07070100E66D37000041ED0000000000000000000000106524747F00000000000000080000000100000000000000000000000200000000.07070100E66EFF000041ED00000000000000000000000B6524747F00000000000000080000000100000000000000000000000400000000lib07070100E6724F000041ED0000000000000000000000036524747F00000000000000080000000100000000000000000000000E00000000lib/functions07070100E67250000081A40000000000000000000000016524747F00001079000000080000000100000000000000000000001900000000lib/functions/caldata.sh# Copyright (C) 2019 OpenWrt.org . /lib/functions.sh . /lib/functions/system.sh caldata_dd() { local source=$1 local target=$2 local count=$(($3)) local offset=$(($4)) dd if=$source of=$target iflag=skip_bytes,fullblock bs=$count skip=$offset count=1 2>/dev/null return $? } caldata_die() { echo "caldata: " "$*" exit 1 } caldata_extract() { local part=$1 local offset=$(($2)) local count=$(($3)) local mtd mtd=$(find_mtd_chardev $part) [ -n "$mtd" ] || caldata_die "no mtd device found for partition $part" caldata_dd $mtd /lib/firmware/$FIRMWARE $count $offset || \ caldata_die "failed to extract calibration data from $mtd" } caldata_extract_ubi() { local part=$1 local offset=$(($2)) local count=$(($3)) local ubidev local ubi . /lib/upgrade/nand.sh ubidev=$(nand_find_ubi $CI_UBIPART) ubi=$(nand_find_volume $ubidev $part) [ -n "$ubi" ] || caldata_die "no UBI volume found for $part" caldata_dd /dev/$ubi /lib/firmware/$FIRMWARE $count $offset || \ caldata_die "failed to extract calibration data from $ubi" } caldata_extract_mmc() { local part=$1 local offset=$(($2)) local count=$(($3)) local mmc_part mmc_part=$(find_mmc_part $part) [ -n "$mmc_part" ] || caldata_die "no mmc partition found for partition $part" caldata_dd $mmc_part /lib/firmware/$FIRMWARE $count $offset || \ caldata_die "failed to extract calibration data from $mmc_part" } caldata_extract_reverse() { local part=$1 local offset=$2 local count=$(($3)) local mtd local reversed local caldata mtd=$(find_mtd_chardev "$part") reversed=$(hexdump -v -s $offset -n $count -e '/1 "%02x "' $mtd) for byte in $reversed; do caldata="\x${byte}${caldata}" done printf "%b" "$caldata" > /lib/firmware/$FIRMWARE } caldata_from_file() { local source=$1 local offset=$(($2)) local count=$(($3)) local target=$4 [ -n "$target" ] || target=/lib/firmware/$FIRMWARE caldata_dd $source $target $count $offset || \ caldata_die "failed to extract calibration data from $source" } caldata_sysfsload_from_file() { local source=$1 local offset=$(($2)) local count=$(($3)) local target_dir="/sys/$DEVPATH" local target="$target_dir/data" [ -d "$target_dir" ] || \ caldata_die "no sysfs dir to write: $target" echo 1 > "$target_dir/loading" caldata_dd $source $target $count $offset if [ $? != 0 ]; then echo 1 > "$target_dir/loading" caldata_die "failed to extract calibration data from $source" else echo 0 > "$target_dir/loading" fi } caldata_valid() { local expected="$1" local target=$2 [ -n "$target" ] || target=/lib/firmware/$FIRMWARE magic=$(hexdump -v -n 2 -e '1/1 "%02x"' $target) [ "$magic" = "$expected" ] return $? } caldata_patch_chksum() { local mac=$1 local mac_offset=$(($2)) local chksum_offset=$(($3)) local target=$4 local xor_mac local xor_fw_mac local xor_fw_chksum xor_mac=${mac//:/} xor_mac="${xor_mac:0:4} ${xor_mac:4:4} ${xor_mac:8:4}" xor_fw_mac=$(hexdump -v -n 6 -s $mac_offset -e '/1 "%02x"' /lib/firmware/$FIRMWARE) xor_fw_mac="${xor_fw_mac:0:4} ${xor_fw_mac:4:4} ${xor_fw_mac:8:4}" xor_fw_chksum=$(hexdump -v -n 2 -s $chksum_offset -e '/1 "%02x"' /lib/firmware/$FIRMWARE) xor_fw_chksum=$(xor $xor_fw_chksum $xor_fw_mac $xor_mac) printf "%b" "\x${xor_fw_chksum:0:2}\x${xor_fw_chksum:2:2}" | \ dd of=$target conv=notrunc bs=1 seek=$chksum_offset count=2 } caldata_patch_mac() { local mac=$1 local mac_offset=$(($2)) local chksum_offset=$3 local target=$4 [ -z "$mac" -o -z "$mac_offset" ] && return [ -n "$target" ] || target=/lib/firmware/$FIRMWARE [ -n "$chksum_offset" ] && caldata_patch_chksum "$mac" "$mac_offset" "$chksum_offset" "$target" macaddr_2bin $mac | dd of=$target conv=notrunc oflag=seek_bytes bs=6 seek=$mac_offset count=1 || \ caldata_die "failed to write MAC address to eeprom file" } ath9k_patch_mac() { local mac=$1 local target=$2 caldata_patch_mac "$mac" 0x2 "" "$target" } ath9k_patch_mac_crc() { local mac=$1 local mac_offset=$2 local chksum_offset=$((mac_offset - 10)) local target=$4 caldata_patch_mac "$mac" "$mac_offset" "$chksum_offset" "$target" } ath10k_patch_mac() { local mac=$1 local target=$2 caldata_patch_mac "$mac" 0x6 0x2 "$target" } 07070100E67251000081A40000000000000000000000016524747F00000728000000080000000100000000000000000000001600000000lib/functions/leds.sh# Copyright (C) 2013 OpenWrt.org get_dt_led_path() { local ledpath local basepath="/proc/device-tree" local nodepath="$basepath/aliases/led-$1" [ -f "$nodepath" ] && ledpath=$(cat "$nodepath") [ -n "$ledpath" ] && ledpath="$basepath$ledpath" echo "$ledpath" } get_dt_led() { local label local ledpath=$(get_dt_led_path $1) [ -n "$ledpath" ] && \ label=$(cat "$ledpath/label" 2>/dev/null) || \ label=$(cat "$ledpath/chan-name" 2>/dev/null) || \ label=$(basename "$ledpath") echo "$label" } led_set_attr() { [ -f "/sys/class/leds/$1/$2" ] && echo "$3" > "/sys/class/leds/$1/$2" } led_timer() { led_set_attr $1 "trigger" "timer" led_set_attr $1 "delay_on" "$2" led_set_attr $1 "delay_off" "$3" } led_on() { led_set_attr $1 "trigger" "none" led_set_attr $1 "brightness" 255 } led_off() { led_set_attr $1 "trigger" "none" led_set_attr $1 "brightness" 0 } status_led_restore_trigger() { local trigger local ledpath=$(get_dt_led_path $1) [ -n "$ledpath" ] && \ trigger=$(cat "$ledpath/linux,default-trigger" 2>/dev/null) [ -n "$trigger" ] && \ led_set_attr "$(get_dt_led $1)" "trigger" "$trigger" } status_led_set_timer() { led_timer $status_led "$1" "$2" [ -n "$status_led2" ] && led_timer $status_led2 "$1" "$2" } status_led_set_heartbeat() { led_set_attr $status_led "trigger" "heartbeat" } status_led_on() { led_on $status_led [ -n "$status_led2" ] && led_on $status_led2 } status_led_off() { led_off $status_led [ -n "$status_led2" ] && led_off $status_led2 } status_led_blink_slow() { led_timer $status_led 1000 1000 } status_led_blink_fast() { led_timer $status_led 100 100 } status_led_blink_preinit() { led_timer $status_led 100 100 } status_led_blink_failsafe() { led_timer $status_led 50 50 } status_led_blink_preinit_regular() { led_timer $status_led 200 200 } 07070100E67CA9000081A40000000000000000000000016524747F00003636000000080000000100000000000000000000001700000000lib/functions/procd.sh# procd API: # # procd_open_service(name, [script]): # Initialize a new procd command message containing a service with one or more instances # # procd_close_service() # Send the command message for the service # # procd_open_instance([name]): # Add an instance to the service described by the previous procd_open_service call # # procd_set_param(type, [value...]) # Available types: # command: command line (array). # respawn info: array with 3 values $fail_threshold $restart_timeout $max_fail # env: environment variable (passed to the process) # data: arbitrary name/value pairs for detecting config changes (table) # file: configuration files (array) # netdev: bound network device (detects ifindex changes) # limits: resource limits (passed to the process) # user: $username to run service as # group: $groupname to run service as # pidfile: file name to write pid into # stdout: boolean whether to redirect commands stdout to syslog (default: 0) # stderr: boolean whether to redirect commands stderr to syslog (default: 0) # facility: syslog facility used when logging to syslog (default: daemon) # # No space separation is done for arrays/tables - use one function argument per command line argument # # procd_close_instance(): # Complete the instance being prepared # # procd_running(service, [instance]): # Checks if service/instance is currently running # # procd_kill(service, [instance]): # Kill a service instance (or all instances) # # procd_send_signal(service, [instance], [signal]) # Send a signal to a service instance (or all instances) # . "$IPKG_INSTROOT/usr/share/libubox/jshn.sh" PROCD_RELOAD_DELAY=1000 _PROCD_SERVICE= procd_lock() { local basescript=$(readlink "$initscript") local service_name="$(basename ${basescript:-$initscript})" flock -n 1000 &> /dev/null if [ "$?" != "0" ]; then exec 1000>"$IPKG_INSTROOT/var/lock/procd_${service_name}.lock" flock 1000 if [ "$?" != "0" ]; then logger "warning: procd flock for $service_name failed" fi fi } _procd_call() { local old_cb json_set_namespace procd old_cb "$@" json_set_namespace $old_cb } _procd_wrapper() { procd_lock while [ -n "$1" ]; do eval "$1() { _procd_call _$1 \"\$@\"; }" shift done } _procd_ubus_call() { local cmd="$1" [ -n "$PROCD_DEBUG" ] && json_dump >&2 ubus call service "$cmd" "$(json_dump)" json_cleanup } _procd_open_service() { local name="$1" local script="$2" _PROCD_SERVICE="$name" _PROCD_INSTANCE_SEQ=0 json_init json_add_string name "$name" [ -n "$script" ] && json_add_string script "$script" json_add_object instances } _procd_close_service() { json_close_object _procd_open_trigger service_triggers _procd_close_trigger _procd_open_data service_data _procd_close_data _procd_ubus_call ${1:-set} } _procd_add_array_data() { while [ "$#" -gt 0 ]; do json_add_string "" "$1" shift done } _procd_add_array() { json_add_array "$1" shift _procd_add_array_data "$@" json_close_array } _procd_add_table_data() { while [ -n "$1" ]; do local var="${1%%=*}" local val="${1#*=}" [ "$1" = "$val" ] && val= json_add_string "$var" "$val" shift done } _procd_add_table() { json_add_object "$1" shift _procd_add_table_data "$@" json_close_object } _procd_open_instance() { local name="$1"; shift _PROCD_INSTANCE_SEQ="$(($_PROCD_INSTANCE_SEQ + 1))" name="${name:-instance$_PROCD_INSTANCE_SEQ}" json_add_object "$name" [ -n "$TRACE_SYSCALLS" ] && json_add_boolean trace "1" } _procd_open_trigger() { let '_procd_trigger_open = _procd_trigger_open + 1' [ "$_procd_trigger_open" -gt 1 ] && return json_add_array "triggers" } _procd_close_trigger() { let '_procd_trigger_open = _procd_trigger_open - 1' [ "$_procd_trigger_open" -lt 1 ] || return json_close_array } _procd_open_data() { let '_procd_data_open = _procd_data_open + 1' [ "$_procd_data_open" -gt 1 ] && return json_add_object "data" } _procd_close_data() { let '_procd_data_open = _procd_data_open - 1' [ "$_procd_data_open" -lt 1 ] || return json_close_object } _procd_open_validate() { json_select .. json_add_array "validate" } _procd_close_validate() { json_close_array json_select triggers } _procd_add_jail() { json_add_object "jail" json_add_string name "$1" shift for a in $@; do case $a in log) json_add_boolean "log" "1";; ubus) json_add_boolean "ubus" "1";; procfs) json_add_boolean "procfs" "1";; sysfs) json_add_boolean "sysfs" "1";; ronly) json_add_boolean "ronly" "1";; requirejail) json_add_boolean "requirejail" "1";; netns) json_add_boolean "netns" "1";; userns) json_add_boolean "userns" "1";; cgroupsns) json_add_boolean "cgroupsns" "1";; esac done json_add_object "mount" json_close_object json_close_object } _procd_add_jail_mount() { local _json_no_warning=1 json_select "jail" [ $? = 0 ] || return json_select "mount" [ $? = 0 ] || { json_select .. return } for a in $@; do json_add_string "$a" "0" done json_select .. json_select .. } _procd_add_jail_mount_rw() { local _json_no_warning=1 json_select "jail" [ $? = 0 ] || return json_select "mount" [ $? = 0 ] || { json_select .. return } for a in $@; do json_add_string "$a" "1" done json_select .. json_select .. } _procd_set_param() { local type="$1"; shift case "$type" in env|data|limits) _procd_add_table "$type" "$@" ;; command|netdev|file|respawn|watch|watchdog) _procd_add_array "$type" "$@" ;; error) json_add_array "$type" json_add_string "" "$@" json_close_array ;; nice|term_timeout) json_add_int "$type" "$1" ;; reload_signal) json_add_int "$type" $(kill -l "$1") ;; pidfile|user|group|seccomp|capabilities|facility|\ extroot|overlaydir|tmpoverlaysize) json_add_string "$type" "$1" ;; stdout|stderr|no_new_privs) json_add_boolean "$type" "$1" ;; esac } _procd_add_timeout() { [ "$PROCD_RELOAD_DELAY" -gt 0 ] && json_add_int "" "$PROCD_RELOAD_DELAY" return 0 } _procd_add_interface_trigger() { json_add_array _procd_add_array_data "$1" shift json_add_array _procd_add_array_data "if" json_add_array _procd_add_array_data "eq" "interface" "$1" shift json_close_array json_add_array _procd_add_array_data "run_script" "$@" json_close_array json_close_array _procd_add_timeout json_close_array } _procd_add_reload_interface_trigger() { local script=$(readlink "$initscript") local name=$(basename ${script:-$initscript}) _procd_open_trigger _procd_add_interface_trigger "interface.*" $1 /etc/init.d/$name reload _procd_close_trigger } _procd_add_config_trigger() { json_add_array _procd_add_array_data "$1" shift json_add_array _procd_add_array_data "if" json_add_array _procd_add_array_data "eq" "package" "$1" shift json_close_array json_add_array _procd_add_array_data "run_script" "$@" json_close_array json_close_array _procd_add_timeout json_close_array } _procd_add_mount_trigger() { json_add_array _procd_add_array_data "$1" local action="$2" local multi=0 shift ; shift json_add_array _procd_add_array_data "if" if [ "$2" ]; then json_add_array _procd_add_array_data "or" multi=1 fi while [ "$1" ]; do json_add_array _procd_add_array_data "eq" "target" "$1" shift json_close_array done [ $multi = 1 ] && json_close_array json_add_array _procd_add_array_data "run_script" /etc/init.d/$name $action json_close_array json_close_array _procd_add_timeout json_close_array } _procd_add_action_mount_trigger() { local action="$1" shift local mountpoints="$(procd_get_mountpoints "$@")" [ "${mountpoints//[[:space:]]}" ] || return 0 local script=$(readlink "$initscript") local name=$(basename ${script:-$initscript}) _procd_open_trigger _procd_add_mount_trigger mount.add $action "$mountpoints" _procd_close_trigger } procd_get_mountpoints() { ( __procd_check_mount() { local cfg="$1" local path="${2%%/}/" local target config_get target "$cfg" target target="${target%%/}/" [ "$path" != "${path##$target}" ] && echo "${target%%/}" } local mpath config_load fstab for mpath in "$@"; do config_foreach __procd_check_mount mount "$mpath" done ) | sort -u } _procd_add_restart_mount_trigger() { _procd_add_action_mount_trigger restart "$@" } _procd_add_reload_mount_trigger() { _procd_add_action_mount_trigger reload "$@" } _procd_add_raw_trigger() { json_add_array _procd_add_array_data "$1" shift local timeout=$1 shift json_add_array json_add_array _procd_add_array_data "run_script" "$@" json_close_array json_close_array json_add_int "" "$timeout" json_close_array } _procd_add_reload_trigger() { local script=$(readlink "$initscript") local name=$(basename ${script:-$initscript}) local file _procd_open_trigger for file in "$@"; do _procd_add_config_trigger "config.change" "$file" /etc/init.d/$name reload done _procd_close_trigger } _procd_add_validation() { _procd_open_validate $@ _procd_close_validate } _procd_append_param() { local type="$1"; shift local _json_no_warning=1 json_select "$type" [ $? = 0 ] || { _procd_set_param "$type" "$@" return } case "$type" in env|data|limits) _procd_add_table_data "$@" ;; command|netdev|file|respawn|watch|watchdog) _procd_add_array_data "$@" ;; error) json_add_string "" "$@" ;; esac json_select .. } _procd_close_instance() { local respawn_vals _json_no_warning=1 if json_select respawn ; then json_get_values respawn_vals if [ -z "$respawn_vals" ]; then local respawn_threshold=$(uci_get system.@service[0].respawn_threshold) local respawn_timeout=$(uci_get system.@service[0].respawn_timeout) local respawn_retry=$(uci_get system.@service[0].respawn_retry) _procd_add_array_data ${respawn_threshold:-3600} ${respawn_timeout:-5} ${respawn_retry:-5} fi json_select .. fi json_close_object } _procd_add_instance() { _procd_open_instance _procd_set_param command "$@" _procd_close_instance } procd_running() { local service="$1" local instance="${2:-*}" [ "$instance" = "*" ] || instance="'$instance'" json_init json_add_string name "$service" local running=$(_procd_ubus_call list | jsonfilter -l 1 -e "@['$service'].instances[$instance].running") [ "$running" = "true" ] } _procd_kill() { local service="$1" local instance="$2" json_init [ -n "$service" ] && json_add_string name "$service" [ -n "$instance" ] && json_add_string instance "$instance" _procd_ubus_call delete } _procd_send_signal() { local service="$1" local instance="$2" local signal="$3" case "$signal" in [A-Z]*) signal="$(kill -l "$signal" 2>/dev/null)" || return 1;; esac json_init json_add_string name "$service" [ -n "$instance" -a "$instance" != "*" ] && json_add_string instance "$instance" [ -n "$signal" ] && json_add_int signal "$signal" _procd_ubus_call signal } _procd_status() { local service="$1" local instance="$2" local data json_init [ -n "$service" ] && json_add_string name "$service" data=$(_procd_ubus_call list | jsonfilter -e '@["'"$service"'"]') [ -z "$data" ] && { echo "inactive"; return 3; } data=$(echo "$data" | jsonfilter -e '$.instances') if [ -z "$data" ]; then [ -z "$instance" ] && { echo "active with no instances"; return 0; } data="[]" fi [ -n "$instance" ] && instance="\"$instance\"" || instance='*' if [ -z "$(echo "$data" | jsonfilter -e '$['"$instance"']')" ]; then echo "unknown instance $instance"; return 4 else echo "running"; return 0 fi } procd_open_data() { local name="$1" json_set_namespace procd __procd_old_cb json_add_object data } procd_close_data() { json_close_object json_set_namespace $__procd_old_cb } _procd_set_config_changed() { local package="$1" json_init json_add_string type config.change json_add_object data json_add_string package "$package" json_close_object ubus call service event "$(json_dump)" } procd_add_mdns_service() { local service proto port service=$1; shift proto=$1; shift port=$1; shift json_add_object "${service}_$port" json_add_string "service" "_$service._$proto.local" json_add_int port "$port" [ -n "$1" ] && { json_add_array txt for txt in "$@"; do json_add_string "" "$txt"; done json_select .. } json_select .. } procd_add_mdns() { procd_open_data json_add_object "mdns" procd_add_mdns_service "$@" json_close_object procd_close_data } uci_validate_section() { local _package="$1" local _type="$2" local _name="$3" local _result local _error shift; shift; shift _result=$(/sbin/validate_data "$_package" "$_type" "$_name" "$@" 2> /dev/null) _error=$? eval "$_result" [ "$_error" = "0" ] || $(/sbin/validate_data "$_package" "$_type" "$_name" "$@" 1> /dev/null) return $_error } uci_load_validate() { local _package="$1" local _type="$2" local _name="$3" local _function="$4" local _option local _result shift; shift; shift; shift for _option in "$@"; do eval "local ${_option%%:*}" done uci_validate_section "$_package" "$_type" "$_name" "$@" _result=$? [ -n "$_function" ] || return $_result eval "$_function \"\$_name\" \"\$_result\"" } _procd_wrapper \ procd_open_service \ procd_close_service \ procd_add_instance \ procd_add_raw_trigger \ procd_add_config_trigger \ procd_add_interface_trigger \ procd_add_mount_trigger \ procd_add_reload_trigger \ procd_add_reload_interface_trigger \ procd_add_action_mount_trigger \ procd_add_reload_mount_trigger \ procd_add_restart_mount_trigger \ procd_open_trigger \ procd_close_trigger \ procd_open_instance \ procd_close_instance \ procd_open_validate \ procd_close_validate \ procd_add_jail \ procd_add_jail_mount \ procd_add_jail_mount_rw \ procd_set_param \ procd_append_param \ procd_add_validation \ procd_set_config_changed \ procd_kill \ procd_send_signal 07070100E67255000081A40000000000000000000000016524747F00000ABC000000080000000100000000000000000000001900000000lib/functions/service.sh# # service: simple wrapper around start-stop-daemon # # Usage: service ACTION EXEC ARGS... # # Action: # -C check if EXEC is alive # -S start EXEC, passing it ARGS as its arguments # -K kill EXEC, sending it a TERM signal if not specified otherwise # # Environment variables exposed: # SERVICE_DAEMONIZE run EXEC in background # SERVICE_WRITE_PID create a pid-file and use it for matching # SERVICE_MATCH_EXEC use EXEC command-line for matching (default) # SERVICE_MATCH_NAME use EXEC process name for matching # SERVICE_USE_PID assume EXEC create its own pid-file and use it for matching # SERVICE_NAME process name to use (default to EXEC file part) # SERVICE_PID_FILE pid file to use (default to /var/run/$SERVICE_NAME.pid) # SERVICE_SIG signal to send when using -K # SERVICE_SIG_RELOAD default signal used when reloading # SERVICE_SIG_STOP default signal used when stopping # SERVICE_STOP_TIME time to wait for a process to stop gracefully before killing it # SERVICE_UID user EXEC should be run as # SERVICE_GID group EXEC should be run as # # SERVICE_DEBUG don't do anything, but show what would be done # SERVICE_QUIET don't print anything # SERVICE_QUIET=1 SERVICE_SIG_RELOAD="HUP" SERVICE_SIG_STOP="TERM" SERVICE_STOP_TIME=5 SERVICE_MATCH_EXEC=1 service() { local ssd local exec local name local start ssd="${SERVICE_DEBUG:+echo }start-stop-daemon${SERVICE_QUIET:+ -q}" case "$1" in -C) ssd="$ssd -K -t" ;; -S) ssd="$ssd -S${SERVICE_DAEMONIZE:+ -b}${SERVICE_WRITE_PID:+ -m}" start=1 ;; -K) ssd="$ssd -K${SERVICE_SIG:+ -s $SERVICE_SIG}" ;; *) echo "service: unknown ACTION '$1'" 1>&2 return 1 esac shift exec="$1" [ -n "$exec" ] || { echo "service: missing argument" 1>&2 return 1 } [ -x "$exec" ] || { echo "service: file '$exec' is not executable" 1>&2 return 1 } name="${SERVICE_NAME:-${exec##*/}}" [ -z "$SERVICE_USE_PID$SERVICE_WRITE_PID$SERVICE_PID_FILE" ] \ || ssd="$ssd -p ${SERVICE_PID_FILE:-/var/run/$name.pid}" [ -z "$SERVICE_MATCH_NAME" ] || ssd="$ssd -n $name" ssd="$ssd${SERVICE_UID:+ -c $SERVICE_UID${SERVICE_GID:+:$SERVICE_GID}}" [ -z "$SERVICE_MATCH_EXEC$start" ] || ssd="$ssd -x $exec" shift $ssd${1:+ -- "$@"} } service_check() { service -C "$@" } service_signal() { SERVICE_SIG="${SERVICE_SIG:-USR1}" service -K "$@" } service_start() { service -S "$@" } service_stop() { local try SERVICE_SIG="${SERVICE_SIG:-$SERVICE_SIG_STOP}" service -K "$@" || return 1 while [ $((try++)) -lt $SERVICE_STOP_TIME ]; do service -C "$@" || return 0 sleep 1 done SERVICE_SIG="KILL" service -K "$@" sleep 1 ! service -C "$@" } service_reload() { SERVICE_SIG="${SERVICE_SIG:-$SERVICE_SIG_RELOAD}" service -K "$@" } 07070100E67257000081A40000000000000000000000016524747F00003415000000080000000100000000000000000000001E00000000lib/functions/uci-defaults.sh. /lib/functions.sh . /usr/share/libubox/jshn.sh json_select_array() { local _json_no_warning=1 json_select "$1" [ $? = 0 ] && return json_add_array "$1" json_close_array json_select "$1" } json_select_object() { local _json_no_warning=1 json_select "$1" [ $? = 0 ] && return json_add_object "$1" json_close_object json_select "$1" } ucidef_set_interface() { local network=$1; shift [ -z "$network" ] && return json_select_object network json_select_object "$network" while [ -n "$1" ]; do local opt=$1; shift local val=$1; shift [ -n "$opt" -a -n "$val" ] || break [ "$opt" = "device" -a "$val" != "${val/ //}" ] && { json_select_array "ports" for e in $val; do json_add_string "" "$e"; done json_close_array } || { json_add_string "$opt" "$val" } done if ! json_is_a protocol string; then case "$network" in lan) json_add_string protocol static ;; wan) json_add_string protocol dhcp ;; *) json_add_string protocol none ;; esac fi json_select .. json_select .. } ucidef_set_board_id() { json_select_object model json_add_string id "$1" json_select .. } ucidef_set_model_name() { json_select_object model json_add_string name "$1" json_select .. } ucidef_set_compat_version() { json_select_object system json_add_string compat_version "${1:-1.0}" json_select .. } ucidef_set_interface_lan() { ucidef_set_interface "lan" device "$1" protocol "${2:-static}" } ucidef_set_interface_wan() { ucidef_set_interface "wan" device "$1" protocol "${2:-dhcp}" } ucidef_set_interfaces_lan_wan() { local lan_if="$1" local wan_if="$2" ucidef_set_interface_lan "$lan_if" ucidef_set_interface_wan "$wan_if" } ucidef_set_bridge_device() { json_select_object bridge json_add_string name "${1:-switch0}" json_select .. } ucidef_set_bridge_mac() { json_select_object bridge json_add_string macaddr "${1}" json_select .. } ucidef_set_network_device_mac() { json_select_object "network-device" json_select_object "${1}" json_add_string macaddr "${2}" json_select .. json_select .. } ucidef_set_network_device_path() { json_select_object "network_device" json_select_object "$1" json_add_string path "$2" json_select .. json_select .. } _ucidef_add_switch_port() { # inherited: $num $device $need_tag $want_untag $role $index $prev_role # inherited: $n_cpu $n_ports $n_vlan $cpu0 $cpu1 $cpu2 $cpu3 $cpu4 $cpu5 n_ports=$((n_ports + 1)) json_select_array ports json_add_object json_add_int num "$num" [ -n "$device" ] && json_add_string device "$device" [ -n "$need_tag" ] && json_add_boolean need_tag "$need_tag" [ -n "$want_untag" ] && json_add_boolean want_untag "$want_untag" [ -n "$role" ] && json_add_string role "$role" [ -n "$index" ] && json_add_int index "$index" json_close_object json_select .. # record pointer to cpu entry for lookup in _ucidef_finish_switch_roles() [ -n "$device" ] && { export "cpu$n_cpu=$n_ports" n_cpu=$((n_cpu + 1)) } # create/append object to role list [ -n "$role" ] && { json_select_array roles if [ "$role" != "$prev_role" ]; then json_add_object json_add_string role "$role" json_add_string ports "$num" json_close_object prev_role="$role" n_vlan=$((n_vlan + 1)) else json_select_object "$n_vlan" json_get_var port ports json_add_string ports "$port $num" json_select .. fi json_select .. } } _ucidef_finish_switch_roles() { # inherited: $name $n_cpu $n_vlan $cpu0 $cpu1 $cpu2 $cpu3 $cpu4 $cpu5 local index role roles num device need_tag want_untag port ports json_select switch json_select "$name" json_get_keys roles roles json_select .. json_select .. for index in $roles; do eval "port=\$cpu$(((index - 1) % n_cpu))" json_select switch json_select "$name" json_select ports json_select "$port" json_get_vars num device need_tag want_untag json_select .. json_select .. if [ ${need_tag:-0} -eq 1 -o ${want_untag:-0} -ne 1 ]; then num="${num}t" device="${device}.${index}" fi json_select roles json_select "$index" json_get_vars role ports json_add_string ports "$ports $num" json_add_string device "$device" json_select .. json_select .. json_select .. json_select .. json_select_object network local devices json_select_object "$role" # attach previous interfaces (for multi-switch devices) json_get_var devices device if ! list_contains devices "$device"; then devices="${devices:+$devices }$device" fi json_select .. json_select .. ucidef_set_interface "$role" device "$devices" done } ucidef_set_ar8xxx_switch_mib() { local name="$1" local type="$2" local interval="$3" json_select_object switch json_select_object "$name" json_add_int ar8xxx_mib_type $type json_add_int ar8xxx_mib_poll_interval $interval json_select .. json_select .. } ucidef_add_switch() { local name="$1"; shift local port num role device index need_tag prev_role local cpu0 cpu1 cpu2 cpu3 cpu4 cpu5 local n_cpu=0 n_vlan=0 n_ports=0 json_select_object switch json_select_object "$name" json_add_boolean enable 1 json_add_boolean reset 1 for port in "$@"; do case "$port" in [0-9]*@*) num="${port%%@*}" device="${port##*@}" need_tag=0 want_untag=0 [ "${num%t}" != "$num" ] && { num="${num%t}" need_tag=1 } [ "${num%u}" != "$num" ] && { num="${num%u}" want_untag=1 } ;; [0-9]*:*:[0-9]*) num="${port%%:*}" index="${port##*:}" role="${port#[0-9]*:}"; role="${role%:*}" ;; [0-9]*:*) num="${port%%:*}" role="${port##*:}" ;; esac if [ -n "$num" ] && [ -n "$device$role" ]; then _ucidef_add_switch_port fi unset num device role index need_tag want_untag done json_select .. json_select .. _ucidef_finish_switch_roles } ucidef_add_switch_attr() { local name="$1" local key="$2" local val="$3" json_select_object switch json_select_object "$name" case "$val" in true|false) [ "$val" != "true" ]; json_add_boolean "$key" $? ;; [0-9]) json_add_int "$key" "$val" ;; *) json_add_string "$key" "$val" ;; esac json_select .. json_select .. } ucidef_add_switch_port_attr() { local name="$1" local port="$2" local key="$3" local val="$4" local ports i num json_select_object switch json_select_object "$name" json_get_keys ports ports json_select_array ports for i in $ports; do json_select "$i" json_get_var num num if [ -n "$num" ] && [ $num -eq $port ]; then json_select_object attr case "$val" in true|false) [ "$val" != "true" ]; json_add_boolean "$key" $? ;; [0-9]) json_add_int "$key" "$val" ;; *) json_add_string "$key" "$val" ;; esac json_select .. fi json_select .. done json_select .. json_select .. json_select .. } ucidef_set_interface_macaddr() { local network="$1" local macaddr="$2" ucidef_set_interface "$network" macaddr "$macaddr" } ucidef_set_label_macaddr() { local macaddr="$1" json_select_object system json_add_string label_macaddr "$macaddr" json_select .. } ucidef_add_atm_bridge() { local vpi="$1" local vci="$2" local encaps="$3" local payload="$4" local nameprefix="$5" json_select_object dsl json_select_object atmbridge json_add_int vpi "$vpi" json_add_int vci "$vci" json_add_string encaps "$encaps" json_add_string payload "$payload" json_add_string nameprefix "$nameprefix" json_select .. json_select .. } ucidef_add_adsl_modem() { local annex="$1" local firmware="$2" json_select_object dsl json_select_object modem json_add_string type "adsl" json_add_string annex "$annex" json_add_string firmware "$firmware" json_select .. json_select .. } ucidef_add_vdsl_modem() { local annex="$1" local tone="$2" local xfer_mode="$3" json_select_object dsl json_select_object modem json_add_string type "vdsl" json_add_string annex "$annex" json_add_string tone "$tone" json_add_string xfer_mode "$xfer_mode" json_select .. json_select .. } ucidef_set_led_ataport() { _ucidef_set_led_trigger "$1" "$2" "$3" ata"$4" } _ucidef_set_led_common() { local cfg="led_$1" local name="$2" local sysfs="$3" json_select_object led json_select_object "$1" json_add_string name "$name" json_add_string sysfs "$sysfs" } ucidef_set_led_default() { local default="$4" _ucidef_set_led_common "$1" "$2" "$3" json_add_string default "$default" json_select .. json_select .. } ucidef_set_led_heartbeat() { _ucidef_set_led_common "$1" "$2" "$3" json_add_string trigger heartbeat json_select .. json_select .. } ucidef_set_led_gpio() { local gpio="$4" local inverted="$5" _ucidef_set_led_common "$1" "$2" "$3" json_add_string trigger "$trigger" json_add_string type gpio json_add_int gpio "$gpio" json_add_boolean inverted "$inverted" json_select .. json_select .. } ucidef_set_led_ide() { _ucidef_set_led_trigger "$1" "$2" "$3" disk-activity } ucidef_set_led_netdev() { local dev="$4" local mode="${5:-link tx rx}" _ucidef_set_led_common "$1" "$2" "$3" json_add_string type netdev json_add_string device "$dev" json_add_string mode "$mode" json_select .. json_select .. } ucidef_set_led_oneshot() { _ucidef_set_led_timer $1 $2 $3 "oneshot" $4 $5 } ucidef_set_led_portstate() { local port_state="$4" _ucidef_set_led_common "$1" "$2" "$3" json_add_string trigger port_state json_add_string type portstate json_add_string port_state "$port_state" json_select .. json_select .. } ucidef_set_led_rssi() { local iface="$4" local minq="$5" local maxq="$6" local offset="${7:-0}" local factor="${8:-1}" _ucidef_set_led_common "$1" "$2" "$3" json_add_string type rssi json_add_string name "$name" json_add_string iface "$iface" json_add_string minq "$minq" json_add_string maxq "$maxq" json_add_string offset "$offset" json_add_string factor "$factor" json_select .. json_select .. } ucidef_set_led_switch() { local trigger_name="$4" local port_mask="$5" local speed_mask="$6" local mode="$7" _ucidef_set_led_common "$1" "$2" "$3" json_add_string trigger "$trigger_name" json_add_string type switch json_add_string mode "$mode" json_add_string port_mask "$port_mask" json_add_string speed_mask "$speed_mask" json_select .. json_select .. } _ucidef_set_led_timer() { local trigger_name="$4" local delayon="$5" local delayoff="$6" _ucidef_set_led_common "$1" "$2" "$3" json_add_string type "$trigger_name" json_add_string trigger "$trigger_name" json_add_int delayon "$delayon" json_add_int delayoff "$delayoff" json_select .. json_select .. } ucidef_set_led_timer() { _ucidef_set_led_timer $1 $2 $3 "timer" $4 $5 } _ucidef_set_led_trigger() { local trigger_name="$4" _ucidef_set_led_common "$1" "$2" "$3" json_add_string trigger "$trigger_name" json_select .. json_select .. } ucidef_set_led_usbdev() { local dev="$4" _ucidef_set_led_common "$1" "$2" "$3" json_add_string type usb json_add_string device "$dev" json_select .. json_select .. } ucidef_set_led_usbhost() { _ucidef_set_led_trigger "$1" "$2" "$3" usb-host } ucidef_set_led_usbport() { local obj="$1" local name="$2" local sysfs="$3" shift shift shift _ucidef_set_led_common "$obj" "$name" "$sysfs" json_add_string type usbport json_select_array ports for port in "$@"; do json_add_string port "$port" done json_select .. json_select .. json_select .. } ucidef_set_led_wlan() { _ucidef_set_led_trigger "$1" "$2" "$3" "$4" } ucidef_set_rssimon() { local dev="$1" local refresh="$2" local threshold="$3" json_select_object rssimon json_select_object "$dev" [ -n "$refresh" ] && json_add_int refresh "$refresh" [ -n "$threshold" ] && json_add_int threshold "$threshold" json_select .. json_select .. } ucidef_add_gpio_switch() { local cfg="$1" local name="$2" local pin="$3" local default="${4:-0}" json_select_object gpioswitch json_select_object "$cfg" json_add_string name "$name" json_add_string pin "$pin" json_add_int default "$default" json_select .. json_select .. } ucidef_set_hostname() { local hostname="$1" json_select_object system json_add_string hostname "$hostname" json_select .. } ucidef_set_ntpserver() { local server json_select_object system json_select_array ntpserver for server in "$@"; do json_add_string "" "$server" done json_select .. json_select .. } ucidef_add_wlan() { local path="$1"; shift ucidef_wlan_idx=${ucidef_wlan_idx:-0} json_select_object wlan json_select_object "wl$ucidef_wlan_idx" json_add_string path "$path" json_add_fields "$@" json_select .. json_select .. ucidef_wlan_idx="$((ucidef_wlan_idx + 1))" } board_config_update() { json_init [ -f ${CFG} ] && json_load "$(cat ${CFG})" # auto-initialize model id and name if applicable if ! json_is_a model object; then json_select_object model [ -f "/tmp/sysinfo/board_name" ] && \ json_add_string id "$(cat /tmp/sysinfo/board_name)" [ -f "/tmp/sysinfo/model" ] && \ json_add_string name "$(cat /tmp/sysinfo/model)" json_select .. fi } board_config_flush() { json_dump -i -o ${CFG} } 07070100E67253000081A40000000000000000000000016524747F00002137000000080000000100000000000000000000001900000000lib/functions/network.sh# 1: destination variable # 2: interface # 3: path # 4: separator # 5: limit __network_ifstatus() { local __tmp [ -z "$__NETWORK_CACHE" ] && { __tmp="$(ubus call network.interface dump 2>&1)" case "$?" in 4) : ;; 0) export __NETWORK_CACHE="$__tmp" ;; *) echo "$__tmp" >&2 ;; esac } __tmp="$(jsonfilter ${4:+-F "$4"} ${5:+-l "$5"} -s "${__NETWORK_CACHE:-{}}" -e "$1=@.interface${2:+[@.interface='$2']}$3")" [ -z "$__tmp" ] && \ unset "$1" && \ return 1 eval "$__tmp" } # determine first IPv4 address of given logical interface # 1: destination variable # 2: interface network_get_ipaddr() { __network_ifstatus "$1" "$2" "['ipv4-address'][0].address"; } # determine first IPv6 address of given logical interface # 1: destination variable # 2: interface network_get_ipaddr6() { __network_ifstatus "$1" "$2" "['ipv6-address'][0].address" || \ __network_ifstatus "$1" "$2" "['ipv6-prefix-assignment'][0]['local-address'].address" || \ return 1 } # determine first IPv4 subnet of given logical interface # 1: destination variable # 2: interface network_get_subnet() { __network_ifstatus "$1" "$2" "['ipv4-address'][0]['address','mask']" "/" } # determine first IPv6 subnet of given logical interface # 1: destination variable # 2: interface network_get_subnet6() { local __nets __addr if network_get_subnets6 __nets "$2"; then # Attempt to return first non-fe80::/10, non-fc::/7 range for __addr in $__nets; do case "$__addr" in fe[8ab]?:*|f[cd]??:*) continue esac export "$1=$__addr" return 0 done # Attempt to return first non-fe80::/10 range for __addr in $__nets; do case "$__addr" in fe[8ab]?:*) continue esac export "$1=$__addr" return 0 done # Return first item for __addr in $__nets; do export "$1=$__addr" return 0 done fi unset "$1" return 1 } # determine first IPv6 prefix of given logical interface # 1: destination variable # 2: interface network_get_prefix6() { __network_ifstatus "$1" "$2" "['ipv6-prefix'][0]['address','mask']" "/" } # determine first IPv6 prefix assignment of given logical interface # 1: destination variable # 2: interface network_get_prefix_assignment6() { __network_ifstatus "$1" "$2" "['ipv6-prefix-assignment'][0]['address','mask']" "/" } # determine all IPv4 addresses of given logical interface # 1: destination variable # 2: interface network_get_ipaddrs() { __network_ifstatus "$1" "$2" "['ipv4-address'][*].address" } # determine all IPv6 addresses of given logical interface # 1: destination variable # 2: interface network_get_ipaddrs6() { local __addr local __list="" if __network_ifstatus "__addr" "$2" "['ipv6-address'][*].address"; then for __addr in $__addr; do __list="${__list:+$__list }${__addr}" done fi if __network_ifstatus "__addr" "$2" "['ipv6-prefix-assignment'][*]['local-address'].address"; then for __addr in $__addr; do __list="${__list:+$__list }${__addr}" done fi if [ -n "$__list" ]; then export "$1=$__list" return 0 fi unset "$1" return 1 } # determine all IP addresses of given logical interface # 1: destination variable # 2: interface network_get_ipaddrs_all() { local __addr __addr6 network_get_ipaddrs __addr "$2" network_get_ipaddrs6 __addr6 "$2" if [ -n "$__addr" -o -n "$__addr6" ]; then export "$1=${__addr:+$__addr }$__addr6" return 0 fi unset "$1" return 1 } # determine all IPv4 subnets of given logical interface # 1: destination variable # 2: interface network_get_subnets() { __network_ifstatus "$1" "$2" "['ipv4-address'][*]['address','mask']" "/ " } # determine all IPv6 subnets of given logical interface # 1: destination variable # 2: interface network_get_subnets6() { local __addr __mask local __list="" if __network_ifstatus "__addr" "$2" "['ipv6-address'][*]['address','mask']" "/ "; then for __addr in $__addr; do __list="${__list:+$__list }${__addr}" done fi if __network_ifstatus "__addr" "$2" "['ipv6-prefix-assignment'][*]['local-address'].address" && \ __network_ifstatus "__mask" "$2" "['ipv6-prefix-assignment'][*].mask"; then for __addr in $__addr; do __list="${__list:+$__list }${__addr}/${__mask%% *}" __mask="${__mask#* }" done fi if [ -n "$__list" ]; then export "$1=$__list" return 0 fi unset "$1" return 1 } # determine all IPv6 prefixes of given logical interface # 1: destination variable # 2: interface network_get_prefixes6() { __network_ifstatus "$1" "$2" "['ipv6-prefix'][*]['address','mask']" "/ " } # determine all IPv6 prefix assignments of given logical interface # 1: destination variable # 2: interface network_get_prefix_assignments6() { __network_ifstatus "$1" "$2" "['ipv6-prefix-assignment'][*]['address','mask']" "/ " } # determine IPv4 gateway of given logical interface # 1: destination variable # 2: interface # 3: consider inactive gateway if "true" (optional) network_get_gateway() { __network_ifstatus "$1" "$2" ".route[@.target='0.0.0.0' && !@.table].nexthop" "" 1 && \ return 0 [ "$3" = 1 -o "$3" = "true" ] && \ __network_ifstatus "$1" "$2" ".inactive.route[@.target='0.0.0.0' && !@.table].nexthop" "" 1 } # determine IPv6 gateway of given logical interface # 1: destination variable # 2: interface # 3: consider inactive gateway if "true" (optional) network_get_gateway6() { __network_ifstatus "$1" "$2" ".route[@.target='::' && !@.table].nexthop" "" 1 && \ return 0 [ "$3" = 1 -o "$3" = "true" ] && \ __network_ifstatus "$1" "$2" ".inactive.route[@.target='::' && !@.table].nexthop" "" 1 } # determine the DNS servers of the given logical interface # 1: destination variable # 2: interface # 3: consider inactive servers if "true" (optional) network_get_dnsserver() { __network_ifstatus "$1" "$2" "['dns-server'][*]" && return 0 [ "$3" = 1 -o "$3" = "true" ] && \ __network_ifstatus "$1" "$2" ".inactive['dns-server'][*]" } # determine the domains of the given logical interface # 1: destination variable # 2: interface # 3: consider inactive domains if "true" (optional) network_get_dnssearch() { __network_ifstatus "$1" "$2" "['dns-search'][*]" && return 0 [ "$3" = 1 -o "$3" = "true" ] && \ __network_ifstatus "$1" "$2" ".inactive['dns-search'][*]" } # 1: destination variable # 2: addr # 3: inactive __network_wan() { __network_ifstatus "$1" "" \ "[@.route[@.target='$2' && !@.table]].interface" "" 1 && \ return 0 [ "$3" = 1 -o "$3" = "true" ] && \ __network_ifstatus "$1" "" \ "[@.inactive.route[@.target='$2' && !@.table]].interface" "" 1 } # find the logical interface which holds the current IPv4 default route # 1: destination variable # 2: consider inactive default routes if "true" (optional) network_find_wan() { __network_wan "$1" "0.0.0.0" "$2"; } # find the logical interface which holds the current IPv6 default route # 1: destination variable # 2: consider inactive default routes if "true" (optional) network_find_wan6() { __network_wan "$1" "::" "$2"; } # test whether the given logical interface is running # 1: interface network_is_up() { local __up __network_ifstatus "__up" "$1" ".up" && [ "$__up" = 1 ] } # determine the protocol of the given logical interface # 1: destination variable # 2: interface network_get_protocol() { __network_ifstatus "$1" "$2" ".proto"; } # determine the uptime of the given logical interface # 1: destination variable # 2: interface network_get_uptime() { __network_ifstatus "$1" "$2" ".uptime"; } # determine the metric of the given logical interface # 1: destination variable # 2: interface network_get_metric() { __network_ifstatus "$1" "$2" ".metric"; } # determine the layer 3 linux network device of the given logical interface # 1: destination variable # 2: interface network_get_device() { __network_ifstatus "$1" "$2" ".l3_device"; } # determine the layer 2 linux network device of the given logical interface # 1: destination variable # 2: interface network_get_physdev() { __network_ifstatus "$1" "$2" ".device"; } # defer netifd actions on the given linux network device # 1: device name network_defer_device() { ubus call network.device set_state \ "$(printf '{ "name": "%s", "defer": true }' "$1")" 2>/dev/null } # continue netifd actions on the given linux network device # 1: device name network_ready_device() { ubus call network.device set_state \ "$(printf '{ "name": "%s", "defer": false }' "$1")" 2>/dev/null } # flush the internal value cache to force re-reading values from ubus network_flush_cache() { unset __NETWORK_CACHE; } 07070100E67252000081A40000000000000000000000016524747F000005B0000000080000000100000000000000000000001C00000000lib/functions/migrations.sh. /lib/functions.sh migrate_led_sysfs() { local cfg="$1"; shift local tuples="$@" local sysfs local name config_get sysfs ${cfg} sysfs config_get name ${cfg} name [ -z "${sysfs}" ] && return for tuple in ${tuples}; do local old=${tuple%=*} local new=${tuple#*=} local new_sysfs new_sysfs=$(echo ${sysfs} | sed "s/${old}/${new}/") [ "${new_sysfs}" = "${sysfs}" ] && continue uci set system.${cfg}.sysfs="${new_sysfs}" logger -t led-migration "sysfs option of LED \"${name}\" updated to ${new_sysfs}" done; } remove_devicename_led_sysfs() { local cfg="$1"; shift local exceptions="$@" local sysfs local name local new_sysfs config_get sysfs ${cfg} sysfs config_get name ${cfg} name # only continue if two or more colons are present echo "${sysfs}" | grep -q ":.*:" || return for exception in ${exceptions}; do # no change if exceptions provided as argument are found for devicename echo "${sysfs}" | grep -q "^${exception}:" && return done new_sysfs=$(echo ${sysfs} | sed "s/^[^:]*://") uci set system.${cfg}.sysfs="${new_sysfs}" logger -t led-migration "sysfs option of LED \"${name}\" updated to ${new_sysfs}" } migrate_leds() { config_load system config_foreach migrate_led_sysfs led "$@" } remove_devicename_leds() { config_load system config_foreach remove_devicename_led_sysfs led "$@" } migrations_apply() { local realm="$1" [ -n "$(uci changes ${realm})" ] && uci -q commit ${realm} } 07070100E67F21000041ED0000000000000000000000026524747F00000000000000080000000100000000000000000000001300000000lib/functions/fsck07070100E67F22000081A40000000000000000000000016524747F00000310000000080000000100000000000000000000001D00000000lib/functions/fsck/e2fsck.sh#!/bin/sh # Copyright 2010 Vertical Communications # Copyright 2012 OpenWrt.org # This is free software, licensed under the GNU General Public License v2. # See /LICENSE for more information. # fsck_e2fsck() { set -o pipefail e2fsck -p "$device" 2>&1 | logger -t "fstab: e2fsck ($device)" local status="$?" set +o pipefail case "$status" in 0|1) ;; #success 2) reboot;; 4) echo "e2fsck ($device): Warning! Uncorrected errors."| logger -t fstab return 1 ;; *) echo "e2fsck ($device): Error $status. Check not complete."| logger -t fstab;; esac return 0 } fsck_ext2() { fsck_e2fsck "$@" } fsck_ext3() { fsck_e2fsck "$@" } fsck_ext4() { fsck_e2fsck "$@" } append libmount_known_fsck "ext2" append libmount_known_fsck "ext3" append libmount_known_fsck "ext4" 07070100E67254000081A40000000000000000000000016524747F00000714000000080000000100000000000000000000001900000000lib/functions/preinit.sh# Copyright (C) 2006-2013 OpenWrt.org # Copyright (C) 2010 Vertical Communications boot_hook_splice_start() { export -n PI_HOOK_SPLICE=1 } boot_hook_splice_finish() { local hook for hook in $PI_STACK_LIST; do local v; eval "v=\${${hook}_splice:+\$${hook}_splice }$hook" export -n "${hook}=${v% }" export -n "${hook}_splice=" done export -n PI_HOOK_SPLICE= } boot_hook_init() { local hook="${1}_hook" export -n "PI_STACK_LIST=${PI_STACK_LIST:+$PI_STACK_LIST }$hook" export -n "$hook=" } boot_hook_add() { local hook="${1}_hook${PI_HOOK_SPLICE:+_splice}" local func="${2}" [ -n "$func" ] && { local v; eval "v=\$$hook" export -n "$hook=${v:+$v }$func" } } boot_hook_shift() { local hook="${1}_hook" local rvar="${2}" local v; eval "v=\$$hook" [ -n "$v" ] && { local first="${v%% *}" [ "$v" != "${v#* }" ] && \ export -n "$hook=${v#* }" || \ export -n "$hook=" export -n "$rvar=$first" return 0 } return 1 } boot_run_hook() { local hook="$1" local func while boot_hook_shift "$hook" func; do local ran; eval "ran=\$PI_RAN_$func" [ -n "$ran" ] || { export -n "PI_RAN_$func=1" $func "$1" "$2" } done } pivot() { # /bin/mount -o noatime,move /proc $1/proc && \ pivot_root $1 $1$2 && { /bin/mount -o noatime,move $2/dev /dev /bin/mount -o noatime,move $2/tmp /tmp /bin/mount -o noatime,move $2/sys /sys 2>&- /bin/mount -o noatime,move $2/overlay /overlay 2>&- return 0 } } fopivot() { # /bin/mount -o noatime,lowerdir=/,upperdir=$1,workdir=$2 -t overlay "overlayfs:$1" /mnt pivot /mnt $3 } ramoverlay() { mkdir -p /tmp/root /bin/mount -t tmpfs -o noatime,mode=0755 root /tmp/root mkdir -p /tmp/root/root /tmp/root/work fopivot /tmp/root/root /tmp/root/work /rom 1 } 07070100E67256000081A40000000000000000000000016524747F000019AA000000080000000100000000000000000000001800000000lib/functions/system.sh# Copyright (C) 2006-2013 OpenWrt.org . /lib/functions.sh . /usr/share/libubox/jshn.sh get_mac_binary() { local path="$1" local offset="$2" if ! [ -e "$path" ]; then echo "get_mac_binary: file $path not found!" >&2 return fi hexdump -v -n 6 -s $offset -e '5/1 "%02x:" 1/1 "%02x"' $path 2>/dev/null } get_mac_label_dt() { local basepath="/proc/device-tree" local macdevice="$(cat "$basepath/aliases/label-mac-device" 2>/dev/null)" local macaddr [ -n "$macdevice" ] || return macaddr=$(get_mac_binary "$basepath/$macdevice/mac-address" 0 2>/dev/null) [ -n "$macaddr" ] || macaddr=$(get_mac_binary "$basepath/$macdevice/local-mac-address" 0 2>/dev/null) echo $macaddr } get_mac_label_json() { local cfg="/etc/board.json" local macaddr [ -s "$cfg" ] || return json_init json_load "$(cat $cfg)" if json_is_a system object; then json_select system json_get_var macaddr label_macaddr json_select .. fi echo $macaddr } get_mac_label() { local macaddr=$(get_mac_label_dt) [ -n "$macaddr" ] || macaddr=$(get_mac_label_json) echo $macaddr } find_mtd_chardev() { local INDEX=$(find_mtd_index "$1") local PREFIX=/dev/mtd [ -d /dev/mtd ] && PREFIX=/dev/mtd/ echo "${INDEX:+$PREFIX$INDEX}" } mtd_get_mac_ascii() { local mtdname="$1" local key="$2" local part local mac_dirty part=$(find_mtd_part "$mtdname") if [ -z "$part" ]; then echo "mtd_get_mac_ascii: partition $mtdname not found!" >&2 return fi mac_dirty=$(strings "$part" | sed -n 's/^'"$key"'=//p') # "canonicalize" mac [ -n "$mac_dirty" ] && macaddr_canonicalize "$mac_dirty" } mtd_get_mac_encrypted_arcadyan() { local iv="00000000000000000000000000000000" local key="2A4B303D7644395C3B2B7053553C5200" local mac_dirty local mtdname="$1" local part local size part=$(find_mtd_part "$mtdname") if [ -z "$part" ]; then echo "mtd_get_mac_encrypted_arcadyan: partition $mtdname not found!" >&2 return fi # Config decryption and getting mac. Trying uencrypt and openssl utils. size=$((0x$(dd if=$part skip=9 bs=1 count=4 2>/dev/null | hexdump -v -e '1/4 "%08x"'))) if [[ -f "/usr/bin/uencrypt" ]]; then mac_dirty=$(dd if=$part bs=1 count=$size skip=$((0x100)) 2>/dev/null | \ uencrypt -d -n -k $key -i $iv | grep mac | cut -c 5-) elif [[ -f "/usr/bin/openssl" ]]; then mac_dirty=$(dd if=$part bs=1 count=$size skip=$((0x100)) 2>/dev/null | \ openssl aes-128-cbc -d -nopad -K $key -iv $iv | grep mac | cut -c 5-) else echo "mtd_get_mac_encrypted_arcadyan: Neither uencrypt nor openssl was found!" >&2 return fi # "canonicalize" mac [ -n "$mac_dirty" ] && macaddr_canonicalize "$mac_dirty" } mtd_get_mac_encrypted_deco() { local mtdname="$1" if ! [ -e "$mtdname" ]; then echo "mtd_get_mac_encrypted_deco: file $mtdname not found!" >&2 return fi tplink_key="3336303032384339" key=$(dd if=$mtdname bs=1 skip=16 count=8 2>/dev/null | \ uencrypt -n -d -k $tplink_key -c des-ecb | hexdump -v -n 8 -e '1/1 "%02x"') macaddr=$(dd if=$mtdname bs=1 skip=32 count=8 2>/dev/null | \ uencrypt -n -d -k $key -c des-ecb | hexdump -v -n 6 -e '5/1 "%02x:" 1/1 "%02x"') echo $macaddr } mtd_get_mac_uci_config_ubi() { local volumename="$1" . /lib/upgrade/nand.sh local ubidev=$(nand_attach_ubi $CI_UBIPART) local part=$(nand_find_volume $ubidev $volumename) cat "/dev/$part" | sed -n 's/^\s*option macaddr\s*'"'"'\?\([0-9A-F:]\+\)'"'"'\?/\1/Ip' } mtd_get_mac_text() { local mtdname="$1" local offset=$((${2:-0})) local length="${3:-17}" local part part=$(find_mtd_part "$mtdname") if [ -z "$part" ]; then echo "mtd_get_mac_text: partition $mtdname not found!" >&2 return fi [ $((offset + length)) -le $(mtd_get_part_size "$mtdname") ] || return macaddr_canonicalize $(dd bs=1 if="$part" skip="$offset" count="$length" 2>/dev/null) } mtd_get_mac_binary() { local mtdname="$1" local offset="$2" local part part=$(find_mtd_part "$mtdname") get_mac_binary "$part" "$offset" } mtd_get_mac_binary_ubi() { local mtdname="$1" local offset="$2" . /lib/upgrade/nand.sh local ubidev=$(nand_find_ubi $CI_UBIPART) local part=$(nand_find_volume $ubidev $1) get_mac_binary "/dev/$part" "$offset" } mtd_get_part_size() { local part_name=$1 local first dev size erasesize name while read dev size erasesize name; do name=${name#'"'}; name=${name%'"'} if [ "$name" = "$part_name" ]; then echo $((0x$size)) break fi done < /proc/mtd } mmc_get_mac_binary() { local part_name="$1" local offset="$2" local part part=$(find_mmc_part "$part_name") get_mac_binary "$part" "$offset" } macaddr_add() { local mac=$1 local val=$2 local oui=${mac%:*:*:*} local nic=${mac#*:*:*:} nic=$(printf "%06x" $((0x${nic//:/} + val & 0xffffff)) | sed 's/^\(.\{2\}\)\(.\{2\}\)\(.\{2\}\)/\1:\2:\3/') echo $oui:$nic } macaddr_generate_from_mmc_cid() { local mmc_dev=$1 local sd_hash=$(sha256sum /sys/class/block/$mmc_dev/device/cid) local mac_base=$(macaddr_canonicalize "$(echo "${sd_hash}" | dd bs=1 count=12 2>/dev/null)") echo "$(macaddr_unsetbit_mc "$(macaddr_setbit_la "${mac_base}")")" } macaddr_geteui() { local mac=$1 local sep=$2 echo ${mac:9:2}$sep${mac:12:2}$sep${mac:15:2} } macaddr_setbit() { local mac=$1 local bit=${2:-0} [ $bit -gt 0 -a $bit -le 48 ] || return printf "%012x" $(( 0x${mac//:/} | 2**(48-bit) )) | sed -e 's/\(.\{2\}\)/\1:/g' -e 's/:$//' } macaddr_unsetbit() { local mac=$1 local bit=${2:-0} [ $bit -gt 0 -a $bit -le 48 ] || return printf "%012x" $(( 0x${mac//:/} & ~(2**(48-bit)) )) | sed -e 's/\(.\{2\}\)/\1:/g' -e 's/:$//' } macaddr_setbit_la() { macaddr_setbit $1 7 } macaddr_unsetbit_mc() { local mac=$1 printf "%02x:%s" $((0x${mac%%:*} & ~0x01)) ${mac#*:} } macaddr_random() { local randsrc=$(get_mac_binary /dev/urandom 0) echo "$(macaddr_unsetbit_mc "$(macaddr_setbit_la "${randsrc}")")" } macaddr_2bin() { local mac=$1 echo -ne \\x${mac//:/\\x} } macaddr_canonicalize() { local mac="$1" local canon="" mac=$(echo -n $mac | tr -d \") [ ${#mac} -gt 17 ] && return [ -n "${mac//[a-fA-F0-9\.: -]/}" ] && return for octet in ${mac//[\.:-]/ }; do case "${#octet}" in 1) octet="0${octet}" ;; 2) ;; 4) octet="${octet:0:2} ${octet:2:2}" ;; 12) octet="${octet:0:2} ${octet:2:2} ${octet:4:2} ${octet:6:2} ${octet:8:2} ${octet:10:2}" ;; *) return ;; esac canon=${canon}${canon:+ }${octet} done [ ${#canon} -ne 17 ] && return printf "%02x:%02x:%02x:%02x:%02x:%02x" 0x${canon// / 0x} 2>/dev/null } dt_is_enabled() { grep -q okay "/proc/device-tree/$1/status" } 07070100E6724E000041ED0000000000000000000000026524747F00000000000000080000000100000000000000000000000D00000000lib/firmware07070100E6777E000081A40000000000000000000000016524747F00001310000000080000000100000000000000000000001B00000000lib/firmware/regulatory.dbRGDB00ADAEmAFzAIALAM\ANzARmAS=ATAUAWzAZqBABBBDBEBFmBGBH_BLzBM=BNBOBR BSBTzBYzBZCA-CFbCHCImCLCNCOmCRXCUCXCYCZDEDKDM6DO6DZECEEEGESETzFIFM=FRGBGD9GEtGFGHmGLGPGRGT6GU2GYHK%HNmHRHT=HUIDIEILLINIRISITJMmJOJPGKEKHzKNKPAKR KWwKYKZLBmLCLILKXLSzLTLULVMAwMCMDMEMFMH=MKMNMOMP=MQMRzMTMUMVMWzMXmMYNGNI=NLNONPNZOMzPA)PEmPFPGmPHPKPPLPMPR9PTPW=PYQARERORSRURWmSAzSESGSISKSNmSRzSVUSYETCTDzTGfTHmTNwTRTTmTWTZUAUGUSUYUZwVCzVEVI=VNiVUmWFWSfYEEYTZA}ZWz#4JJ#4FJ 8) p @ @ > 8   )@ $%@@$%,@$%,@$%,@$%,@ $%,@ $%,@$%,@$%,@$%@@ $%@@$%PN $%P@$%P@ $%P@$%,@%}%PN %&0N  %&0N JL$0@N0OͰ@N0P8N0P8N0P8N0P8N0P8N0P8N0P8N0P8N0P8N0P8 N0P8 N0P8N0P8N0Pi8N0Qp8N0Qp8 N0Qp8N0QpqNPPN NPPN NPPN NPP@NPP@NPP8NPP8NPP8NPP8NPP8NPP8NPP8 `NPP8 `NPP8OͰPN PQTPN PQTPN PQTPN  `PQTPN PQTP@ `PQTP@PQTP8PQTP8PQTP8PQTP8PQTP8PQTP8 `PQTP8 `PQTP8 `PQTP8 PQTP8PQp8PQp8PQp8PQp80PQp8PQp8PQp8PQp8PQp8 `PQp8 `PQp8 PQp8 PQp8PiQp8 `Sw0Us8 Sw0Us8Sw0U8 ]Sw0W[H8Sw0W[HqSw0W[HqSw0W[Hq0Sw0W[Hq `Sw0W[Hq Sw0W[Hq Sw0W[Hq Sw0W[Hq Sw0W[Hq Sw0W[Hq Sw0W[HqSw0Wnq `Sw0Wnq Sw0Wnq Sw0Wnq SPT8 SPU0N  `SPV6PqSPVpq SPW @ SPW q SPW q SPW q SPW q `SPWnN  `SPWn@ `SPWn8 SPWnqSPWnq `SPWnq `SPWnq SPWnqSb qUW[H8 `V6PWn8 V6PWn8V6PYCqW[HX8W[HYC8W[HYC8W[HYC8W[HYC8W[HYC8 `W[HYC8 W[HYC8 W[HYC8 W[HYC8W[HYC8uW[HY88W[HY88W[HY88 W[HY88 WnYC8WnYC8WnYC8WXX@ WXXN  WXX8WXYN  WXYN  WXY@WXY8WXY8WXY8 `WXY8 WXY8uYCY8N  YCYX@xZhb qZhb qZhb q ]Zhb q ]Zhb qZhlqZhl ZhlZb qZb qe@А e@ Be@  `e@ e@ e@ e@ e@;_ e@;_  ii_@ iiJ@ ii;_ 0_@J@  J@?   : *nNo E.J^*K3>7]<@ OsIOIOsIOsIOxIOIrb^jV%BE>:g*Yf6b!G*jNbo3 wRV"f}3*Fkn.FFFv"ZET Z&2n.n.rv*z2~FF&6{>FBFFFFFFFRKFFFF .07070100E66F0A000081ED0000000000000000000000016524747F000B1114000000080000000100000000000000000000000C00000000lib/libc.soELF+04p4 (p888  \/NNNdtP   ,,dtQdtR HH  EA@ @@(>@&@ s8!$H!@!Pa@dʠB HAͅ#  @H ˑ,R "P P@ HH` H`RE@  B("@qc 0@"1CD@ BD! @ @8@(0BP@$ 34! ("1@"Di",X#  D i H@h   } %@+ H(@ @A@j3 C BxᖰE @@R!B "$& R $@P H,`\ EA!2@A` y B9@@ HAFA0  QD*  A $4H`$<"@ eDHI@$ 6(21!8` @@@`p Ap A@TX(h( (P @@   @@P @  ( 3 Ld0PI  @Xh   0@ 9 @Q @ FH L A@8U ހC!Q`A a &"A A  A@ `! 0 RPj B Pd @`a@D6B9@A @ x PP!ᒐEhaH @AH"@T <ZP#@ * A@ HD!@D@@ "P BAŀF(HE.B@ A@ 0 ` ˜   PE(@AJ!DP@FJPHexz2b`" ' "&W@@HEI#@ G00"   ``) Ag$(< @0k"l`*D PD `ЀEJBQ G#`q %0"AA 1Ȅ@ H@F"@  BNT@H6RB  !Dd$ o @8 BF"  P $A00@d$8H )  h@B@%$H  "4%  0 'D`(" $hX Ba01DD%'@ @B0A$"A@ ȁ@@rC- `Q ( !"$&',-0367<=>?CFJMQSTW[`bcefghjkopqstuxz{}   "%'()*,./489:;<?BEGHJOQSVWY[\^`abcgjlotvwyz|~  !"#$%')*-.1689:>@ABCDFJKLNPQSTUVWXY[^_bcfikmopqrstvwx{}   !#$&()-/14568:;=@ABFIJMOPQSUX\^adgklnoqsuwxyz{|}~    "#%'()*+,./25679;<>?ABDFGJMNORSTVYZ[]`acefgjlnosvy}   !#&)+-.146:;<@BGHIKLORUVWZ[_`acfgklmqsuz{}   !#&'*,-.02356<=BCGHIJKMNPQRTUWX[`cgkmnprtuwx} 5@2j?0Kŕ70.RxAyutB4?2sXV$1 sOy𽩃 T}ת=X@ڀh?7sX;{_ w&|dEy s E|dIE)JE&m$v~L?⏷3JXz—6|dOH ?| hѵK{^ۧubq/Ϟ5cV"2Yhb| n|5<V-En 1NnE*_/Ϥ TiZd>ޮhh=rDY\|o-ekL+@2, k9?"&>ޮ滮Ђ$m[4#?|+~%)c9$"|{ڰoFa t)]? |;[)ar>$i'Q*JL0[m/5n0;rwKfǤ,!>@9c_Q  Tr5V*2!wP<'3(2|-,w!cr5\Mr*24VuM|&2I&*< t7qU~ѵKWck`r ]$ 1Te|] ћnh 9<)O Y\K)y cw:6"Ț93~ v"ձ5͑5mw7z"($) 8rG=KÕ"6yYxYx w73|"% |e7o$iH\G+p-MARl]3|V|VO![|V&\z8 R;co'"츯؍$6֚Õ*H&(I&kq`򍖶 J (/|&>Io,^sPWLApV{w%{0H8aFy򍖼xX6Ӑ}4\Z|?yrP|-hx |J ps,T|⮅G+aJ?'^"8YYZZ"ȯ>)yUs#rr1rˁOR+Npov^`{a.v,z>M_UıDz(tUbWq 49Yx\7.|̤-9![ }ОYf89q9sMО~mJaUgwYbJt\L} OhsW_iy|hZja.@Sl@.F, db!kTmewmD2֟s5|1pj-!oٌ=ۉ? ޝ듴ArV|Q~rSJx@|Gs%F%rVBTK|3*:k`Cu|M@^E+1޵:yu .Щk<|SkrnQ\_Z \K-jwKrnWmKpa` .@@@X8=R||Y).kuh6ZD9 3pp9>Wl ++i|$(`CCٽl deXEBu I`Am%Z]n=>}]Y\8B߳P s~ Ϛۧĩߊa~ƒ'U{c^RHEʐ'ծ~M5 d>bg Rߥ.TWn(),EEig!' >D߬Ny=:ac,(jl5 t[wrA8=: k+GX 9ZLd?[w#| Х|MV{u^-j7U=eIs?[WM| pͣ#vf 7p׌$78kNi$NЊ8-_|4 NPc$e\JǤA 4y;"IIgIu/5yQvfY<g(_(\~#ԀFViNpE$i0#nj(M_;L|$b߮q|Om6f{9Db LSrVfNpUZ}65-IbvY6|?ϳBP% .L6ҙg+Rt[nK8R{'KTP |?Xta(2X,cZL!9HYB{Rf)A9 Ri/.| 5|eClBH ̥RUYU!?Բz\ClV{0]epZ7XG U|sGM9_|ھO"' BAI- |pce|uN9_tґAS|G20Y`r|wvt<3_ 3|=ج&_œp|I`mj喺3wkw!8I`ڵvmMbS{|GcfV<`%5j$#+&+Ɯ/ |G|P2r5h|~?|`}1Q:د5o.~űN5/],+3AT4,4aׯ'E.؛sZ1{=Bʯ񉁈A5X<U;t u%ǁFMy(樉9wЕ`0}|D>| .0k/ w7- GFvMwπM6C2҇ϩ5HNx WPWm%6B{(Kmf7|L&ZJRq$sX@/9;{omf|"3̚7)QH¯ T`߉7֛o-_7(EH2'SPo m97|Nq|0 gz[(KJT ~g|7x͋!l뒫XɢRPf˵""І=OF7ILϿĝwۃ8EG,=O/ˡ7O>)|@p18ViF|:[|@rU;ӥ# |K93(y;q|v1>|@w5vTI!(Rm8 -7(P,[;~gӔ/۱l<$T)vnn߿ʕiâ=#HDu1W "kݧKQ#xj.Rih|xe "bzbW.7uڲ|;;ۀh,c u5uڹ;Q=h\oc}GP?VKEJ||+Z@|X?Vw,`}u͆L^Q=c06?Vޗtud@Sae- KuVguP : %s$OúNjZ?n>DanDL籒1BAb ]|Q4|-+ZQ=Ei|~:aOak'oK 1V`+`+#fs]BuK|KYz 5ZYz;; ;ySMX9=nLSyG\,xF>\$x%08y_W`A/iJ<+E|0b=e 4me^4.{=k>H4 jI|T.sl|Brrzp>Zi^IJKѵ+Cs̀U|ƭJz|> rd P6|d H;hh8|2LeL?scjJ|fΣt/eu$$ r*sa>Vb/vОm T]N =:kCx?t|΋oIgYzLb{Rt/°ZF_|&o9 :I( y@*u(/8yS8s9o ? !9! X|0I,?mi>Ge!o 5Iz,c]6r@Gwfc0`[};0r) @bx~O?a_`V\mY"@h ^9|L)K(/ 3kf6+wU0R33gqݛL)Qi-.f3 akl6+|U )G\;Xi-;%:,bK98Pӡv7#q~`fϹ i|7pjRbP% #4tqR4Զ^vV\EQf<n|Uk|WKwj| -R8,|Z`o)a)4:.p"W|`>^2#(N&qfz,"Ga]Dv7.K/}o&ݬ*1ծ2qKj̾LPdToa2']]>yʦUqKIMįLdrn_4>~C oB v[i#/Ê1.P1c?K%_: ff[sF8zYGWv bNrc,L} ~)$|TPJ| uNr>kK83S-y84,tr @99id6'=r7m9+tTg|az^ -d>wP'#ٽ|aӄ^_)[zPO*"ȴ;S {A=d|.2"B bAsό67e:@Dmʉ:bﳘ!f3V$luu$i#)K ,|0|FDm%>-Ip8$$| o89f׿mf3`r ]! c  W$}H*$QY3:sK#l*mY;m >^@ )koLG0rb@JN^r[sooBcjW@v&<e/Yb9{/#sk 9- W!&{B.Zqw K}6k_ 6-_? `T3/ .W \k5 ,7NT=P80Y60zJ\1{`)uEJd'Z_di)}Ql4:AM"  wO@wNK 217bsN'_?VF3w(Slj] |oNWQH?2{S.BUmkrC )&KC0tt%u2`z#;+f !gy!S&"3xD| w&lvMf6%Ce8i1d"g~anQ?p4 So p=]Cp.,'X`S[^+vP)\6EOnzEPK7 <r1h'RDp][7vIa~9tS}Afs`c /!?3L7gi % nfmqc|Ie9 !PD'7n{ Xuz]dGOGZ#50xH(= Bv_F^\>KA=18<WoxtkZDyG5,vyi18}5=Xh/Z@`YD.MH,=iVacjb~eT-.mB2>'nO<K|z$Hr   Ic2@"h;Zd&4$B?@v+jGL5~bRk:aFT /+%>{ j-;Qw|-l>q[VwFdxlONVPg{,Sg^#JpQXuEVd~U %}x+F]|eU \/,UXCP_^g9p6?n rthB[G)xOTXAmIL1xEu:~62~ f.>:U Z,LYE^:tYR|%O[#5]Vg#JICV"5*mID$*nqq>4;h (4MeL7uG(;q*A+%iF](LJ"8Qs"ahy9P2<CyczRI!EH)RbWJij&Ur$A}M8ayo8sU\j<+*$zF;t[*(X03(MDq4Ne-Rfh9f:M-'Hl a_3A b`yR<=4uT\p0T E UOz ?  %hpppp pppp6Po{OQHp ;4C\$ \3I#wrT15kVx:bw#cD^q~Wb!.T8qI9Lr#= !'W%KkUf%&Nu'cZOO[1yB-LRNaVd>x}$Fsi}DEhx)+ jL9?w<GybMjV`"Gqhvm?P}"^HseS*BZOWjK>h'#s :]I6g&tpc#`n] 5R2J>K Skml JiX:M{*}vI~=| ]\ @^9 ZEfe\m~XRi7f#<b*,#0fkt%X/Jz92 NC_|4 6U=wu. <[upmR?3rRA *jNn)Kk3zl647gt~ C|oWd@O-LGo @5,SZoFdoB,5'@A@%P6X{)NQ\Yw~H-<:> _| w(E&vod.!!*eQ[PyY7=-lp1!n0Xn`]H<1>IdM>z/aT^DA<8BYHgqsVzr;np0TK\ k&CJ0&?4Sg6N$RB`2acQ_{3?'be5=| [xK Z,+hZ9) $Y/U$8Q{N(A{63R91Av*9mMVyo`}jh]yev T fCO! 0%@/"GiFYMPeSb p^lEX`,InDtuAzgS%iJ:tqr[M(XD..d\-?qprVbTU fP4f4sj z$>]yn;o/v @ ws-=, 72c,.[miJr(&2iG!++U P'}1=":WHCEt|kvEah 3~+_.u3-FPK_zslW27mFxDO }[6UW`/Hu; ^_ ~) aGQqT* S hgFZY_CE'?c<4|D81xB(]ayLFe05:/7Gd{g(VY8)+"^uI8U"aA)7ltBMJx;(cQ;0 25; 8L&%"$l+Lj( + otdT&s(? d t.`"+D"+|\&C0=M H #  \   i'Hi2" L,.+ D:0X < <9X5zt4&)p 8th" OP p3yL `  D.&})0l48(L,D"10FX>Q "TjTr46{1,M@dB <'U TI T4>Y' \ X S@T, !E\ 4 h@X < t.&Hr8Hvd4 ;";$/5x e٠ 2 +Ly*Ux y((|L(|,#  ? '<' \+$!hL =T5vX0"?q +@X- H  9 +!Š4942J(9 $XX/4@1Jch408,ʬ N"9i\"ctɠ${<\/5"(:`= ,x5mt" t"G4 <4+|"vP'L<T\.I(4".` $ITX|9,4QK4x> TX@+"'R$t/ h)P,4@"&LΤ Dd`P5|"4e"+EwUA@)):h$&|" \ <c> $\T,"4   vx"0"3S)G"9(> "T @%i&r(-D4b,'$@0GDDaxX,:\ (d7 $:d1J\,-$D*h8:#$ {(t=$RՄ!:H@@-dI\ll24J J</*0-003DPL:t"uy<<0'<+d  DD6Xd<06A|,@";`$;H"0  +h `<-)-D"d rB(X 1[l$Q2\ m4`<t3&C|0FT8`\<.: d-~H"B<P'zd< \d1?4/9\"8H!R<:tx):;?w +p'b(, x4bX  E $]LH m5&q,": Ť|?+0%0`"8;T/0`; t@*j\@7$h Bh O,L, -X(D"7( 'x5w"."*j"lWh C% 1 G|kH*gt)F">2("Hp[7P; ," dh |\d80FU,> %/6t`4bdDRː+4p"OC<9xL> #P9<@9<,"E0t"8d,$<: < 2 xP|6xI7.)D@~40 V  h 44p " H(:@ 4=k L mT(h1 h4"=P^rh'1< 2X D80F=d8!P40) :&btH Q8H t$<0d>t@5@  d)Dt$TgX~y<@|;l\)F)P|/0H-lH8d"+ld(*`@T; !^p bU80<|7" <"= x7H 6H"'%L$0lD 1JP t? P1l% $",L0E =ɼ<"Br :CЄ-P(D [!7'/9*T+&r\tϨD?( (`Z\~4H m=lT1aJ-7ep(R%"/r.T!U<<7p82jJlHD" )"%x /1t=@ X,Dm "Tj? :m@0E8/;P , 1H> %XD` L1l"t4R[ ":D$> #XX ":",}D "& 3 $\L4<b> ^'hL(:P(Q& "l< (</)d%8x0F$ `X-klH"@<)Qp(9"8" 1 1{J , % "h8"#t.A <`H(=8mTT !R 9Ww(dSw8;@Ip D z!N,; /h2Jy[)Dt"*Ux":Q̬T(  $Hp8Lpt "774M`$e \|Ih"d;<"Bc.s|",OxT.0 ?Q<yDe^פ\".,(:0<` < K(p"QYt@86 Z<@+H e EQ@9p8("1J@ph1<ɴt5t|"[-dHIɔ :p4"vP ~<")Dt"9 +!= @'4<!Ml&")a&{)08(&,D#ae0E"<(: $.r<;<0E0PX"H&)p< *J,t*x_H<0W>tHWx< ( %Dl(h-h'hWlO 1H" <#Lex8= j<5xP"5et"$hT pP0E l@6*5Os03=H$Wl <" %X"+<4T|m<"T.XX'0p"[F+</;8$jTs(=a X / +$:t .qD"DL9bL:(H-$^(:z@x&4d? -1H/\.P alL4"U,.QG̤<r4X!R""< @: ɴ"4rbP3ML,(o Tx/6<` (@< "%/,p 4Pp`":9`L !LH#ΰ< PtDT S\@'LL6$|$4$<* Udx"50X 6H9 @W-H$L 4 8-\ΈD4*-d$e8,8$T3!`IpTM`X($.<"<  <4d ʜ< |TA, ? 7H"L)PU<(A$ *2"7TZ<>i "\T hW70"ɼYr<"P, ";<,+<'2K  TFh"u,T*q^8"p"0Wd\ 5"#_83t"8sH;(|? ,$-"K_" \*j<DX!yLL0<`.23S \@-< D\V4#e&Ql]d@55v"/l@uT4~<h !,  &=p0jx rL<X/;8(b(<~AH&&P4"8Ih$`-|(T`|@(9@|jӔH0}E<|4= 3S 9 +!.~\= t9*<|3$fZ<<  +ot"Tt|![I` 4z XD*`0" <T4> #T/9xx;< 8\h<u|<4Z  <"1 460//Dh 4 QRL/(>-T P? &T6< |hll~7)BT,4jpD0"d0(IYTlW|f܈;l"= ,`% ,U8*c@'$p"$ !RH`4+V~PDaAD";1EJOL< lH4" 6L*JY|"jy80!a4 @X? "xT [h!BH0p?0HI6"P$< l;JL: 7\;.<0&t!awȨ<3N,'q40,4'8xTs $L x"&` 8 Xn U"= p :6Ϝx0 Xh%\lU`O)z@lt; (uH@ (t8@:uT.= ((Z2&<H U$r8>2 !Pd8@I84H. "7 P!:\"]7P":69!xx l HlpITE$5 0(<`"+D$P ,  9 @= <xN\@ c";j/;֬:}3,!"Gp Q$jD4g`t,$`@ b , !gJh?d **ʈ.t"TX"%8@$< 6DH ,@7b4"ps7"+L%Zڐ-/  \$+dh"!4h"6`[#e )o\ Z|DT  ;P",<! T-   D:," p)@4)H<@|"q@ <?! (0h+[~L"O`"/*i8/$Lf \)W "83x)c7h@hp8 6 $ = p@ĜX T $ > T֐ X,\(HPTlD. B4Tb8"(9;w48 @|4D !Pd  d<A/U,;" 2Pp` \4( X,y8}K$| \<h:$< h3L ZD-($5"? &@p7{h">ѰLp<&+( 0#͜X.1"H2@H6bT"*a\@",=@~B< )p+`<1!I4U [ TyD?+01"-P, <[l0 )Z<|"8`+R~P"4)X Y4)Gi"631L &|)0)Bh "P/]Wt  m~d/)T|): (H$@4l$8 /F*l`>, T p" :7 'x= @uo$<X@v(<,ED T {,:єHx ),:6'f@9%X͸4hX@ v `!#e`8|*D,@"SҬX-˘42H\+oH2$GP4?T(|1$"oZx"x? c$$-0  v"0"\9l"P"dH ": Udx?T *= \!U|>h3L/--` 4!E`p: !T{ c>X(3$<'( q/p L]L  '$)8h \ D9.$p%r<=y TT1J0t>p0> $T+p)TCP K0"d 0.PD< 8<8<hPd"'[hT*,WT K0?=(2|0$o\͘ TS; l$ `G 9 +e D2 Xw/X P/ d  [pP @ : ,$9  $ \ @"9 + 9 +pthread_mutex_locksem_postlseekfcntl_pthread_cleanup_pushpthread_mutex_unlockpthread_cond_waitpread_pthread_cleanup_poppwritefdatasyncpthread_rwlock_wrlockpthread_rwlock_unlockpthread_rwlock_rdlocksigfillsetpthread_sigmaskpthread_mutex_initpthread_cond_initsem_initpthread_attr_setdetachstatepthread_createsem_waitpthread_attr_initpthread_attr_setstacksizepthread_attr_setguardsize__stack_chk_guardpthread_cond_broadcastgetpidgetuid__stack_chk_failaio_readaio_writeaio_fsyncaio_returnaio_erroraio_cancelpthread_cancelpthread_rwlock_tryrdlockpthread_rwlock_init__aio_suspend_time64pthread_testcancel__clock_gettime64lio_listiomalloccabshypotcabsfhypotfcabslcacoscasincacosfcasinfcacoshcacoshfcacoshlcacoslcargatan2cargfatan2fcarglcsqrtclogcsqrtfclogfcasinhcasinhfcasinhlcasinlcatancatanfcatanhcatanhfcatanhlcatanlccosccoshccosfccoshffabscopysignfabsfcopysignfccoshlccoslcexpcexpfcexplcimagcimagfcimaglcloglconjconjfconjlcpowcpowfcpowlcprojcprojfcprojlcrealcrealfcreallcsincsinhcsinfcsinhfcsinhlcsinlcsqrtlctanctanhctanfctanhfctanhlctanlconfstrfpathconfget_nprocs_confsysconfget_nprocsget_phys_pagesget_avphys_pagesgetrlimitstrcmpstrnlenstrncmpcrypt_rstrtoulsetkeyencrypt__ctype_b_loc__ctype_get_mb_cur_max__ctype_tolower_loc__ctype_toupper_locisalnum__isalnum_lisalpha__isalpha_lisasciiisblank__isblank_liscntrl__iscntrl_lisdigit__isdigit_lisgraph__isgraph_lislower__islower_lisprint__isprint_lispunct__ispunct_lisspace__isspace_lisupper__isupper_liswalnumiswalpha__iswalnum_l__iswalpha_liswblank__iswblank_liswcntrl__iswcntrl_liswctypeiswgraphiswloweriswprintiswpunctiswspaceiswupperiswxdigit__iswctype_l__wctype_liswdigit__iswdigit_l__iswgraph_ltowupper__iswlower_l__iswprint_l__iswpunct_lwcschr__iswspace_ltowlower__iswupper_l__iswxdigit_lisxdigit__isxdigit_ltoasciitolower__tolower_ltoupper__toupper_l__towupper_l__towlower_lwcswidthwcwidthtowctrans__wctrans_l__towctrans_lalphasortstrcollclosedirdirfdfdopendir__fstat_time64callocreaddirreaddir_rrewinddirscandirreallocqsortseekdirtelldirversionsortstrverscmp___environ__progname_full__progname__libc_start_mainclearenvputenvunsetenvsecure_getenvstrlen__errno_location__strerror_l_Exitabortraise__assert_failat_quick_exit__cxa_finalize__cxa_atexit_finicreatopenatposix_fadviseposix_fallocate__flt_roundsfegetroundfegetexceptflagfetestexceptfeholdexceptfegetenvfeclearexceptfesetexceptflagferaiseexceptfesetroundfeupdateenvfesetenvscalbncopysignlfmodlscalbnlfabslprogram_invocation_nameprogram_invocation_short_name__uflowftok__stat_time64msgctlmsggetmsgrcvmsgsndsemctlsemgetsemop__semtimedop_time64shmatshmctlshmdtshmget__tls_get_addrdl_iterate_phdrdladdrdlclosedlerrorvsnprintfdlinfodlopendlsym__dlsym_time64cuseridgeteuidgetpwuid_rdaemonsetsidvwarnvfprintffputsperrorvwarnxverrverrxeuidaccessfaccessateaccessnftw__futimes_time64__futimens_time64getdtablesizegetloadavgsysinfogetpagesizegetpasstcgetattrtcsetattrtcdrainendusershellfclosesetusershellfopenfmemopengetusershellgetlineisastream__lutimes_time64__utimensat_time64ulimitsetrlimitendutxentendutentsetutxentsetutentgetutxentgetutentgetutxidgetutidgetutxlinegetutlinepututxlinepututlineupdwtmpxupdwtmputmpxnameutmpnamevalloc__adjtime64__adjtimex_time64__clock_adjtime64_flush_cachecacheflush__cachectlcapsetcapgetchrootclonecopy_file_rangeepoll_create1epoll_createepoll_ctlepoll_pwaitepoll_waiteventfdeventfd_readeventfd_writefanotify_initfanotify_markflockgetdentsgetrandomgettidinotify_init1inotify_initinotify_add_watchinotify_rm_watchiopermioplklogctlsem_destroymembarriermemfd_createmlock2mlockinit_moduledelete_moduleumountumount2name_to_handle_atopen_by_handle_atpersonalitypivot_root__ppoll_time64prctlprlimitprocess_vm_writevprocess_vm_readvptracequotactlrebootremap_file_pagessbrksendfilesetfsgidsetfsuidsetgroupssethostnamesetns__settimeofday_time64__clock_settime64signalfd__stime64swaponswapoffsync_file_rangesyncfsteetimerfd_create__timerfd_settime64__timerfd_gettime64unshare__utimes_time64vhangupvmsplice__wait3_time64__wait4_time64lgetxattrfgetxattrllistxattrflistxattrlsetxattrfsetxattrlremovexattrfremovexattrbind_textdomain_codesetstrcasecmpcatclosemunmapcatgetsbsearchcatopenstrchrstrcspnbindtextdomaindcngettextdcgettextdngettextdgettext__duplocale__freelocaleiconv_openiconvmbrtowcwctombiconv_close__nl_langinfo_l__nl_langinfolocaleconv__newlocalesetlocale__strcoll_lstrfmon_lstrfmonstrtof__strtof_lstrtod__strtod_lstrtold__strtold_l__strxfrm_lstrcpystrxfrm__uselocale__wcscoll_lwcscmpwcscoll__wcsxfrm_lwcslenwmemcpywcsxfrmaligned_allocmprotectmalloc_usable_sizeposix_memalignreallocarray__fpclassify__fpclassifyf__fpclassifylfloor__signbit__signbitf__signbitllog1plog1pfatan2lcbrtcbrtfcbrtlceilceilfceillexpm1expm1ferfcerfferfcferflerfclexp10exp2pow10exp10fmodffexp2fpow10fexp10lpow10lexp2lexpm1lfdimfdimffdimlfinitefiniteffloorffloorlfmafmaffmalfmaxfmaxffmaxlfminfminffminlfmodfmodffrexpfrexpffrexplhypotlilogbilogbfilogblj0y0j0fy0fj1y1j1fy1fjnynjnfynfldexpldexpfscalbnfldexpllgamma__signgamlgamma_rlgammaflgammaf_r__lgammal_rlgammalllrintllrintfllrintlllroundllroundfllroundllog10log10flog10llog1pllog2log2flog2lmodflnannanfnanlnearbyintnearbyintfnearbyintlnextafternextafterfnextafterlnexttowardnexttowardfnexttowardlremainderremquodremremainderfremquofdremfremainderlremquolscalbscalbfscalblnscalblnfscalblnlsignificandsignificandfsincossincosfsincosltgammatgammaftgammaltrunctruncftruncla64ll64a__xpg_basenamedirnameffsffslffsllfmtmsgpthread_setcancelstateforkptyopenptypipe2login_ttywaitpidget_current_dir_namegetcwdstrdupgetauxvalgetdomainnameunamegetentropygethostidfwrite__optresetoptind__optposoptargmbtowcoptoptopterr__posix_getoptmblengetopt_longgetopt_long_onlygetprioritygetresgidgetresuid__getrusage_time64getsuboptinitgroupsgetgrouplistioctlissetugidlockfsetmntentendmntentgetmntent_rfeofferrorfgetsgetmntentaddmntentfseekhasmntoptstrstr__lstat_time64ptsnameposix_openptgrantptunlockptptsname_rrealpathreadlinksetdomainnamesetprioritysyscallsocketconnect__time64__gmtime64_rstrftimesetlogmaskcloselogopenlogvsyslogwordfreewordexpexeclfdopenmincoremlockallmmapmremapmsyncmunlockmunlockallposix_madviseshm_openshm_unlinkmq_closemq_getattrmq_setattrpthread_selfpthread_detachrecvmq_notifypthread_joinmq_openmq_receive__mq_timedreceive_time64mq_send__mq_timedsend_time64mq_unlinkc16rtombwcrtombc32rtombmbrlenmbrtoc16mbrtoc32mbsinitmbsnrtowcsmbsrtowcsmbstowcswcsnrtombswcsrtombswcstombswctobacceptaccept4binddn_compdn_expanddn_skipnamesethostentsetnetentgethostentgetnetentendhostentendnetentether_aton_rether_atonether_ntoa_rether_ntoaether_lineether_ntohostether_hosttonfreeaddrinfogai_strerrorgetaddrinfohtonsgethostbyaddr__h_errno_locationgethostbyaddr_rgetnameinfogethostbynamegethostbyname2gethostbyname2_rgethostbyname_rfreeifaddrsgetifaddrsinet_ntopstrcatif_indextonamentohsgetpeernamegetservbynamegetservbyname_rgetservbyportgetservbyport_rstrtolgetsocknamegetsockopth_errnoherrorhstrerrorhtonlif_freenameindexstrncpyif_nameindexif_nametoindexin6addr_anyin6addr_loopbackinet_addrinet_atoninet_networkntohlinet_makeaddrinet_lnaofinet_netofinet_ntoastrspninet_ptonlistenstrtoullgetnetbyaddrgetnetbynamens_get16ns_get32ns_put16ns_put32ns_skiprrns_initparsens_name_uncompressns_parserr_ns_flagdataendprotoentsetprotoentgetprotoentgetprotobynamegetprotobynumberrecvfrom__recvmmsg_time64recvmsgres_initres_mkquerysetsockoptsendtosendmsgres_queryres_searchres_querydomainres_send__res_statesendmmsgendserventsetserventgetserventshutdownsockatmarksocketpairfgetgrentfgetpwentfgetspentfreadgetgrnam_rgetgrgid_rsetgrentendgrentgetgrgidgetgrnamgetpwnam_rsetpwentendpwentgetpwuidgetpwnamsetspentendspentgetspnamgetspnam_rulckpwdfputgrentflockfilefunlockfilefputcputpwentputspenterand48drand48lcong48nrand48lrand48jrand48mrand48srandrand_rsrandominitstatesetstateseed48srand48_Forkexecvexecleexeclpexecvpexecvpefexecvesigismemberposix_spawnposix_spawn_file_actions_addchdir_npposix_spawn_file_actions_addcloseposix_spawn_file_actions_adddup2posix_spawn_file_actions_addfchdir_npposix_spawn_file_actions_addopenposix_spawn_file_actions_destroyposix_spawn_file_actions_initposix_spawnattr_destroyposix_spawnattr_getflagsposix_spawnattr_getpgroupposix_spawnattr_getsigdefaultposix_spawnattr_getsigmaskposix_spawnattr_initposix_spawnattr_getschedparamposix_spawnattr_setschedparamposix_spawnattr_getschedpolicyposix_spawnattr_setschedpolicyposix_spawnattr_setflagsposix_spawnattr_setpgroupposix_spawnattr_setsigdefaultposix_spawnattr_setsigmaskposix_spawnpsystemsigactionsigaddsetsigprocmasksigemptysetvforkwaitidfnmatchglobglobfreeregfreeregcompregerrorregexecsched_setaffinitypthread_setaffinity_npsched_getaffinitypthread_getaffinity_np__sched_cpucountsched_get_priority_maxsched_get_priority_minsched_getcpusched_getparamsched_getscheduler__sched_rr_get_interval_time64sched_setparamsched_setschedulersched_yieldhcreate_rhcreatehdestroy_rhdestroyhsearch_rhsearchinsqueremquelsearchlfindtdeletetdestroytfindtsearchtwalk__pselect_time64__select_time64_longjmp__setjmp__getitimer_time64killpg__sigsetjmppsiginfopsignalstrsignal__setitimer_time64sigaltstacksigandsetsigdelsetsigholdsigignoresiginterruptsigisemptysetsiglongjmp__sysv_signalbsd_signalsigorsetsigpausesigsuspendsigpendingsigqueuesigrelse__libc_current_sigrtmax__libc_current_sigrtminsigset__sigtimedwait_time64sigwaitsigwaitinfo__xmknod__xmknodatfchmodfchmodat__fstatat_time64__futimesat_time64lchmodmkdirmkdiratmkfifomkfifoatfstatfsfstatvfsumask__overflowvasprintfclearerrclearerr_unlockedvdprintf_flushlbffflush__fsetlocking__fwriting__freading__freadable__fwritable__flbf__fbufsize__fpending__fpurge__freadahead__freadptr__freadptrinc__fseterr_IO_feof_unlocked_IO_ferror_unlockedfflush_unlockedfgetcfgetlnungetcfgetposfgets_unlocked__fgetwc_unlockedfwidefgetwcfgetwsfgetws_unlockedfilenofileno_unlockedftrylockfilefopencookiefputs_unlocked__fputwc_unlockedfputwcfputwsfputws_unlockedfread_unlockedfreopen__isoc99_fscanffseekofsetposftelloftellvfwprintffwrite_unlocked__isoc99_fwscanf_IO_getc_IO_getc_unlockedfgetc_unlockedgetchargetchar_unlocked__getdelimgetwgetwchargetwchar_unlockedopen_memstreamopen_wmemstreampclosepopen_IO_putc_IO_putc_unlockedfputc_unlockedputcharputchar_unlockedputwputwcharputwchar_unlockedremoverenamerewind__isoc99_scanfsetbufsetvbufsetbuffersetlinebufvsprintf__isoc99_sscanfstderrstdinstdoutvswprintf__isoc99_swscanftempnamtmpfiletmpnamungetwc__isoc99_vfscanfwcsnlen__isoc99_vfwscanfvprintf__isoc99_vscanf__isoc99_vsscanf__isoc99_vswscanfvwprintf__isoc99_vwscanf__isoc99_wscanfatofatoiatolatollecvtfcvtgcvtimaxabsimaxdivllabslldivqsort_r__strtoull_internalstrtoll__strtoll_internal__strtoul_internal__strtol_internalstrtoimax__strtoimax_internalstrtoumax__strtoumax_internalwcstofwcstodwcstoldwcstoullwcstollwcstoulwcstolwcstoimaxwcstoumaxbcmpbcopyexplicit_bzeromemccpymemmemmempcpymemrchrrindexstrrchrstpcpystpncpy__strcasecmp_lstrcasestrstrncasecmpstrchrnul__xpg_strerror_rstrlcatstrlcpy__strncasecmp_lstrncatstrndupstrpbrkstrsepstrtokstrtok_rswabwcpcpywcscpywcpncpywcsncpywcscasecmpwcsncasecmpwcscasecmp_lwcscatwcscspnwcsdupwcsncasecmp_lwcsncatwcsncmpwmemsetwmemchrwcspbrkwcsrchrwcsspnwcsstrwmemcmpwcstokwcswcswmemmovemkdtempmkostempmkostempsmkstempmkstempsmktempcfgetospeedcfgetispeedcfmakerawcfsetospeedcfsetspeedcfsetispeedtcflowtcflushtcgetsidtcgetwinsizetcsendbreaktcsetwinsizecall_oncecnd_broadcastcnd_destroycnd_initcnd_signal__cnd_timedwait_time64cnd_waitmtx_destroymtx_initmtx_lock__mtx_timedlock_time64mtx_trylockmtx_unlockpthread_atforkpthread_attr_destroypthread_attr_getdetachstatepthread_attr_getguardsizepthread_attr_getinheritschedpthread_attr_getschedparampthread_attr_getschedpolicypthread_attr_getscopepthread_attr_getstackpthread_attr_getstacksizepthread_barrierattr_getpsharedpthread_condattr_getclockpthread_condattr_getpsharedpthread_mutexattr_getprotocolpthread_mutexattr_getpsharedpthread_mutexattr_getrobustpthread_mutexattr_gettypepthread_rwlockattr_getpsharedpthread_attr_setinheritschedpthread_attr_setschedparampthread_attr_setschedpolicypthread_attr_setscopepthread_attr_setstackpthread_barrier_destroypthread_barrier_initpthread_barrier_waitpthread_barrierattr_destroypthread_barrierattr_initpthread_barrierattr_setpsharedpthread_exitpthread_killpthread_cond_destroypthread_cond_signal__pthread_cond_timedwait_time64pthread_condattr_destroypthread_condattr_initpthread_condattr_setclockpthread_condattr_setpsharedthrd_detachthrd_equalpthread_equalpthread_getattr_nppthread_getconcurrencypthread_getcpuclockidpthread_getname_nppthread_getschedparamtss_getpthread_getspecific__pthread_timedjoin_np_time64pthread_tryjoin_nppthread_key_createpthread_key_deletepthread_mutex_consistentpthread_mutex_destroypthread_mutex_getprioceilingpthread_mutex_setprioceiling__pthread_mutex_timedlock_time64pthread_mutex_trylockpthread_mutexattr_destroypthread_mutexattr_initpthread_mutexattr_setprotocolpthread_mutexattr_setpsharedpthread_mutexattr_setrobustpthread_mutexattr_settypepthread_oncepthread_rwlock_destroy__pthread_rwlock_timedrdlock_time64pthread_rwlock_trywrlock__pthread_rwlock_timedwrlock_time64pthread_rwlockattr_destroypthread_rwlockattr_initpthread_rwlockattr_setpsharedthrd_currentpthread_setattr_default_nppthread_getattr_default_nppthread_setcanceltypepthread_setconcurrencypthread_setname_nppthread_setschedparampthread_setschedpriopthread_setspecificpthread_spin_destroypthread_spin_initpthread_spin_lockpthread_spin_trylockpthread_spin_unlocksem_getvaluesem_opensem_close__sem_timedwait_time64sem_trywaitsem_unlinkthrd_createthrd_exitthrd_join__thrd_sleep_time64thrd_yieldtss_createtss_deletetss_set__tzname__timezone__daylighttzsetasctimeasctime_rclock_getcpuclockid__clock_getres_time64__clock_nanosleep_time64__ctime64__localtime64__ctime64_r__localtime64_r__difftime64__ftime64getdategetdate_errstrptime__gettimeofday_time64__gmtime64__mktime64__nanosleep_time64strftime_l__timegm_time64timer_createtimer_deletetimer_getoverrun__timer_gettime64__timer_settime64__timespec_get_time64__utime64__wcsftime_lwcsftimeacctctermiddup3getgidgetegidfchdirfchownfchownatftruncategetgroupsgethostnamegetlogingetlogin_rgetpgidgetppidisattylchownpipeniceposix_closepreadvpwritevreadlinkatrenameatrmdirsetegidseteuidsetgidsetpgidsetregidsetresgidsetresuidsetreuidsetuidsymlinksymlinkattcgetpgrptcsetpgrpttynamettyname_rualarmunlinkatusleep__fxstatfstat__fxstatatfstatat__lxstatlstat__xstatadjtimexclock_adjtimeaio_suspendclock_getresclock_gettimeclock_nanosleepclock_settimecnd_timedwaitdifftimefutimensfutimesfutimesatgetitimergetrusagegettimeofdaygmtimegmtime_rlocaltimelocaltime_rlutimesmktimemq_timedreceivemq_timedsendmtx_timedlockppollpselectpthread_cond_timedwaitpthread_mutex_timedlockpthread_rwlock_timedrdlockpthread_rwlock_timedwrlockpthread_timedjoin_nprecvmmsgsched_rr_get_intervalsem_timedwaitsemtimedopsetitimersettimeofdaysigtimedwaitstimethrd_sleeptimegmtimer_gettimetimer_settimetimerfd_gettimetimerfd_settimetimespec_getutimeutimensatwait3wait4__dlstart_dl_debug_state__dls2b__dls3_dl_debug_addr               $ ( , 0 4 H L P T X \ ` d h l p t x                         , D H L     L d h l        < 'Z!'ЯJ%  J$ %< 'Z0!0%'  '< 'Z!0%'  '%@$B  $(,  $(,$< 'Y@ !h| %@(% %h|   %$ $$ $($$ %'$ '#@' @ %$ '% %(%048<@ ' #%' Є##! @%< 'W!$   #%%D# %(!d% %`8%||=||='/ 8#@H $Eg!|b@6$$$H ( $$<8%@(%(@$c0b@0b$E|b$c|b@$$<4cC$<50$'0%|B%(#((+E%b!|b@$$%<}0e4BBb$e%@ &(#`$@$%$"<b%%(E$ 0%C(#C+%G! 0%$0E `0bg!|b@0b<4Bb$`$ @%<@@+$B %$Eg8!B@0%@# $Eg# $$Hw(@$(#((+E%b#|b@w|bQpC $r<8%@(%@#& #`_$@# %$ %$$"<b%%(D C #C+%# 0% %$$0B@`E%%= %<0bg#|H#@:@%40b`9<?% %g#|H# %pC $cf(*bf#$e(#+b%0%@pC 0%0#<4cC$% 0% %%0%$@<|B@<?4B %$% %$4B< '1 !|=|$'$($ <C%$X%|=|&/$+$ <h%$H%8# 00%$,@&@& 0%JF0!0!@ pC $f$8#$$bX 8%$ ` ph@ %$0#$$H 0%$ Q@C+`M$% 4F1EHpXb%k+@@j!j+@%$k+@%$j!k#f0pb(+/j!jH+ $bH+ $j!b&$ %+%$`90D|D0D$|D$B|D(d<4cC$$(d#Gh%|Bb%B %(%C%<@e$`2@%@%|B@3$@%`% X%$c(`$c%@%`$ #(`$ b+%0C`|C0C$d|C$B|C`%$<?@%4B$%%<?4B$@%|=$|||='h/ $G%@&fG`+%$|=$|||='/`9F$$d 1$%H )`"$$ @F(*0*$+@g+`$@`$`$ $$|=$|||='/`9F$$d 1$%H )`"$$ @F(*0*$+@g+`$@`$`$ $$|=|&'$*$<C%$@%|=|(/$ -$ < i%$X%8!00%( P&Z$(%$,+C`%V`@%@ pC $f$8#$$b@ 8%$` piH %&$0#$ $#X 0%$ $ 0040@f0DC( b%+b%|c`;B0Bb%%#`80D|D0D$|D$B|D(d<4cC$%#(dI Wj%|Bb%P%$$ $9$ $%%C%<@d$`)|B@+$P%H%`$#(db %#b+%0C`|C0C$d|C$B|C`%$$<?P%4BP%$%<?4B$P%|||=$ |= '/K% 8 $@%@v+a$8@n$Z$%|b@ $$+<4cC$<50$'0%|B%8{#@5@q$Eg!|b@l$K ( $<8%@(%(@ $c0b@0b$E|b$c(#((+E%b!|b@$$%<}0e4BBb$e%@ F#<e%(E$@0%@0%`$@$%C(#C+%G!@0%$0E `0bg!|b@0b<4Bb$`$,H%<@"H+ $B %$Eg8!B@0%$@1@$Eg# $K(@$(#((+E%b#|b@|b`pC <8%@(%@3%$y %@,$%$@ %@#F# %@0%`$@# %$ %$(E C(#C+%#@0%<d% %$$0B@`?%%@ %?0bg#|E#@4@%70b`3<?%$ %g#|E# %pC $cf(*bf#$e(#+b%0%@pC 0%0#<4cC$%$@<|B@<?4B %$% %$4B|$|=||=`$+$%|=(e|'(e<4B!<E%(e$$cjb##b%6%7#pe( $ #(@ ($,$%7%|cC%@$$E#$C+C%<4B0gb$0c$g|C$B|C`<4c$C$ #$C0%%$< ' !|=(@(|'(@$(#'<+D#C#(#%' <(%(@ $,$jM %`(%+#F#E(%(%%%||ʘ|U|U PGBB'7C% @%8+P#@H`$(%%E g8!H@!+!|C`$ H%$F$D$ %B)E9"(%<@%@(%( $ EP#H0XGP0% P+0%(0!(!+!%|E+0e%)$%<%P%(9(%$0(#((%(+0%(%(%@T (i0#C(%$$ g!H@!g+!|E$ $ 0e0e$$e+C!%|E$%)%<4E$W@|CP%%%$e(9(%<E%(%( $ %H#P"0#H0% H+%(g!(!g+!`H%(9( (%$0(#((%(+%(%(%%&0@+ C0%Y(%0eg8!H@!+!|C`Q<4c^C$8%$ @@%<@$ |@(%P%BC%@ %M$$$Og8!+H@!@!8Bg%BH%%<4E$(B0c(%e%xB@?`$(%%Eg8#H@#g+#%!$ $F (9 (%$%])E9(%<@%@(%( $ EP#H0XGP0% P+0%(f0#E(#f+#%|EE|E`X%0(#((%(+0%(%(%@A i(#C %$#@#+# %$  (9%%8$ $d(9 %<D% %( $ $H#P"(#H(% H+% # #+#`H% %( %$( #  % +% % %%+1k`;C`% P%@\%% %@0egX#kP+H(#(#|@#@#+#eP%@H%`%@%% %@$ @@%<@$ |@(%X%BC%` %v$$gX#kP+H(#(#|@eP%X#(#8+(# %qb p $c#e(KE8%i*@<k(i#$b$ 0#E@0h%0+f%GH%@H%% %$C(f $BK8i*@<i#$b(F $c$ Eg#G+C%%%4B$#H#W@< M#H$'$H%|B"(%%@%#H#<4c$`%%%%Z%X@H%%%kH%/@%$%bP%@%< %$4B|Bb(%`P%$ $ `P%<$ 4B$ < '!H%|U%|*o$A%B@<h%b%$`%|U|˘Bw$Yi0% X /B(%< X% 0%(% %$H8#,WH&  % ! !%`%q $D$$Gd#@eh%@$ P#%p $d($b $ce`%$ $ P%$ %$ $ i0%@%`q%( qf0 $$$(# X((% X$ @#`0%X%$($ $( 0%$$X%$X%$$c +/cF + BWB% "F@%$d1 `qlh,e%m(+2h!hp+%mp+%h!m#d0B`qlhC%M+`H!Hp+%Mp+%H!,(%pM#xN+``%N%O+`FP!Fh+!X!+$Nh+ O`#O`+O`#FP!$F(+(!E!O`#N(#LP+(# T(qbh,E(%P+@m(!p+$Jp+$J(!(#1 (qdX,E%K(+ZH!H(+$K(+ ,$H! ,(%PK #Xp+@h%``%G`k !p+$p+=P+@ $(@0+0! !0%31$U0E |e0E$$E+b!%|e(<4d$$(8/@% O% %|c0%@(%%%$7P%N(%a%%@P%`%%4BcX%<dX$`QH%|cb %<4c$$H%H%`%%`%$A$%%$H%$%$0#(9-( $$ +8G%%0D |d0D$$D+b!%|d'@% % #$  $>88%8+%%8%$%%%%$|U$ ||ɘ|U' 7J $Hi%g8%(%&i $e%+%|U$ ||Ø|U'*7@%IIg%$$d `A$%Jg%`8 $$ @%$  @I0*"H* $h+@$+@(+$@H% gP%@ $ $$|U$ ||Ø|U'*7@%IIg%$$d `A$%Jg%`8 $$ @%$  @I0*"H* $h+@$+@(+$@H% gP%@ $ $$|U| -'$#EE%Bb%<b%%)X%|U|ŘF7$  ]`%WB(EP%<`E(%%h%P! H-H%). @&%G)$Y$%)-) ^%%X%E%`H%@pJP %I$%C @#b@@%e$ @%*H#%p $i)($j $ce@`%$ $ %$ %$ $ `%p@ pP %L$%M @#(@@%($ `%8#(%% )% %@ `%$ $(%8%$ (%$$ $ 00 d0@ 0'l eh`Y(!p+!NX!(!H+l!i0!X +nX+ %l+H+i% ! !@s%"@-+e%%*@|le% B0c %%B$e0d |D0d$$d+C!%|D(<4D$$('@%G-(%|B0% %'@%$$&$ $9$d$d#$d$n0d |D0d$$d+C!%|D(<4D$$('@%(%<($D|BC %<4B$$@%G-(%|B0%% @%@8%$0#(90( $$ +8g%d%0d |D0d$$d+C!%|D'@%(% #$  $>88%8+%%8%$%%~$%%%%w$$0#(90( $$ +8g%d%0d |D0d$$d+C!%|D'@%(% #$  $>88%8+%%8%%%$%%%%~$|˘| XOBB|U+H%$ |UC%'7K!8'`% % *`%`y$8*`r$%%|E$%=<4E$7@0%8 0#E@'(%$ g8!IH!+"!|C`$\%$(9Y$ W(9!(%<%H%(%( $ EP#I0XGP0% P+0%(0!(!+!%|E@0e%$<%0%(%$0(#((%(+0%(%(%F%H(#(92<F%( 1$ @#X0@0%@+%(g!(!g+!@@%@%C(%%$g!IH!g+"!|EY$$0e0e$$e+C!{%(9 %%( (%$0(#((%(+%(%(%%0@(C0%'(%0eg8!IH!+"!|C`<4coC$?'8%$ H#H%<&H$ |@(%P%BC%@ %]$Ag8!+IH!#H! 8Bg% B@%%<4E$(B0c(%e%BN@'(%$g8#IH#g+"#%$5(9 (%$ (9(%<%H%(%( $ EP#I0XGP0% P+0%(f0#E(#f+#%|Ep|E`P%0(#((%(+0%(%(%`P %%$Z %`G%%$ %>H(# %@%C(%T% #"H#+"# %$ %$E(9 ( (%$(9 %<D% %( $ @#X0@0%@+%(#%(#+#@@%0(#((%(+%(%(%% 1J@,'0%CX%` %% %0egP#j0+I(#(#|#"H#+"#E0%%@%`o %% %$ $'$gP#j0+I(#(#|E0%P#"(#8+(# %qB p $c#e(JE8%h*@:j(h#$b$ 0#E@0h%0+f%G@%%K@%$C(f $BJ8h*@<h#$b(F $c$ Eg#G+C%%%4B$@#7@<E@$'@%|B(%%%@#<4c$% %0%/@%$b0%%< %$4B|Bb(% `0%$8$% %`0%<$4B$|$|U|˜|Ue(%$G%+$%|U(f|'(f<4B!<F%$30#( ($cbE%#$#b%|U(f|'(d<D%$3 #( ($cbE%$#b%$0%%A'#pE( $( `0#$ e#$b'50%|c(%@ %%%$%%%p $(b @ (#$ C#$cDd |B-E8%%%$cd %(%< '0!|U(`2|'(>`$(#'<+D#C#(#%' <C %(3@ $3,$`(%+#F#(C `$E(0(%D$(#(%(%%%< '@!'%40,($ @m%%+ # ## %p $>3#*"4@($ c`%&br & $>*b+@3#&$+Ӱ#D аİ%P42%~֘6(%@ %0,($ %%'8&%а*"7@+$0$(%s0# %(%,&f8`%{@%C%+%%<4c2@$2$D&P+p!@%|b@<4B$?b$3#@P%b&c$(S#PdV%p%%%$3|=$0B|@ '$@'-(%|B0%%`%pf0 ( @ $ F#$C$(#$C%`%|B@b(%$%< %4B$||U7B0%%0B'@D8%(C`Y@,(C`V$<(#0%( ` $%(88+08%%0b@?$b#$ f%00%0+f%0b@,$%'D%|cC%0%+0?Bf%g%0e0e$$c|e$B%%%`$?B0<0%4c$`0bE$c0bE%$%<? %4c'% %(%0%! @#'< 'T!'|lhxtpd`\Xlh&5%$ %  &  '4$H$T$L|;$b4"\PD8@@^!P&&x$\$`@%V!BR!BU!B^!P|& % (%(% &,\b$Bb@ % ` &d &` &d << 'H!',|phd`xtl%%'9$',@%,048 $(0%(%  % D.XD$ $ C$dB`$|xtplhd`'" 0$B&5"   %$b6'<$.$$ @ %$ @ %'` %l '`0%(%p $$`,' $ƍ\@(% '@#p0%`(% $  %@| @ %ӏ @ %@ %\ Ex(% @ %Ï  %,'9 %D-$ C$p`d0%`(% $$< '!'쏓\௿诱䌑b%'$@ &% 645 "d&(%%@a,'9|&$`%@$b,'9|(%d%b@,'9| &D@ C  `4b &D,,'9@ %+$x(% 'd$\ ` hl,\hp'\'9 $f܎bb쏲菱䏰'ͮB\$|;$b@܎bb+쏲菱䏰% '< '!,'9h(%< '!,'9h$< '!'%$ %C$$eD,@(%'9h' -$C$' d`|B< 'T!' @ %`(%o@ %`(% @ %`(% |x@ %T`0%@8%$ PLHD@<840 %(%'Xf< 'D!'<40,($ 8%(%L%@(%@% ȏ(% %?@%` %@(%@(%@ %h@%`(%u@ %@ % )ȅ@% % 掌EЏ(%@ %@%@e @ %:@ %V@ %@ % %`%@%@(%@ % (%-@ % %'@% %@%@%` % @(%GFh`% %(%`8%@0%@%` % @(%GFW`% %(%`8%@0%@%` % @(%GFF`%`8%@0% %(%`(%@ %(% %簯 (%@ %(%@ % @ %@ % 県eԏ<@ %840,($ %'@u< '!'ԯ8<0&%%<`8%#@0%&<048%0%048%%'@< 'Ȁ!'Џ%(%<, &@(%,` %&%%('0< '(!H%@%%% (% %`8%@0%< '!H%@%%% (% %`8%@0%< '!'<F&H%@% 8%0% '< '|!'%%< &@(%w'< 'L!'\P<|*XLHD@d`T%%%%@|׸*яǰ%$<@6z@%`%40 0%8%` %@(%w`0%H%@%d@8%`\XTPLHD@ %% %(%'h*@)z %(%X`%y@%`8%@0% %P(%40` % @(%\ %(%`% @%`8%@0%` %@(%:0<@$B.B*@) `(%T @ %`(% TP$@ % %(%X`%yx@%0%8%`(%@ %40`0%@8% %yV(%ď<@4B*@% @ % $ 0%8%,($@ %U`(%0% %D@ED`0%@8%y24`8%@0% %(% G݌F@%`0%`8%` %`(%`% %(%X`%y(@%`8%@0% %(%40\ % (%`0%@8%6 %R(%@% 0%`8%` %@(%`%%`0%y@ %40`8%0%(%x %04)`0%|0%8%%@%%@"`%40`0%@8%(%x % 0%8%`(%F@ %`0%@8%` %@(% 0%8%`(%t@ %`8%@0%װ* 0%8% %(%40`0%@8%`(%@ %X %x(%0%8%`(%@ % 0%8% %(%@%0%8% %`(%D`%@%`0%@8%` %@(%40m`%0%8%`(%2@ %`0% H%@%< 't!'@<|<+840D,%%@|t+`<Ay@%  (%@ %@(%+@y %dx@%@(%v %  @ %h % @%@(% %fk <B$Br+@ ` @ %@ % Sȅ %dx}@%(%I@ % @(%x %ҏ<C@4B+@􏙂 $@ %  (% @(% `%wD $E؏@(%@ %@% %dxH@%@(%@ % h  %(%@ % %@(%@ %@%@(% w % @(%D@<840%%,'H(%@%`~B@ @(%w % (%ҏ􏙀@(% @ % (%@ %@(%ԏ@t+`  (%  %@(%;@ %dw %(%@ % h  %@(% (%o %(%@ %@%@(% @ %@% (%ڏ< 'D!H%@%%% (% %`8%r@0%< '!H%@%%% (% %`8%H@0%< '!'|G%84D@<%`%T `8%@0%D@< %(%84%%'H|%%`%X %w;(%$ \ % (% $`%<C+@  0%8% %d(%@0%`8%%`%;$ (%X %`%@0%`8%@%<y4BѾ<D!4cC+@ T `8%@0%%%  %(%X`%v@%`0%@8%`(%@ % %(%\$ `0%@8%`(%@ % 0%8%%%< '!'|$,(@ %` @%, %%($'0| %dw %h  %<C+@<N %@% %, %@%4B<D!4c]C+@`,($ 0%'0  %dv@% (%@ % %h  (%@ %%< 'P!H%@%%% (% %`8%@0%%%%%%< '!'t840,%%%%D@<` %@(% 0% 8% 0%8%` %@(%`%@% %(%`% @%D`0%@8%@<84 %(%0,%%'H< '(!'Џ$ %%,( %(%(% %@%@ % @%,@ %($%% '0< '!H%@%%% (% %`8%@0%'<F&H% @%  %%'<'E(&%%''<F&H% @%  %%'< '!'H%@%%% (%<840,  %`8%@0%TP\cX  8%0%`(%@ % <840,H%@%`(%@ % 8%0%Q'@< '!'؏%%` %$ @(%%n%`(% 8%$0%@ %$ (@ %`(%'(< '!H%@%%%, (% %`8%@0%< 'h!H%}#<@% %b(% |<C %% 'ЏCB0%,8%(%uT %,`8%@0%% % %(%'0% %(%< '!|<b|b% '؏Bܯ$u: %$@(%%%'(%< '@!H%@%%%0 (% %`8%@0%%%%%%< '!'48<0&%%<`8%$@0%&<048%0%048%%'@< 'l!'Џ8%(%<, &o@(%,` %&%%('0< '!'<L|c@*XHD@\TP%%%%|C*`ÏG%@<@6 `0%@8%\XTPLH %(%D@%%'`b*@)  %(%X`%t@%`8%@0% %T`(%40 %u@(%\ %(%`% @%`8%@0%` %@(%>0<@$B.Bb*@5 `(%T@ %`(% TP(@ %@%@8%0% %`(%th`% %(%X`%ts@%`8%@0% %@(%40\ % (%0%`8%`(%@ %<@4Bb*@' @ % $,( 0%8%$@ %M`(%@%% %D@ED0%@8%t*`%`8%@0% %`(%c`0% GԌF %(%X`%t(@%`0%@8%`(%@ %40`0%@8%` %@(%p %T(%@%0%`8% %@(%`%r%`%` @% 0%`8%(%s %`0%@8%%+%8%(0%|GH% @%8%0%40(%s %04`%@%5C*@X0%8%@% 0%8%40 %(%`%0%@8%`(%n@ %`%8%`0% %s(%0%@8%`(%`@ % %4\0 (% N %(%0%@8% %@(%`%G@% 0%8%`(%@@ %@%0%@8%40 %@(%i`% 0%8%< '|!'<8|c0+4,<0%%|C+`@<A @%<80@%%4,'@b+@  %ds@%@(%z % t@ %h % @%@(% %j{ <B$Brb+@' ` @ %@ % Wȅ@(%@ %s%@% %ds{@%@(%G@ % h  % (%@ %<C@4Bb+@  $ (%@ %@%@(% `%rDȏ@(%  %@%E؏ %dsE@% (%@ %  (%  % %@(%@ %@%@%`@(%r %@%f %@ |c< r % [@%Y %&C+@d(%(%  %@%@(%@ % %s %@(%@ % h  % e %@(%@ %߻@%(%߶@ %@(% @ %@%(%ԏ< 'x!H%@%%%4 (% %`8%@0%< 'D!H%@%%%< (% %`8%J@0%< '!'@40,($ <8%%%%0%8%%%%&%@@8%0% % (%@%%<840,$%@%(  % (%'@~<C<~b %TR~b$C+`@ %E<@0% 8% %` (%@0%`8%@ %)`(%`%@%`%C$!0% 8% %L (%a@ % `(%0% 8%@(%` %`%q@%`%@%%0% 8%@ %q`(%`%` % @(%`(%@ % ǃُƃ@b ` %ǃ|ƃx@(%ǃ|ƃx % (%`%w@%`%@%$8%0% %(%0%8%l  %@O(% 0%8%`(%@ %GTFP`(%U@ %`(%D @ %@%0%`8% %`(%{`%`8%@0% %(%`%@%%`%@%K`%0%`8% %f`(%0%8% %(%`%]@%`%9@% %  (%ǃƃ`(%k@ %A% 0%8%`(%@ %GTFP`(%@ %`(%D @ % %(%`% @%0%@8% %@(%`%&@% %`(%`8%W@0%0%8% %@(%`%q+@%< '<!'H <840,($%(%ݕ%@H(%ݏ %@%<840,($ %% '@~<b$C Q~$+` (% %@(%܌@ %@% %(%@ %!  @% %(%p@%@%(%p % %`%@%(% %`%d@%@7 l0%8%` % @(%`0%@8%`(%@ %TP`(%a@ %`(%D @ %@%@ %`(%`%@0%8%@ %(%@% %(%`8%@0%`(%@ %<_ &8%` %l@(%0%`% @% (%`8%@0%_ %TP`(%$@ %`(%D @ % %`% @%9@ %`0%@8%` %@(%`%@@%`8%@0% (%q %`(%\@ %` %@(%V@%@ %k(%< '!H%@%%% (% %`8%@0%< '`!'L8<0&%%<`8%$@0%&<048%0%048%%'@< '!'ЏP%(%<, &B@(%,` %&%%('0< '!'|HD%%<F+L40TP@<8%%`S%|E%@'%@$ 8%0% %(%@ 0% 8% %(%`%@% $8%0%TPLHD@<840 %% %(%'X<D! ~F$􏙁\ % (% %(%X`%o@%`8%@0% %W(%`%@%0%8%(%o % $`0%@8%~f+`F<@6C+@\  ` %<0%b&T(%z` %D@0% 8%`%ov@% %(%\$ `(% @ % %(%X`%or@% %(%`8%@0%`0%@8%`(% @ %`0%@8%`(%@ % %%0%(% %8%0%@` %@(%@%`%@ %%`H%@@% 8%g0%T % (%@%`0%`8%` %`(%`%D@`(%@ % % (%`% @%@% 0% %`8%`(%`%D@`(%@ %`(%D @ % 0%8% %(%@% 0%8%`(%@ %D@`(%@ %0% %(%`%@% 0%8%`(%@ %0%8%`(%@ %@%0%$ 8%` %@(%`%`0% H%0@%< '!'<4|+,<80($@8%|@%H(%) %@ %@(%@%<840, %%($'@<D!|Ch % %dn@%@(%۷ %@%(%n %@%|C+@ %%f %@%@%<A0+0  <`~ &@(%nd@%` %h @ % ۅe` %dn@% %{@(%(%v@ %(%q@ %X %@(%@ %f@%ȏؕ@ %@ % @%@(%@ %V@%ȏ؅@ %\ @ %(%` %G@%(%B@ %ȏq@ %(%` %7@%(%2@ %@(%ٙ@ %@% %įْ@(%u%< '\!H%@%%%L (% %`8%@0%< '(!H%@%%%` (% %`8%@0%< '!'% %@(%$C$$f$B,B$@ $矬D$C%' $䏆d $Ɯ$B$矬< '\!',@ D$C$' (@$B(!< '!h$S< '!h$T< '!h $U< '!h$V< '!l$< '!'h\tpld,@ @$cTC!Q %D$C$d{t*"@ %*"@&"p2$? '$dC`<C+`<4B0B,C `參 $c b!B\!@<$Bi4P̌B<'0,$| (% %$',$ %'`$e$e$$Bt6',`@$`$UBH0BpD(!'Z$?$U @ %$ @0%$p%(%@ %R9%, &1'd'$0%(%&| %C'$0%' %=&|d<b&@d<۝$BYb<34$B5b$H  %@ $H(%  %@ &LbbďU$ (%@Ï$" (% 'w,R%'(@$0?(A@$(a@$$< '!'   $ %h%`%%k$$$@0c1C!h!K!k!Bc$C%`%@0B$cb!x$1O!g!G!cB$b%@H!G!$Bb%h% %$@H%$&&1&R&s$%"H!#L,x-pMx%p%%$ P%%go 0 !0c0B!!p!Q!cB8b%"%n0B00! !0 0! !%JC%%V%k@$% ' < 'H!'@% $( P%%@%%%$ #$cd%Be390c I9H!C! H.!N!9-H!M!y%B@%#%Jb%XB% < $%@<<|5J<X$H%@@%BP$y$b%J$b%B0Bb%}+b%!@ $Q$D%'D% 0D% @0>D%2b & $r&2@d&R&0r?D&&R$  !E!R%) %&RE!R %0R?&RE!R %|r+&R@|c)$cE!e!Rc %%|D+$@|B) $B !E!Bd%%b%M@&8@h%%knh% X%`%$ %%J%)$ $y0c0B!!j!J!cB$b%bX%p0B1!!i!I!cB$b%`%$ 'h%< '$!'쏗\诳ܯԯЯ 䯴௲؎%%%%'$$!0@f&1$BE'D(%@% %c$_ b(, &f%%'9$<$` %E ! b$c%h$%&f%$O % ! b$cB%h$'@,'<0$4"@[ď$ `(%  %& $%<$E0$D%$c(@` B(% %'@'< <@ &$B< ! $|d- !$|d+ !$|d* !$$d %|c,b!c#|+b!c#|)b!0? !c#|* !#0c?|)(!b!$B" $ ̎b@􏙀,0ȏ4 <%ď@&$$((%  % "@@eE&b&1$c`$ e$:bd,'9&@%` % B%b$u%쏶菵䏴܏؏%'< '4!'P\HTLD@<4$_b"% &1&R,&%`(%'@(% %$$@%@ %@c$*b &ȏ4bT &1&R   (%@ꏼc&LPLHD@%<'X< '!'h%$@D%4F%$F%$c6F%b  %0%@p% (%@%`%0%E8&8$8&!8!0!&6B8!0!8!b(&($(&(!%-8!(!8!&E$C& G! "8!E!8!&b$f&g!#%b!%p%$ V$%3'@!b8&8$8&8!@%8!10!'@!4&68!0!8!(&($(&(!%08$@8!8%-(!X!G8!&C$F&G!% 08$@8!<"E!x!g8!&f$e&g!#%b!x%$h$%39Ȁ'-@!b8&h&9h!h!0!&70!8&8!(!18$@8!M!(!%08$@8!%-B(!G8!&E&G!%08$@8!m!"!g8!&b&g!#B% C!%$ W$%1x%@x!8'8%8&8!%8!0!&60!8'8%8&(!(!18$@8!O!(!%08$@8!%-(!G8!'E%F&G!%08$@8!o!"B!g8!'b%e&g!#%C!`!cX!BP!%H!D 'H< 'z!'ȯ%,( 40$"0U?!F+d!%%#"&4$@u#+@  !40,($  '8 `0%(% %,'9&!S!,%P!&.b@@ (##P0!B(# %% %&s< 'y!'$($ ,%0B?$D!,C,9%&@ &s$@0#(% D ! %`%@(% %$80#(% D !'B|%#PTU %VW`%b@(%&$"&1""D",($ '0< 'x4!' \Яȯܯدԯ̯į0B% $u1 %@%,Bu1@  0Bb#܏ $$  %@&$%$$$!B@C%&!%X<͏,4W<4^%<2<gE'X&1&s#\$CTv,l`@0%(% % %dh$0% %  %@0%(% % %'H`(%,$C 0`% %E(%X,%\`l@0%(% % %d쯾h&,@0%(% % %@%.b@&F10#&B,B10 0! % %@%H`}2b(  %<gE$B#4<4B8<4B<<2$BTv@%X4$`8%d<\h@l2bD$b@2bw@e@0%(% % %n$V@0%$ % %( % &s$bӏ,  (% , C(! $$$$$$쐃'0$cg!'0$8!c:g%$8!$Ig%0g?8!$BIGH$S0C?f!F!cB$ %X %s&s@$ %P %{B(%(% %H %$ %A %$ %@0%(%9 %@0%(%0% %2 %@0%(% %+ %2b@@0%(%0% %" %@0% ؏ԏЏ̏ȏď'< 'r!'p\tlhd,b&1 | %\'@% @0%$ %$ R@ % $# $@ &L\bbtUplh%d'x< 'r!$$H%%g#P%!$ 1$ 2 $ 5 񏙂$ 6ꏙ@0%@(% %< 'qX!'%$@ `0%``%<G%$G%$:G%$ge8f%D%BH&*hE&e$$c(!E!&D&)(&0(&E!b<  $ @H%`0%h%(%%% 8%@%@%&s8$%%V&%BV&!h!%װ!V!&Ű$ư&V!I!##KB6H&#6&gH%9H$g$7H%H!T!I! %H%B!#!!x!!p!mX!FP!   $' 0%%h%`8%(%@%%<j 4Bg<g4B <8%8&e& 6@ )(%e& 1!0&l(+0!(!EC$B"% `%  (% $$((,0,4 80<0@4D4@H%$,8 < ($B@'H D@RP!DMR!CJBj!!Mh+h!Sj%TSP%t%%TP&s&B%BTP&~%s&h!P&C!&FP$b+h$KP&jP!Mh!p&C+h!IH!mh!*+h!M!hh%PCP%s%t%h&CP&@c%@t%CP&%$%o$h&$w%$%C!h!jP+MP!<#!-!8i+Mh!iH+J!&R$ "!!8<%JJ`H%#!"!y+"!(!G!+! L`!q!+C!$Ox!v!+C! (S!t!b+C!( ,F0!h!+C!00Np!u!+C!84KX!p!b+C!쏷謓,$4<@D䏵܏؏ԏЏ'%X%%p% %x%%`%@%`0%@8%D`(%%%<<j 4c4Bg <<g4c;4B<<<4cl4Bh40<A<4ck4B٫<8<~<[4c!y4BD@< '^!'ȯ%,( 40$"0U!F+d!%%#"&4H$u#+@  !40,($  '8 `0%(% %,'9<&!S!,%P!&.b@ (##P0!B(# %%' %&s< ']!'Я ,($,%%%&1#.A@ $@,0%`(%(@ % %$ '0`(% %@ %&쏼< ']!'$($ ,%0B$D"!,CH,q%&3H@ &R$0#(% d ! %@%`(% %$x0#(% d !#"'B%##`(% %"@%ɮ"&$(%&@$$젢,($ '0< '[!'\쯰诼 !@ %@دF @(%&ʏ @ %@ꏼŏP@&sb+@Ə0(  %@@%"!D &`8%$(%  %LQ%< '?t!'ЏL($,$ %@ % % 7  8% ,$ @ %T( '0< '>!d$ $< '>!'h% $pp@@P$$l$ @#&DDp$ XB %' $< '>!'$$P0,(4 qb&1"#bd#$BC$!!r &p&44@b"l40,($ %'8B!V!DFE  !&R< '=!'('̯%%$(% @ %%DQ" !$c$B" !P$@?,C&tXC@pb0"&4$/Pp&@.x @ %||DHLP$t`7$$į'$0%$\ @A 4`B!C$Dp&''$V 0c ` $ $ @@$$"ԏЏ̏'< ';!'Џ$,($%% Ѐ! % %`%0% @(%@ %< ':!'؏ $%$% !O%0% (%,@ %'9G$  '(< ':!'|;$$s,( blT,P$P blC!R&R @ % 0#(%D ! &1+@,($ '0< '9P!'௼\(%$  %|;`%C' <A$BNmr4< '8!'؏D$ P@ %$ %'((%&< '8t!'Џ$=( ,$ %S#S %,($ '0B@DP$= 0% ` %@ Q!cr&&1Q!&< '7!'ȯ,D($ 40%%-%\&)0  (%@%@5 @ %$&&동 0% ` %@@(%Q%40,($ '8$T  %@%@ُ&& @ % !3 @ܮ@(% %< '6@!'$= %P(#PB@ %'  %0%' < '5!PB@N%< '5!'% \\F%%$% 0$( %@#B$dC!$P$ '(GP$  '(P%$c$B< '4!'Я,($ D$C$,($ %'0%$=% %Q#QꏼB@菙D) ` %&D !T @%@%@ޏ@0% (% @ %!$=&D&`(% ! C,($0%@(% % '0 %@ԏ< '3`!'Џ$=$ ,( %R#RB@DD.$C$,($ '0P%%`0% @ %@$!BT =(%&1%00"&$=|;$b< '2@!$m$m,  @$BV, ! $BW| D ! %$m< '1!|;e8% %! < '1!',(%$$P%$< '1p!'L $ %L ,048<@D$',0%$$b |;$d$ $ $($'$$c 4< '0!'؏8% 0%$ $^< '0d!'ȯ(L\,$ 40`% &ď&ď\\T&1̎B@ %40,($ '8$BBQ! % U% `%  %B< '/!'؏L \$% &$ď$ \bD$Ddȏ\$cC!P%T &$ď$ %'($% < '.!' L\0($<84, % &L&L$ \\BT@TcPC! %V% W%  % %  %cP$bbP`BTBuPBT<840,($ '@< '-!'ȏL$\0(4, %&DL %\T@\\$BXT$ #PbTx$,$@T% &DL$40,($ '8 PCT"PT d!$B"Pus% &DL%< ',!(%,0%$S< ',!'ȯ% %< ',!H0%$$| @#< ',P!'%\'X ,$@LHD<%X %4 , 0%@(%'9V<` % $# ,8%(%$# $| $&V<'0%$$C  0%%$ L@$@ %04#LHD@<'P$*%@%$B %@@ %$%$@ %`% 0%R 0%@@ %$ $%(%@@ %$%$`%( $(,` % 0%%v@(%@ %,, 0%< '*,!'0 04@D@%<A$b8%'@@,(%$ 6 @ %@ ~$$$|  z40'8< ')|!'0 4D@<A$b%'D,D4 0%(% $  Y@ %4'8(%'௨$ ' @##(%'௨$ ' @##< '(t!'Яn$$ `%' < '(4!'ԯ%Z %%' < ''!'دQC %%' < ''!'؏ܯ$ %% '0 $$- $$ %'(< ''D!&$< '' !'؏ԯ$ % % %@%  %$ %'(%%%%%%%< '&|!' <840,($h%C%$CQ$+"A$-"?&",B @%< ̏% 6s̮DQ&",B @*`D%!B@Ch!$DC&% @ %@%&",B @*%ÎBp@B$BB<+###<80,($ %%4'@BChCf$CCB$C,c `V:5-XBp@B$B$BB<%<G6s<z&t &GE&",B @*`%!+'p!%W!+b!@@Q!%+q!&C!DCh׸+$B$!% @ %@%ُChBC $DDB$B,B @BC$D % @ %$B,B @Ch.d@%Bp@B$BB @ % |@%J< '#D!'%x$|$0@d`\XTPLHD(4 C%h$0D[$CBQ$$.C%%%쯠@%%%%%$C,d &%$.CJ$@% %hC%$CB$C,d &%+*d}2!%8B0!  $'(D !&E!@C!$ #$h&sC%  %ʏ$0Cҏ0$\4Bί0'($BD!$C$@%  %QhU `N5 4C $edh,('9\4 %<D!t+!!`%($5@(0V C!C#v *DT+ $B *D D@$"(0CD@`(%@ %d` %@(%`\XTPLHD@%%'hA&Di$C8%0%  %(% %d`\XTPLHD@%%'h` @(p@($Bp@ُD$BծhD$CB$0C6h%%$0.$Eð#D &BQ$$@% [ %Qh@ %`(%8%z0%d` %@(%`\XTPLHD@%%'hv+@tD+ * @'($bD!$B$$ $$2$$*<4pD$c'(d!b&s+ @I%*G*@D$ =@* @&C#4C!(C`P@4 &$c_C!(RD %@%l`%(0@ %`(% %(%`8% @0%` %N@(%@D <8$"(0C<8'@$Bb!D`%$B&s<84B9'CD#U!/# & $U#$_D!F<;4BF8%@%(%H$$cbF  !dpI8%0H&$B'(C!&Gը#& %*<$Bp_$<;4B%@ &$s'($BC!$BC+@l< '2%'(&bC!B@p!#+!x"+@-&bx<; % (%4)0%<; % (%40%0`%`%&b'(C!2RqU!&R2R'(&bC!B@p!#+!ۏx"+@<;&b'(C!2%RqU&C 0c@%$T`%&2& $C0c('($cd!$'((!d@%%b'($BC!*P< < /<<&$%p_% %e5e>'($BC!BL+`7L 1b3$B'(C!BM+@,*@P%P%$ $ $!%0%0 $'(d !$G((!#$pj001u&&&0cu'($BD!`%¬F* 1w&$B'(C!@'($BC!D)1p8%0%`(% @ % &2& $'( !@ % `(%GLFH'5 '($ !`%@% 0%8%`(%@ %(0@ %¬`(% #` %4@%*`%*% $8 $iQDP@ (% % 0#`8%@0%`(%M@ %$5 #0% (%< % $@ %`(%`8%hH@0%@%@ %`(% 0%`8% `%$`8%@0%@%`%&0BW"'($BC!C<$Beb +`& (0G|FxO %(%`8%|@0%`%@%<(B@ @ %#4`(% 0%8%kB#$`(%@ %&D~ *`%Z@%d\XPHD@ %`(%TL0%` 'h$ $$C0c$cd!d4d@%4#. 4(b@p@H %(0y4$5b%<8$%@䏣4 C!C#v *ӏDxT+@v bg&(0 GTFP  %ad`(%`(%&R \X@ %A='4R*@ D8@@ %(%8%0%@DM$"C %  %CDB@(%`8%@0%,gl(8%0%@`(%@ %@T,( %(%`%J@%0BW1<C(B  %GTFP~`(%@%8`%@$'M*@@ %0B(0W GTFP<$B@pD$%%`M(@8%0% %(%*D)d8$'pD$pD$dpD !@@%ň %(0`(%5@ %$ #  $_ !(@%U`% %<4pD<4pD< '0!'P%%$,L$ίH$5D$8$d<$2@0$$5$ hC$DQ&#4,c`$+"$-" (eDd@UT$ %$% %@%珼 (%UT $CDB@$ hCw$CQ6" $iCw$nhb$CB4B $nChb$CB4B $fChb$CB4B $iChC$CB4B $nC%$hC$CB4B $iC$hC$CB4B $tC$hC$CB4B $yC$%%'$kH$D$8$<$@0$kh$ $u`td^lCh (CtBp$ ( %@%CE$0hb$CB4B $aCvhb$CB4B $nClhC$CB8B(+@$$$_hCp$DBS$$D$c, ,c`T$)Co p@i$C@M e$BQ#@%$B"^&1",hC$CB4B $xCp@,$B8%`0% (%'9_lM %`%@%%%'p@_$BZ % %p@D$BDa$C8%0%z %%<% % %@菙D Ux,T|} %p@ $Bq %l %Ng %8B(]+` %[ %GV %Q %y@p@$$Ed$d$d$BhC$CB$0Ch$0C$DBQ$L$.C`dP %|d@cDTp %xeTdP ed쯥lhtX\%$Q.# `4D i %x&T+!@%$LhCX$CB$Q.# `4D $,c` $.C܏LP@f$`dꯢPC(B:@$x@&TpX\`8%-@0%X$\ȯx$.@".@揢xplh珤T %T(p `%T 8%`(%@ %X\`8%@0%X\!t  %.@.@ԏp% %Qf]h$B7$B4$B1L@$p.%@$pp@$B(%$p@(%p@(%$B(%%d$f +`$c ! 7b! %C+ !d!`%`@%`(d,8&<|T@UD 04PPQT(%`%@%\X,&@ %`(%`8%@0%.`%@%#[&,(@ %`(%40@ %`(%A@`8%`%s@0%`%.@`P `d dhCR$CB$0CHh%%$0.C $EB#Q&$`dL˯P% %.#Q&hp@@$B(%$B8%0% %%{(%\X%%&C Hr+^!d #d+$BC#@@b *b5D +*b5V#&s `*b5@|$TEDD@ 0#$ `(%I%@ %*s `%`@%X\$ŏ  %`% @%$ `(%@ % 0%8%`(%@ %0%`8%`(%@ % 0%8%`(%?@ %@% %@`(%8%0%`%@D2$"C %(%@0% 'V %*Lp@ @uP`m$B(%@n(%0 +D <8$"$ XC<8`(%Q@ %`%@%C+@D D@$"$ >CD@|$TED D@$ `(%H@ %`%@%@X\8%P0%@X2@V&XR\, %'9\4@(%<Dy`x(@p@s%{,'9\4 %@(%`%<v@t@j8%0% %%x%@]$Z$$$$$B%O%%$`dP %@><:< '!',%hlTPLHD@<840@`D$]%%%$ hC<$DB$CS,c`$+CS$-CQ$@3$0$C $c_=C!cr+`2$ CN &C&_=!r$`E+@x%< &sqǮb!3 +BR+`E@(%rQ0h$dbň!%M %%H %ÏCC $c_=C!c,c ` $CЎp@$B8%0% %D$C%R%8B-,Bh#di$$bb$C,c `0<% 6R$E, `2 +<q!@hb!$$Q`% %폼hC$CB4C $xdf@$ $&_=!$E+@+%%p@$B+@$&$#&#+D#Q#TPLHD@<840'X$0Cʏ &_=!E,@$$% <b!3 +Cr+@`(%['hш$db%%% %%$2( rE!Ř+d !d!'h$d`%b/%b!BR+``2S80V !g+f!`2hb$dc!cr+`D %<$"0D`p@%%h %Џ %c %!BR+@叼َh@ %$ $ 2 %D%  ,% (!Cr+@Z +w, B՘шS%h>  $q%`%(  %叼U"+@I$0B@$@r$$u+@}D$"C;(%Q !+Q!@68%b% @G&7(r !(%(!+e!$E7G@%8%0', tH+P+ "v @@('fj(+!h!D +h!$`%@%% %֏%A믠$$<4E+@ $ &_=!BR+@>؎pQ+@8h %>$@ %$%Я$D %r$"D,C#$Q+@ThQ+@D$e+`R+hC'$CB &_=!E,@$p@  ($B%%! @R! R#|B@$cC!Vk %nf %؏ 58%0%D %%%$B$p$r$o$c$s$f$e$/ $l $d  <%$5H8,F `H%$c!<̠` !4, $C!@#$B0`(%$0,@%E#OÌpt|xe#GH* !h+@!< 'd!'د $,%|x#ptQ!h!"+@%C!D*@O  %@:pt&$+e@% 2!@#(+H#q# We#j(*C,h#d !?8!+g!(+x|$ '( H+ ,8!#d !h?8!+g!(+x|,(#!R!%(+!x$$p|hٮt'8+(#< '!',@%%' DF #D$< 'P!'P<840,($ G$!@DC$ %$!bF$ %@$c<840,($ %'@$ 8!<, !*$%(%$$ J!$ !Hш!$"# !`$"Ϗ% 8%@ %$ \XTLHD@<%P'`<4B!(,8%$@0% (%% $%@ %\XTPLHD@<'`8%< 'h!'',8$,04'௨$` ' @ %@ #$'(< '!'%40,<8%%%'`(%$ ` %`<4d+` $$ `:$$<4d+`5$`%@ % (%`0%8%$ @ %@ #@<8`$<4d+`$`$ <4d+`<$$ <840,'@$$ʯ < 'p!'௨$ ' @ #`@ %< '!'௨$ ' @ #K@ %< '!'', $.$,04@%''௨$ ' @ %@ #+@$ $ '(< ',!$# @ #@ %< '!(%'௨$ ' @ #@ %< '!0%<(<4ޭ$i$ @ #@ %< 'P!'௨$ ' @ #@ %< '!$$ @#< '!$ @ #@ %< '!$+ @ #@ %< 'L!$* @ #@ %< '!`)'د %$%$ @#"@ %$ @ %@ #$ $ 0@@%0$ '(< 'P!'Џد$, $' $ĠX$,'0< '!$ @ #H@ %< '!$ @ #9@ %< '!'Я,@ <$BB@b+@$菿,$"'0pCܯ' $ %,'0%'% %(%0%! @#'< '!'Я%$ ,(%%$8%$ @ %@ #$ ,$ `%('0@0% (%&R$@%$@%@~@$$ (%@%$|2$$ (%@%$| %< '!'௨$ ' @ #@ %< '\!'Џ௿,%%$' f(%,'0< '!$ @ #@ %< '!$ @ #}@ %< '!(%'௨$ ' @ #e@ %< '0!$ @ #V@ %< '!$ @ #G@ %< '!$ @ #8@ %8% %(%! @#< 'L!'0%(%'94$ᏼ@ %' < '!'<PLHd`\XT!%c!4+s+(!g!#%  '(&ï0ï8(,4<D@8%$; @%@$#$g ` %d`\XTLH@%P'h $(,04'$ @ #@%d`\XTPLH'h@@ %î î$< 'H!'0%0&1484,<%% %(%a$:@ %$ <80,@%4'@$' %O`(%@ @ %î î$@%s<840,'@< 'T!$ @ #_@ %< '!0%(% $< '!$ @ %@ #H< '!$ @ #;@ %< '!8%0%(%$< 'd!'ȯ(40,%$@8%$ @@%#40( %,'8%@@%󏙀'$ @(%'î $'îݮ8% %(%! @#'% %(%0%! @#''% %(%0%! @#''% %(%0%'௨! ' @#'< '!'؏$'9Ϙ8%0%(%$$@ %'(< '8!'؏$'9Ϙ8%0%(%$$@ %'(< '!'؏$'9Ϙ8%0%(%$$@ %}'(< '!'8%0%'9\(%$@ %j' < 'L!'8%0%'9\(%r$@ %W' < '!'8%0%'9\(%_$@ %D' < '!'؏8$8%'90%(%h$$@ %.'(< '\!'؏8$8%'90%(%R$$@ %'(< '!'؏8$8%'90%(%<$$@ %'(< '!'0%(%'9,$@ %' < 'd!'0%(%'9,$@ %' < '!'0%(%'9,$@ %' < '!M< '!|;b菙EE%|"< '!'<jD0,( @<84$4B"%!&s%P`%@(% @%@0%+@YC#+@?%C+`O@%¨%26%B!@0!00!`%@%R +8B #d +4!b!c`0P (!@">!!`%$$@%R +B#r+@!b!c`!D@<840,($ 'H$@#%%%< '! %'  $`@D$C%' %< '$!' $%' C +b+$< '!'40(<8,&sČ $ %$%'  $ @DA$#C@%<840,('@FB$ p&$ t(!(! '$@叼B&1"!!< '!'؏$ '@<D4cC$ce $ @ %D$C$$'(< 'P!'T\L<\XPHD@8%4$/ %@4b<\XTPHD@<8 %L'9'`PB@ D$C$4᏿\XTPLHD@<8'`-$a@%@叼 & <4 @%@&R $ $Ba ($Bܯ,@Ώ$: %@% @%'4%$% +@%$a^L$cCL&(Cd`$LC*$NC!^G$@G԰+D`F'4$lC.$tC$_ @ %@%B@& $a$  %@%  %@%ޏ% @ %@%@%$S#"+@я (%S !  0%q!&( @ %돼%$ $&`$$Pa %&` %'&b C!, `$C\%< '!'ȯ( 40,$%%\P` %40,($ '8  @(%@@ $$ % @%@%."@.b@\D$ԬCL &\\`x3 !$ $@%@T &\%  @(%@ (%@$` #T &\`&&&! @(% &f (%`¢`b%`@$  @(%@ ю1%< '`!'X\%(@BDld||;%jp\B(Ld@,B@l@  :(ll $@%,B@(\Q` d8B `%\LC@|Bb%%ڗl $ @("@1QWCi%$Ɵ ` %@%@( &Ra0$ @(%  %@ (&1 $ "C$$B,B@! $ $a@  %@($$;"@'C&1$ "C$B,B@ &1$   %x@T($Q&1&$ $  'x@%(ޏx$$aL  %@( &1a(&1 `CX`DXd`d`Xd@%@o(@  @%R+@b(@ c %%X@ݏ`"#b#`(%  %$BS+(`L&R"!$x$ m$ @%(@gt ` %(:X!5\`PXK$ p("H &$Ba\!D"@ %X P(@% $BaTb!0%$@@ % Sh@(T!hhR##T0%$. @ %@(R#P&sv!b!Tb!p!&#'(P $B4't<8Tld$D(% hH4 P<8 P@%@(0%$_ @ %@(R#%'< '!'؏$$0%$'(< 'L!'؏$$q$'(< '!'؏$$$b0%$'(< '!'؏  $% $@%@ $P& $(%  %$ % '(< '`!' %@ %d q' ' 0!C8!Bb%8!8B !b%b%< '!%(+$C#b! !@0B(#0cDb%(C` $B@$cb C!B< '8!'Я($  ,&1f" % %$@$ %+$` 4g $,$c,c `$$$$`@  %$B!@⏼,C`pS&@(%@@ &Q#,($ '0  %$B!p!$PB< '!'Я&x($, %%$SD$C$$@ %%@%S $f$!c,c`@D!B%,C` 6,B@,T $@P@@%$CT,($ %'0< '!'0hdTLl`\XPH%%@;%% |p@$Bf$c$C!D! v$U|;@D}`%`%$BBX($%bX $Baد0 $Ba4&@(CXlhd`\TPLH%X'p%0B,C `4b!B\!@,@$((%'@ '8@%$$ $Dx$P(άCX8&@0B,C `ӎf0b!B\!@,@$,$<$B(!,B@z<+@w$,ԏ'9(%@8%폼$2!(#G!:B8%<$I$@!-\$H(@!-$&<-$X,$! !cd%i!,dG$B(@!C8!B@4$$%$4$$ŮB$VP!P#\$$:.B@B@,'9H(%<C8P$.C$îB$%u$$'9E(%@8%@|b$X,@"$BG"7$,,'<,(% @ %bC+@I$, $"C!"bC#b$ (%,@&$*䏙 '9(%G "$$C#Gf,@@%'98,@古 (%돼$<+4$b8 ,@2"C !C#*$B"g$<+`&<,c`,4`##2*4d8!B$8#g@!0B$e4B !(!B$c#$,@2#b !.8Dd !,8D8Bd !b!*G%< 'L!0@ '௿ %' %< '!$0@F $B`4 $(b@(!@;$Bb%(b@$b$b$B$b0* $Bs$0󏂁 $Bs $d (2@ $Bs8$BD(!@ %D$B$ $Bs $Bs$B< '!|;0e< '!'௼%%' %0%D@%< ',!'P\@0TLHD<84%,@"% $t|@%@B@%$ r $Btb !@%@B@ % $a@%@'B@$%$/$!B@C&1$!$.C!c`$CC @F% $tt  %@ 9$.;% &tt &tt $t  %@\d`1PB@\ ռ$t@%@T'$Q# &" C!',$B@G$: @ %R#@% b+@+Ґ!b%4,bQTx&e  %@Ȏs `0%@(%  %&b 'C!$/&dC 0%(%  !$'(S!`  %@%@Ϗ )$$@%@( @ % $$@%@4CBcR( 0%q!b(% &d db d%PLHD@840`%<'X< '\!\$B< 'D!8 $ \$B\$Bl#+%%< '!'L@%<PLHD<840T% %'%@`%$$T0B@'(%*!BWdb&RV&s  %$@ (% 8%$. $$c %$ e$, 6$i$$w8!*C8 &b$C$$SCBd0% (%  %Q+`# Dӡ$C$LHD@<840,'Ppd8!%d$, $hĀe%$ pe ! %!"#@#< '4!'؏0%'8'9$Y$'(< '!'؏4'4$'9I$'(< '!H < '!L < '!P < 'l!'Џ($ ,% %% %P+@%T@(% ` %,($ % '0< '~!|;Xڌg< '~!\B0@ $BuH< '~!'د$ $  '( %@%,B@D$C %\0@ T0&& @(%0$ '( $0@%< '}!\(% %< '}!`8%0%(% %< '}!|;$ePX$c $` %XC$< '}@!d < '}(!|;hf< '} !'Џl($ ,% %% %@%P+@p&F`(%  %,( @%$'0,&p %0! `(% < '|\!|;tΌg< '|@!'د$ @;DpT  %@%@8xB@.| %@0.@$0 !0$(% #Q#.`$H@ %0%g%(%e%`$$B#0!$ 0% %(% '(4$ C%$  %'(< 'z!d< 'z!'د$ @;Dp C %@%@8xB@.| %@0.@$0 !0$(% #Q#.`$H@ %0%g%(%e%`$$B#0!$ 0% %(% '($ C%$  %'(< 'y!< 'yp!#f f##`(C`$@0cb!< 'y!'#D$$ D 'DѤ$C %$ %'(E+@%Dѕ$ xB@%B@D.$C &$J !@ %@0B@4@0c<*@)(#$>8* g80g80$0$I&|--&0)< 8@0!pf8P*@0!0*|!;1$0+<(+$pg($B'9 X@!$ep0&(!0#ǀ$$e 0%$8$| H@(!9 !#<1G+@ %K 0%#$h$< 'vX!' #(2$!$0#D@<840,$ (%+@7$/$$$^P#&1Q+@" P@ VCC` Cw Cq!`C`4C`c`CcCbCb!&+&@&sD@<840,($ 'HBBb쌢@4@@BEE< 't|!0@4@0<*@ #$CdC& *D 0D 0ޏ$D $(|d-,0 @ !p(8* ! *|d$cf+`<($|d< 's4!'$ %(,$0 %8%&$@!$B|-|@(h0<@+| H@ @!+$A(+e$e, F#(!$b "!D$b "!j@ @$d |-(b0@$b<"!.ŒD #$D|B@"$D$B&$ @$B$$d, "#!b (%'9 +&$FC,$ @%('0,dK$e<(%(!$@@!(+(A$d e&%@@ޮ@@$d  $ !E$b "!EE$c #!b@C `Cd$&$e#F$Gf@$ %@}4$d  $ !όl$b ($E m0B '94@ %F@0@(%'9|'}(b0@$c  !P'9 (%&< 'oX!a'Џ$ ,('94P%@%B$0QC$D P$$B@ %b8$4b!D| @e@!,($ '0&%@,| @L  0%(%'9|'T  ׏DR@%  (%ˮ@4@@BEE< 'md!<C+`|C`$B|B-@b!B< 'm!''9LP%@%F@#p $B%$cI!DC!G$D04' +AB @% %A %8$' +8#$'H+ G$9DG!@DE$D #!b(#D #d(#(d`$C!@0cd!C' < 'k!$,)$DBb%b%b%b%b%$b'C$<k4c)pC $cuTC!B$B$C@!cd+`@$B@(!d+`$B< 'k!$bD $B`%$d @$BD$b0B< 'j!PB| @ L @T< 'jp!'08 D@<4`P<A'($cNmrc(%$,Cq!d,($`R`#$$B&be$$ ` % &1bb cbcCbb`w`.Dd `$#A 2!(% %$ @#"$@0H, %$ @%@ ## #&E $!@#!$%%$􏙅$0% @(%2#$B&",(@87$ $TrT(%%$$0% %Q R!&r ,$B &B"$@$@(%  %@ҏ DQC$YbD@840`%<'HQ("#($b ($BT< 'g !'84$ <% d !D LH@0,(@%C `ECC~EEeCC@@b!B@r@!V @b@%&<b!GPF* @܏ 5!$Buxb!d +c+$c5!Q!C!Q$#B&C+$ r6($I+@p&,C `b!D͐H-d9'92@ * @&=b!B8!+@$2$E#C$I!%%$$$(% %W @@@@ @@@(%'9&dt$`%D$6E$c|Bc!bEH$&$ce$`FF b!F%C `4|e-(@E!$G9p($H!%"E&(B@ $B* $B|C8$ (%C$cd $ #F$G@$(%f$C `D|-$, d !$ # $d#C *#<k4c)D$pC $cuTC!BLHD@<840,('P3%2$cutC!Q2"@+@<CCr6C+@#$cd#(c `0-c`$%+C+@%$DE+@=@$E#C$I!*"@7#$$DE+@$@V!$#$D$!$@E+@@@E+@$V!$#$D$!$$W#C$&D!&C+`0F0+@8+G $G $#$D$!$$E#C$I!􏙅@%$C~Cc $cc $v$cq *&#(d ~!2? !$d($E E &1$  #$DBRB@(%D'9|d8ĠD2#B4c0Bu%b%B  $BB Cd !B%$ '9 % (%@ %'9(@%@(%@ @!& w!g 1'9$C |CC$0cd%C$D %$c#(* !&#< '_4!'<4B+ <840,(@5<4B+@a%$%%$$$`(% %@%Q& PB| @L '9 @%@ T `(%  %%`(%9 %(u@ %@ %`(%@@0% %`8%ۯD`(%@ % 7@%` %`(%`%(X@ %@ % (%H@0%` %`8%L`(%@ %'@TP$ %@%$8%;0%&1@$5&g$'0 %@@%0<4D&8<D& M#&s40<w8< '@d+`᏿D8%@0%@ %% @%`(%'9u@ %@@% 0%8%`(%  %`8%@0% %(%Uq@ %@0%`8% EDD@`(% TP @ %@%` %D`(%U``%` %@(%@%'9u`%@%<?$B33+ -`%0%`8% % (%@@% %0%8% `(%@0%`8%@ % `(%ljTƉP`(%K@ %@0%`8% E@B+@E$<$@D3D@<840, %%($'HRE@%<?B+@`%<?B+@菔  0% %`8% `(%D@`(% @ %@% % (%GF `%`8%@0%` % @(%`%@%% 0%8% % (%@%0% %`8%`(% `%@%` % `(%GF `%`(% Č @ %`0%@8%`(% @ %`(% ̌ @ %`0%@8%`(% @ %`(% Ԍ @ %`0%@8%`(% @ %`(% ܌ @ %`0%@8%`(% @ %`(% 䌆 @ %0%8%`(% @ %@%` % @(%GF `%`(% 􌆉 @ %`0%@8%`(% @ %`(%  @ %`0%@8%`(% @ %`(%  @ %`0%@8%`(% @ %`(%   @ %`0%@8%`(% @ %`8%@0% % (%@@% % 0%8% `(%$X %(%@0% `8%`%@%D@ % `(%D@ %(%`% @%`8%@0%` % @(%`%@%!$<@4BB+@%  % `(% %(%`% @%`(%$ D@ @ %`8%@0%` % @(%`%@% 0%EtDp `8%`%@%$ $h&R!!`(% @ %@@% 0%8%`(%  %ED`8%@0%< 'h!'<%% %|+`<  |C%(h@+i < @!0%@ % `(%@!@%@ %-' G2%@% $m$o %' @%< 2@m bHeL< &f ,D\ $c(C!beV $c@!@+j2i!f+`$, %(%@ %gT fP`(% \X@ %0% @ %`(%Pj@ %`(%@ %`(%$$ ޏ<b&%(%@ %gT fP@0%`8% E\~DX bXe\b@eDbXe\%(%b8e<< '!'< |%(h0+%8%|@+(%@ % <?G' 2 %$z${' `2z Bw|i$< $ $ $f BwpEw  DЏ ƌeԏEw&.@U $Bwd!Ўj@!@+2#0!+`$. %@ % ew e O@ %9@ %$  O@ %&@ %$쏼<b&%@ % ew@(% uDЏ BЏ Bwx Bwt% |B< '!< '!'<L$|#+, 40(%`<$B"+@4 EwL DwT `@%<P&<>#+`<9#+`6$<$@4 (%40,($% '8OJ@%<?"+@}<?0"+@f (%  %Eȏ @ %@% %  Ew %@(% %@%(%  %@(%@ % @%@%@ %  Ew@ %  ew@(% @ %@ %  ew(% @ %@%@ %  Ew@ %  ewď@(% @ %@(%  %@ % (%@ %$"?(%  %@%E  %E % @% %@(% $@%<@"+   % EwEw % @%@ %  eȏ %@(% $@%(%Dv $@%{ $Bw&Rw2!"! %(% @ %D@(%%< '!'|U,C,( <840$%`P|,C`@%  %@<<P&840,(% % $'@0%8%  %%@% 0%`8% %`(% `%@% 0% `8%EDD@ `%`8%@0% % (%0%8%`(%@ % `(%F@ %`(% TP @ %`%@% 8%D@ED 0%`8%@0% % `(%@0%`8%@ %`(%< '!'<?$|+04,(@@</+@<D$@%(%  %`4<Q&0,$ %('8(%  %(%@ % @%@%(%  Dȏ@(% @ % (%@ % G@ %@ %  e@% (% Dȏ@(%  %@(%@ %䏙< '!'< '!< 'p!'|<F8+<840,($ %%0%8% `%@%<840,($ % %'@0$% G\ FX@%|B@珼$D<)$Bx <D!$b%%8%(%0%  %0% 8%(% %`% @%` %@(%`8% @0%@%`0%` %`8%`(% `%`0%@8%`(% @ %@%` % @(%GdF` `%`(% lh @ % %(%`8% @0%@%` % @(%GtFp `%`(% |x @ %`0%@8%`(% @ %`(%<  @ %`8%@0% % (%8%0%`(% @ %!+b!T$`0%@8%` % @(% % (%`8% @0%@%`0%@8% %`(% `%`0%@8%` %@(%`% @% 0%8%`(% @ %`8%@0% % (%`0%@8%`(% @ %`0%@8%`(%)@ %$D<*$xF< '!'|<C0+<840,($ % (%@%<840,($ %'@d$`$@  Ew@(%$|BC`<&Q$B !< $ %@%`0%` %`8%`(% `%`0%@8%`(% @ % %`% @%@% 0% %`8%`(% `%@%0%8% %`(% `%`0%@8%`(% @ %0%8% %(%`% @%0%8%`(% @ %` %@(%`8% @0%@%`0%` %`8%`(% `%`0%@8%`(% @ %@%0% %(%`8% `%`0%@8%`(% @ %0%8% %(%`% @%0%8%`(% @ %` %@(%`8% @0%`(% @ %Z@%C`<*Q$c(%pC!< '|!>< 'd!'ȯ(|U*B3$ 40,%@(%@8% 0%@" )*Rgf %  (%gf`(% @ %@ %0% 8% `(%@ %%@/`% PhQl40,(% % $'8gf %  (%gf`(% @ %@ %0% 8% `(%@ %%@`% P@،QD % (%0% `8%8%0%$ %`(%`% @%AǏ  %GDF@  (%`%@%< 'x!|=$c(e(%'Я(,$`%<6p$`  Ew` 0!'$,($'0  Ew` <@@,<?< 'ߴ!O<F$|8%%%<|e$C%< 'l!< 'T!'<?|$c!C+4`<<>F4cC+@ Gd F`$@ % <?cD4'848%0% '8C+@0% 8%4' 0B$,($C $H@􏙅ʯ<&<< '!'<?I$Bۯ |+,($@<@{<9+@  Ew` Bȏ,($ '0 `(%@ %,($  '0$BS+(%@1 <@4 +  \X`(% @ %@ %`(%<b&񏙁  <8`(%@ % `(%@ %%<8@0%`8%<@$B1+@%<<@4B+@  `(% @ %@ %`(%  < & GF`(%@ %+ ,H'0B$C $C@ <C&@ %`(%< 'd!'%<?|$.B(+ 4 0,($E%<>P + @(%d` ` %@ %@D40,($ '8` %;@(%@%@0%`8%@ %`(% `%D@@ % (%`% @%@0%`8%@ % `(%`8%@0% % `(%D@`(% @ %͏4<@$.B +0T` % @(%@%D@@0%`8% `%@0% 8%@ % `(% T݌P4,($D@ ` %@(%'8< '\!'<?1|$Br+ ,($@0 <9+@  Ew`ȏ,($ '0  @(%@ % @% % @%@(% @ %@(% @ %ȏ @ %܏,<B$Br+@(` @(% @% (% @ % ȅ,$ȏ '0< '!< '!X< '׸!'<?+0D@<84,($ @⏔ %I'(%D@`(% @ %@% % `(%GF `%`(%  @ % 0%8%`(% @ %`(%  @ % 0%8%`(% @ %`(%  @ % 0%8%`(% @ %`(% Č @ % 0%8%`(% @ %`(% ̌ @ % 0%8%`(% @ %`(% Ԍ @ %@% % (%G܌F `%`(% 䌆 @ % 0%8%`(% @ %`(% 쌆 @ % 0%8%`(% @ %`(% 􌆊 @ % 0%8%`(% @ %`(%  @ % 0%8%`(% @ %`(%  @ % 0%8%`(% @ %D@`(% @ %`8%@0%` % @(%@0%`8% E D D@ %@<840,($ %'H(%%HE %@%0%`8% %`(% `%D@`8% @0%@%<@4Bm"+`% > ` %`(%G F`(%  @ %`0%8%`(% @ %`(% $  @ %`0%8%`(% @ %`(% ,( @ %`0%8%`(% @ %`(% 40 @ %`0%8%`(% @ %`(% <8 @ %`0%8%`(% @ %`(% D@ @ %`0%8%`(% @ %`(% LH @ %@%` % (%GTFP `%`(% \X @ %`0%8%`(% @ %`(% d` @ %`0%8%`(% @ %`(% lh @ %`0%8%`(% @ %`(% tp @ %`0%8%`(% @ %`(% |x @ %`0%8%`(% @ %`(%  @ %`0%8%@ % `(% `(% @ %`0%8%`(% @ %D@`(% @ %@%%@8%<U&`%%0%@ % `(%`(%% % @ %`(%T=@ %@%%8%0% %@(% @%%0%@8% %(% `% %(%`8% @0%0%`8%@ % (%`% @%`8%@0% % (%`(%T @ %`8%@0%  %@@%0%8%`(% % ` %`(%G F`(%  @ %`0%8%`(% @ %`(%  @ %`0%8%`(% @ %`(%  @ %`0%8%`(% @ %`(%  @ %`0%8%`(% @ %`(%  @ %`0%8%`(% @ %`(% Č @ %@%` % (%ǦF `%`(% Ԍ @ %`0%8%`(% @ %`(% ܌ @ %`0%8%`(% @ %`(% 䌆 @ %`0%8%`(% @ %`(% 쌆 @ %`0%8%`(% @ %`(% 􌆋 @ %`0%8%@ % `(% ጆ< '˰!'< %|+$40,(@!%(@$ #@% 0% @8%EDD@ `%`8%@0%` %(% 40,($ '8<?+@<@<>0 +   % %G F؏@% % @(%G F `%`8%@0% % (%`(% Ԍ@ % 0%8% % % %@%  %GF`(% `%`(%  @ % 0%8%`(% @ %`(% $  @ % 0%8%`(% @ %`(% ,( @ % 0%8%`(% @ %`(% 40 @ %@% % (%GB+@  (%  %@(%} % Ȅ (% @ %D@(%ZB+@(%'9P` @ %0@(% KDw40,($ !'8` EwLEwL9 %< '!< '!< '!'<%L~5U&7@%,e?\XTPHD82%a.  %GDF@@(% \XTPLHD@<8'``<#@O$A % \XTPLHD@<8 '`󏙆$%( %@(%  8%0%`(% @ %8%0%@ %`(% `%@% %`(% `% 0%@8%`(% @ % %(%`% @%@ % (%`8% @0%@%2b@$B!`%C 8% (%@0%@ %@^ !,( (%@ %`% @%$ `(% @ %0%8%`(% @ % $B!GF (%@ % $ $`8% @0%<8 (%@ % 40`(% @ %0%8% %(%`% @%`8%@0% % (% `8% @0%`<?<!0%8%@ % `(%0%8%@ % `(% d``(% @ %!@0%8%@ % `(%@%0%`8%@ %(% `%@% % $`(%D@ `%AV  0%8%@ % (%0%8%`(% @ %D@ %(%`% @%@%D@`0%`8% `% 0%8%`(% @ %0%8%`(% @ %`0%@8%`(% @ %D@`(% @ %@%8%@0% %`(% `%@%%D@,(,( @ %40D@ %(%0%8%@ % `(%0%8%}%%< '!','840,$<(%?o%@%~U,B@=@8%0%@ %`(% `% @&h % (%$C!bc<840,($'@ @ %GdF`  (%`(%0z@ %`% @%$C!@ %  (%ڏ< 4`0%ElDhAt8%< ' !'Џ8'($ ,?l%@%~B=,B@.H(%  % @&x @ %$B!B,($ '0  % Ex<@ % @%$C!  %䏿,  %`(% d` @ %`(%0@ %`(% @ %< '!@G< '!'<%L~5U&7@%,e?\XTPHD8D%a.  %GDF@@(% \XTPLHD@<8'`` <#@H$@<$ %\XTPLHD@<8 '`4B"+@  %@<b%$C+`(@D(%( 0%D@@8%(%  %8%0%@ %`(% `% %@(%`8% @0%@%2b@$B!`%C 8% (%@0%@ %@^ !\X (%@ %`% @%TP`(% @ %0%8%`(% @ %LH (%@ %  $@ %`(%$C!g f $`8% @0%lh (%@ % d``(% @ %0%8% %(%`% @%`8%@0% % (% `8% @0%`<?<!0%8%@ % `(%0%8%`(% @ %@0%`8%@ %(`(%!@0%8%@ % `(%@%0%`8%@ %(% `%@% % $`(%D@ `%AV  0%8%@ % (%0%8%`(% @ %D@ %(%`% @%@%D@`0%`8% `% 0%8%`(% @ %0%8%`(% @ %`0%@8%`(% @ %D@`(% @ %@%8%@0% %`(% `%@%%D@,(,( @ %40D@ %(%0%8%@ % `(%0%8%`(%@ %%%< '!' <840,($ %@%~U`%,C0`2< %,B@ȏ (%<840,($ '@ (%@D %<840,($  '@  % Ex@H %L@0%ut 8%(%  %8%0%@ %`(% `%@ % (%`8% @0%@%2b!gf@ %`(%`%V W`(% D@ @ %g f@ % (%`% @%gf`(% @ %@0% 8%@ % (%`% @% %`(%`8% @0%0%8%`(% @ %@@%(!0% %8% `(%`(% @ %sq%< '!0< '!' <840,($ %`%~U@%,b+@3< %,c`  (%<840,($ '@ Ex@D %<840,($  '@  % ExAH %L@ %g,f(  (%u$t @%@0%(% %`8% `%8%0%@ %`(% `%@ % (%`8% @0%@%2b!gDf@@ %`(%`%V W`(% D@ @ %g4f0@ % (%`% @%g$rf0+<3<?$Bb+` v Ey $@% Sy`(% @ %@(%@ % @%`(% @ %@%  % ̏@(% % @%@%@ %  Ey@ %  ey@(% @ %@ %  eȏ %@(% @%@(%  Dw %@(% @%(% % @%@(%  Dy@(%  %@ % @(%@ % Y@(%  %@(% @ %@(% %|Ey $@% Sy  Ey @(% h Dy  @ %@ % @%@%` %  Ey@(%  %@%` %  Ey@%ab+`o%<$@(% D@<840,(%$'H (%(% @ %(% @ %@(% @ %@%$"@(%  %̏ @ %̏@ %$"#."9  % Ey A  %@(% @ % ey$@(%  %@(% @ %eڏ&5@ @(%  %eȏ @ %@(%$" %@ % e e@ %ʏ %$#*1  % @(%d(% @%@(% % (%􏙀(% @ %@(%  %e@ %폙 `Pv< 'x!(< '`!6< 'H!'<$b(%|+,$ @%%%,<~D$b+@ @0% 8%` % (%@` %(%@0%  8%`%@%,$ `%%('0@% %%%< 'P!'<|$Bb+$ `%|b+@% @ %  (%@%$ %'(%%< '!P|<+|<+< '!'ȯ(|U*B3$ 40,%@(%@8% 0%@" )*Rgf %  (%gf`(% @ %@ %0% 8% `(%@ %%@.`% PpQt40,(% % $'8gf %  (%gf`(% @ %@ %0% 8% `(%@ %%@`%%% % (%0% `8%8%0% %`(%`% @%@ȏ  %GDF@  (%`%@%< '!|=$c(e)%'Я$,(`%<61q$$`  Ew`!'0$,($'0  Ew`@<<p %< '!O$ (%%$4c %@4c%!4c@ %@4c%B8BC%< 'H!' 0q0c$%(%` % %@%gf@ % (%`(%|CU`@ %$c7@%< |B%(@$c̮ $ %'($< '!'`x&h<8@D0%8%'H%|@DP%'X0%8%'h%`*@*@p@D8 <`8%@0% %(% `%@%(b@$b쏙|x%%'L\XH@H( $H @8!+ !D! 0!$!, G(+ +D !(!+E!(!b#hl*@@j$b, % (% 0%$@ %0 (%0#`% @%`%@%Tdb&00tC,!B!r+!+@$r+@%("!Q+!b!0!C+q! 4 4$B@'9$P$@0`(%0#  % 4,0%@% `%`(%0%, %C% "%C%+C%TP#0@* % `(%`%*@%$J- UT&'*@@@$$@,T#$ % @0%$ %0C%0% +(,@0%@% %(0%%, 0%(%}%CC#*B@@,$@0# %  (%C%@0%0 % (% +@%c%%d%%,(௠% %%$Ԩ#R#S+# +(%$@(%%Q#0+( # #C0#F+ ## A4,(B#B+@%#"##"+# %C!# +b+d #!P!d+C# 04,B0 4C%@?%@ %'9:`(%$PBb%2sBQS%, %`(% 0%@ %`%G%# +D # (#`%t@%$- UT@0%@8%(%  %@  %GF @(%`(% @ % @ %`(% ~@ %@@L(BE(% B<@D %02s@(%+ # #(#T @0%`8%@ % `(%0%8%`(% @ %@%@ % `(%GF `%@0%`8%@ % `(%@0% 8%@ % (%`% @%`8%@0% % `(%@0% 8%`(% @ %`%@%|0% %x@(%@'S%(+"(%"*d %+ # #(#T ܏S%(+"(%"d %*<'!'ȏ4,($ 0% %` %`% @% (%`8%@0% @ % %`% @%@%`0%@8% %`(% `%`%@%|c<b % (% 40,($ '8~U$C`0%@8% %  (%`8%@0%@ % (%@0%8% %  (%`0%@8%@`(% @ %@я@̏`0%@8% % (%*0%V 8%` % @(%0%8%`(% @ %8%0%$@ % `(%(BV&"Q+0! %@(% % (%`0%@8%叙."#&"<'}4!X'<'}!'% %%|<$+($,%`%~E $+`,`C$@ ,@%`%@0%`8% %  (%@,($% % '0<'|8!'<|$Bb+ $` %|b+@ %C$ % @$ %'(<'{!\<'{!'<$b$%|+ ,(%@%%,<~$+` % b$` ,@%`%0% 8%@ % `(%@,($% % '0<'z!'<|$Bb+$ `%|b+@%b$ % @$ %'(<'z !`<'z!'@b%(% @D%80$<4, %%`%<|$+` ~U0%$%#`(%0%8% % `(%@0%`8%@ %`(% `%@%<840, %`%($'@7@%C8+0@b8+ C菿<現88%0% %`(% ?~b%A4@,$0#  %`%@%U7<b%A,@,$(%0#  %`% #(+B#e#(*%`d%@`%%@( +0<B!"%<u$b%%'&1%@<B%%'&%@ޘ^%`d(%`%%@r%@&1@R%@&1$(%0# @ %`%<'w!'@@ <|$f+`|=$8% @(%@ % @ %%' @C@+C(%%|@A$f#g|=@#<B@$@#(FH* e@#%@<b!5%<8$ %$@<b%$B@@|(%@%@$@$$F#C<'u!d<'ul!'|U $%%@$%@8% 0%@  %GF  (%@0%`(%'9 D@ %@%B`%$BB$ % %'(@$D$B<4B$<?%<'t!'|= $%@%H (%@  % Ey( (%'90@ %@%"$B"$ %'( $D$B<4B$<?p%<'s!h<'s!'||+\XTPLHD@<8@%H%@%+@%H% %@%@0%=%%-$ %%%%8%0% #(A(`0%8%` % (% `%@%\XLHD@<8%%TP'`  (%` % Ď` %@(%`% @%@%`% CB  %Ǘ̏Ɨ(% @%`0% %(%`8% `%`0%@8%`(% @ %@%`0% %(%`8% `%0%8% %(%@% `%Ǘ̏Ɨȏ %(%( ,@%0% %(%`8% `%0%8%`(% @ %@%0% %(%`8% `% 0%8% %(%$ @%0%8% %(%@% `%0% 8%`(% @ %0%8% %(%0 4$0%`(% @ %04`8% @0%$0% %(%@% `% %(%`8% @0%`0%@8%` %@(%$ @%(,`(% @ %`0%@8%` %@(%@% `%0%8%`(% @ %`8%@0% % (%0%8% %(%@% `%`8%@0%@ % `(%$`8%@0%  %0% 8%`(% @ %(,`(% @ %`(%D/@ %`(%@ %(=  (%` % ` %@(%`% @%@%`% CB CDB@%%<'n!'||+,($ @<% %@%<%" %+@ #< C+@<]@(% % @%,($ %'0+@?<!  y0y0 % @%@% Ty, @ % %`% @%`0%@8%` %@(%`% @% 0%8% %(%`% @%`8%@0%` % @(%`(% @ %\/ @ %(%@ %"+@  y,y, % @%@% Ty0T<'l!l<'k!'|U($,%@%#D %%`$(% %<,($'0 @$Bd %@,$C$B(% %#D % %<4B<'k!'|= $@%"@ $(% %<$ '($B @$ $C$B(% %"@<4B<'jh!l<'jP!'\(%\XTH@<8`P %LD%;% %(%X`%@%@%p@`%<P&@0% 8% % (%`%`@%<b+@0%8% % (%`(%@ %X<@0% 8% %(% b&8%0%$`(% @ %A0%8%@ %  (%@(%,0%0`8%` % @(%`%@%`<Hb+@ p@~,<C&,<@ +@ <@$B.+@揂 <@4Bm+@ ČBȯ$ &s&RЌCԌBЯ0%8% % (%`8%@0% 4D @@%G,F( %`(% `%G$F `(% @ % 0%8%`(% @ %GF`(% @ % 0%8%`(% @ %GF`(% @ % 0%8%`(% @ %G F`(% @ % 0%8%`(% @ %`(% @ %g$f  %(% @%gf`(% @ % 0%8%`(% @ %gf`(% @ % 0%8%`(% @ %g f`(% @ % 0%8%`(% @ %$ `(% @ % 0%8%`(% @ %`(% D@ @ %`8%@0% @ %`(% D@ @ %0%8%`(% @ % <@ +@34<@$B.+@: <@4Bm+A CB &&֘SR,( % (%$ `(% @ % 0%8%`(% @ %`(% @ % 0%8%`(% @ %`(% @ % 0%8%`(% @ % `(% @ % 0%8%`(% @ %`8%@0%`(% @ %,( %(%@% `%$ `(% @ % 0%8%`(% @ %`(% @ % 0%8%`(% @ %`(% @ % 0%8%`(% @ % `(% @ % 0%8%`(% @ %`(% @ % 0%8%`(% @ %`(% D@ @ %`8%@0%@ % `(%`(% Ԍ @ %`H%@@% (% %0% 8%`H%,0@@%0% % (% `8% 4`8% @0%`%@%  %G$F  (% %(%D`%+@% %(%`8% @0%\XTPLHD@<8'`0%8%` % @(%,0 CB$ &sX/&R CB$ &s&R(CČB! C܌Bد$ &sP&RxCB௣ CB诣%%&&֙ CB &&֘S͌R CB &0&֘`S R<'_!'<(|B+<840,$ @0% 8%@0%`8% EDD@ <%+#~s`%`@% 0%`8%'9`5@ %<840,($ '@<? B+@  0% %`8% `(%@% % (%GTFP `%@%` % @(%G,F( `%`(% 40 @ %`0%@8%`(% @ %`(% <8 @ %`0%@8%`(% @ %`(% D@ @ %`0%@8%`(% @ %@%` % @(%GLFH `%`(% TP @ %`0%@8%`(% @ %`(% \X @ %`0%@8%`(% @ %`(% d` @ %`0%@8%`(% @ %D@`(% @ % %(%`8% @0%`0%@8%`(% @ %D@ %(%`% @%D@ 0%8%`% @%`8%@0% % (%`8%@0%` %-@(%<8B+@  %G|Fx `(% %(%`8% @0%`%@%D@ 0%8%<'[!'@E%<840,($ @ 8%EtDp0%  <%8%0%(% %<+@% 0%8%EDD@<@+@<>@$0%'9`!8%<840,($ '@+ @ʏ 0% 8%@%@ % `(%GlFh `%`(% tp @ %@0% 8%`(% @ %`(% |x @ %@0% 8%`(% @ %`(%  @ %@0% 8%`(% @ %`(%  @ %@0% 8%`(% @ %`(%  @ %@0% 8%`(% @ %`(% @ %@%@ %  (%GF `%`(%  @ %@0% 8%`(% @ %`(%  @ %@0% 8%`(% @ %`(%  @ %@0% 8%`(% @ %`(% D@ @ %`8%@0% % (% %`(%p`%@% %`(%`%@%`8%@0% % (%D@`(% @ %@0% 8%`(%@ %D@`(% @ %<'W8!'hD8,($ @<40% %%9D%` %d0@%@%<P&@(%  %@%<"+@b`(% ` %@ %d<@(% % &(% @ %Ag(% @ %@(% % @%@%<X"+ = ~v<U&<A+@V <@$Bs+@Y <@64B+@] Wz &Rz &1z4Bz`(% ` %@(%  ȏ%@ % @%% @ %(% @ %%  @ %(% @ %% @ %(% @ %% @ %(% @ % @ %E % @%E  @ %(% @ %E @ %(% @ %E @ %(% @ %(% @ %(% @ %ȏ @ %@(%  %ȏ @ %(% @ %@%<A+@ُ<@$Bs+@܏ <@64B°+ߏ Wzԏ &1y4&RyLVz؏E  %E @ %(% @ %E  @ %(% @ %E @ %(% @ %E @ %(% @ %(% @ %% % @%% @ %(% @ %%  @ %(% @ %% @ %(% @ %% @ %(% @ %(% @ %(% @ %ȏ @ %@(% @ %@ %  ex`(% @ %(% @ % % @(%@%  % Ez܏` %\(A@% % @(%D@<840,($ 'H(%  %@% Wz%&Rzx&1z Wz &RzL&1z`Bz Wz &Ry&1zBz Wz%&1y3&Ry܏ Wzď &1y&Ry+Vzȏ Wz̏ &1yd&Ry|#Vz<'O!'<$|B+ ,(@% (%@(% ČD ,($ '0'"~1@% ,( @ %$0%@(%'9+x'0<:B+@ (%  %@% %  Ȅ@% %  Ez@ %  ez䏼 (% @ %@ %  ez菼 (% @ %@ %  ez쏼 (% @ %@% %  Ez@ %  ez (% @ %@ %  ez (% @ %@ %  ez (% @ %eȏ @ %@ % @(% (% @ %e % @%d(% @%@(% @ %@(% %b<!B+@  % Eԏ % @(%@%dO(%<'L!'|,($ ` (%Dv ,($ '0<(% %+@% (%D<@+@ <9,($ $(%'9+x%'0+ @  (%@% %  E{@ %  e{ (% @ %@ %  e{ (% @ %@ %  e{  (% @ %@ %  e{ (% @ %@ %  e{ (% @ %E{ @ %@% %  E{@ %  e{  (% @ %@ %  e{$ (% @ %@ %  e{( (% @ %@ %  eȏ@(% @ % %t@% %$@%@(% @ %e{, @ % (%E@ %$e{, @ %E{󏙀<'I@!'\(%PL<8`\XTHD@ %%3%@%p@`%<P&X %[(%@%`0%`8% % (% `%`%0`@%<b+@%0%8% % (%`(%X>@ %`0%@8% % (% 8%0%`(% @ %@<P&`0%@8%@ %  (%@(%0% ,4 `8%@%0`<Hb+@tp@~,<C&,<@ +@䏂 <@$B.+@ꏂ <@4Bm+@󏂁 CB$ &s&RCČB0%8% % (%`8%@0% ŃD ă@@%G,F( %`(% `%G$F `(% @ % 0%8%`(% @ %GF`(% @ % 0%8%`(% @ %GF`(% @ % 0%8%`(% @ %G F`(% @ % 0%8%`(% @ %`(% @ %g$f  %(% @%gf`(% @ % 0%8%`(% @ %gf`(% @ % 0%8%`(% @ %g f`(% @ % 0%8%`(% @ %$ `(% @ % 0%8%`(% @ %ǃDƃ@`(% @ %`8%@0% @ %ǃDƃ@`(% @ %`H%0@@%0%`8% (%  % <@ +@70<@$B.+@> <@4Bm+E CB &&S R,( % (%$ `(% @ % 0%8%`(% @ %`(% @ % 0%8%`(% @ %`(% @ % 0%8%`(% @ % `(% @ % 0%8%`(% @ %`8%@0%`(% @ %,( %(%@% `%$ `(% @ % 0%8%`(% @ %`(% @ % 0%8%`(% @ %`(% @ % 0%8%`(% @ % `(% @ % 0%8%`(% @ %`(% @ % 0%8%`(% @ %ǃDƃ@`(% @ %`8%@0%@ % `(%`(%  @ %`H%@@% (% %0% 8%`H%,4@@%0% % (% `8% 0`8% @0%@%0t@ <T&  %G$F 0 @(% %(%D`%#k@% %(%`8% @0%\XTPLHD@<8'` 0% 8%,4 CB$ &sH+&Rp CB$ &s&RCB ČBȯ$ &s@&RhCԌBЯ C܌Bد%%&& CB௣ &&SɌR菔 CB & &PSR<'>!'<$|+0,<84(%@%0% 8%@0%`8% EDD@ <|@<8"`8%@0%'99p. %<840,($'@+0% 8%@% % `(%GF `%`(% $  @ % 0%8%`(% @ %`(% ,( @ % 0%8%`(% @ %`(%  @ % 0%8%`(% @ %@% % (%G4F0 `%`(% <8 @ % 0%8%`(% @ %`(% D@ @ % 0%8%`(% @ %`(% LH @ % 0%8%`(% @ %`(% TP @ % 0%8%`(% @ %`(% D@ @ %`8%@0% % (% `(%TP @ %@@%@0%`8%`(%B %%%<';8!'@E%<840,($ @ 8%EtDp0% !<%8%0%(% %<+@% 0%8%EDD@<@+@<<$0%'99pF8%<840,($ '@+@ 0%8%E\ʌDX0% 8%@%` % `(%GdF` `%`(% lh @ %`0%@8%`(% @ %`(% tp @ %`0%@8%`(% @ %`(% |x @ %`0%@8%`(% @ %`(%  @ %@%` % @(%GF `%`(%  @ %`0%@8%`(% @ %`(%  @ %`0%@8%`(% @ %`(%  @ %`0%@8%`(% @ %`(%  @ %`0%@8%`(% @ %`(%@ % ǃD ƃ@ %(%`8% @0%0% 8%`(% @ % % (%x`%/@% % (%`%@% %(%`8% @0%ŃDă@0% 8%`% @%`8%@0% % (%`(% D@ @ %`0%@8%`(%@ %<'6!'hL8,PX %\HD@<40(1#% @ %`%X`׏<&d % @ %@%0%`8% % (% `%`%P@%<b+@%(%  %d@ % @ %0%@8% % (%$ @%8%0%`(% @ %@<P&0%@8%@ %  (%@(%0%$ `8%  %@%P<Xb+@V\X@~<C&<A+@ <@$Bs+@ <@64B+@ W| &R|&1|0^|(%  %@(%  ȏ%@ % @%% @ %(% @ %%  @ %(% @ %% @ %(% @ %% @ %(% @ %(% @ %E % @%E  @ %(% @ %E @ %(% @ %E @ %(% @ %(% @ %(% @ %ȏ @ %@(%  %ȏ @ % @ %`H%@@%`0%`8% (%  %@%<A+@`%<@$Bs+@ <@64B+ S|Џ &1{0&R{HU|ԏE  %E @ %(% @ %E  @ %(% @ %E @ %(% @ %E @ %(% @ %(% @ %% % @%% @ %(% @ %%  @ %(% @ %% @ %(% @ %% @ %(% @ %`(% @ %(% @ %ȏ @ %@(% @ %@ %  e|؏(% @ % @ %`H% @@%0% % (% `8%`8%@0% % (%@%\@ <S& ` %GF @(% %`%\@% @ %`8%@0% % (%`(% @ %LHD@<840,('P+@%$0%8%  %m W|%&R|t&1| W| &R|H&1|\^| W| &R{&1|x^| S|%&1{&R{؏ S| &1{&R{U|ď S|ȏ &1{`&R{xU|<'-!'<|+ ,($@% (%@(% ČD ,($ '0|@<9,($? % 0%@(%'9K'0+t  (%@% %  E|܏@ %  e|(% @ %@ %  e|䏼(% @ %@ %  e|菼(% @ %@% %  E|쏼@ %  e|(% @ %@ %  e|(% @ %@ %  e|(% @ %@ %  e|(% @ %@ %  eȏ@(% @ %ȅ @ %@ %n (%d<'+L!'|,($ ` (%Dv ,($ '0<(% %+@% (%D<@+@ <3,($ 8%$(%'9K'0+@ (%ӌD} (%@% %  E}@ %  e} (% @ %@ %  e}  (% @ %@ %  e} (% @ %@ %  e}@% %  E}@ %  e} (% @ %@ %  e}  (% @ %@ %  e}$ (% @ %@ %  e}( (% @ %@ %  eȏ@ % @(%(% @ % %|@% %E@%@ % @(%d(% @%@(% @ %@ %  e{, (%@ %:<''!'#G%¯\<|S%$cC+tplhd`XTP@ߏtp %(%tplhd`\XTP 'x <'f0&8B@D$x %(%$D %(%%@%%@h`%<be( @ %@% 0%$8% %`(% `%A<Rb+@a$2RB$ %BD(%@L\+`%@%X %(% `8%@0%` %@(%X %Ѵ(% %(%\@%+`%`8%<s&@0%` %@(% `(% $  @ % %(%D`%@%`8%@0%` %@(% `8%T@0%Xц`%@%\ %(%X| %(%\`%*@%p %L(% %x(%@%@%`%%(&  %@0%`8%@ % `(% 0%8%`(% @ %0%`8%`(% @ %`H%@@%0%`8% (%  %%`%@%`%0%`8%%UԯD@t<F0&plhd`\XTP%%'x<>b+`2 *B!@  %GTFP (%@%`% &R%T@SD`%$(  % %`(%`8% @0% %(%0%8%`%@% &`%@%0%`8% %b`(% %ǃDƃ@ (%@0% %`8%`(% ( 0%8%`(% @ %  0% 8%ED , ,@0%`8%< @ ,@%`0%`8% `%ǃDƃ@`(% @ %@% 0,`%8 $CLBHLH$LH % (%@ÃDƒ@%%40$(  %(`(% @ %@0%`8%@ % `(% 0%8%`(% @ %0%`8%`(% @ %40`8% @0%&`%@% ,`(%@ %(`(% @ %`(% $D@ @ %փ@AzՃD(%%( @ %@0%`8%@ % `(%0%8%`(% @ % 0%8%`(% @ %(`(% @ %&R@%`%@M(p %(% %(%xF@%@ %@%;`% % (%(4 ( `8% @0%@~@0% % `(%0%8%`(%m@ %<@` % (%@% %(%`0%`8% `%08`(% @ %&08@%5`%@%`% %`%CB$ ,0( @ %@0%`8%@ % `(%0%8%`(% @ % 0%8%`(% @ %0%8%`(% @ %$ (@ % `(%@( % (%( %`(%`% @%,0`%@%&R@ph %%%(0% 8% % `(%0%8%0%G8%<'@!#'G%|<C%,%$F+(D@<840$ @%ag%@8%0%(% %`%@%D@<840,(% % $'He%` %@(%D@<840,($  'H $'M0` %5@(%`%<P&@<Rb+`g$2=X$\` %F@(%T(j` %@(%X@%`%`8%<q&@0%` %(% `(% $  @ %` %@(%D`%!@% %(%`8% @0%`%@%@D<` %@(%` %@(%`%@%\` %@(%  ('` %@(%X`%@%`8%@0% %(%(`%@%X` %@(%` %@(%` %@(%@%@%<`%%(&  %@0%`8%@ % `(%`0%@8%`(% @ %0% 8%`(% @ %`H%@@%0%`8% (%  %% %`%@%<%ԯ`%$%"%<'0!'% %0|<$E(+LHD@<84,(ZL@ tLHD@<840,( 'PA <' &8c b$동|$Ql @%@t<Bq  %(%@ % @%A;t % %@%|%@%&s ` %@(% @ %(% @ %@(% @ %(%@ % @%@ %3 @L<D &HD@<840,(%'P@%<5B+@(  %E $@%$*" " $s@%  % %@(% & %@(% @%@% (%@ % @ % ` %@(%@ % @%(%@ % $@%(% % Dw@(% % @(% % @%ȏ @ %@% B},$$  %@y%$  %`(%@ % &@(% @ %(% @ %@(% @ %@(%  %@%ᏼ %s@ %`(% @ %@ %  e}0AW@%`%  %@(%@ % &1(% @ %(% @ %(%@ % %@% 7t& % %|@% %`@% %[@%@(%  %@W (% @ %`(%Q@ % @ % %@(% @%(%@ % %&o@%@% @%`%V}4  %@(% @ %`(% @ %(% @ %(% @ %(%@ % @%@` % (%@ %(% @%@%%&1 ҏt`%%(% @ %(% %<'!'| %<$C+<840,($`f!@(% %@%<840,($ %'@E%  %<840,($  '@$'607%3 % %@%@%<!%<&  %@(%@ % % (% @ %(% @ %`(% @ %@%V%@<< %X<P& % %<'!$<'x!%-<'`!%c<'H! <'0!'$<80TPLHD@4|<b+%@%0%8% T<;b+%@<D&$@ % (%<&TPLHD@<840'X<?b%%%~R@(%  %@ %@%( &s %(%`8% @0%@% % `(%G F `%`(%  @ % 0%8%`(% @ %`(%  @ % 0%8%`(% @ %`(% $  @ % 0%8%`(% @ %`(% ,( @ % 0%8%`(% @ %`(% 40 @ % 0%8%`(% @ %`(%  @ % 0%8%`(% @ %@% % (%Gm$B3"+@Ꮒ  % E}`@% (%  % (%@ % @%@% %  E}@ %  e}(% @ %@ %  e}(% @ %@ %  e}(% @ %@ %  e}(% @ %@% %  E}@ %  e}(% @ %@ %  e}(% @ %@ %  e}(% @ %@ %  e} (% @ %@% %  E}@ %  e}ď(% @ %@ %  e}ȏ(% @ %@ %  e}̏(% @ %@ %  e}Џ@(%  %(% @ %@(%  D}ԏ@(%  %@ % ,e}4B"+@ (%% Dw@%<?4B "+@  %% E}d@%/ %% Eȏ@%  % E}܏@ %  e}(% @ %@ %  e}䏼(% @ %@ %  e}菼(% @ %@ %  e}쏼(% @ %@ %  e}|(% @ %@% %  E}@ %  e}(% @ %@ %  e}(% @ %@ %  e}(% @ %@ %  e~(% @ %@ %  eȏ % @(%@% %  Ey@(% %"+@   %@ %@% &s % @(%@% %  E~@ %  e~ (% @ %@ %  e~  (% @ %@ %  e~ (% @ %@ %  e~ (% @ %@ %  e~ (% @ %@ %  e}| (% @ %@% %  E~@ %  e~  (% @ %@ %  e~$ (% @ %@ %  e~( (% @ %@ %  e~, (% @ %@ %  e~0 (% @ %ȏ @ % % @(%@% %  Ȅ % @(%@%.b@J $B}LS!B\!@  % Ey@%  % E~4`(% @ %@%  % E`(% @ %@%  % Ew`(% @ %@%  % Ew`(% @ % Q@ %@(% % @%JD(%2@ %Ɏӎݎ<\"+ j % 4(% @%@(%@ % @%@% %  E~8@ %  e~< (% @ %@ %  e~@ (% @ %@ %  e~D (% @ %@ %  e~H (% @ %@ %  e~L`(% @ %@ %  e~P@% %  Ȅ % @%@(%  %@(% % ȏ @ %(% z%<'H!<'0! <'!'`(% @ %' <'!'6 @ %' <'!<'|!'^`(% @ %' <'8!' @ %' <'!' `(% @ %' <'!'<<0!$ 0+LHD@<840,(%%=@%<?d 9` %GD F@@% 0%`8% %`(% `%@%0%`8% %(% `% %(%ď`%|x @%tp`(% @ % %(%`% @% %(%`8% @0%` %@(%`% @% %(%`8% @0%`0%@8%`(% @ %d` %(% \X`(% @ %lh %(%`% @% %(%`8% @0%`8% @0%`0%@8%`(% @ %LH %(% D@`(% @ %TP %(%`% @% %(%`8% @0%`8% @0%`0%@8%`(% @ % % (%GF @%`0%`8% %(% `%`0%@8%`(% @ %@%`0%`8%` %`(%<`% 88%0%`(% @ %@%0%`8% %(% `%@%0%`8% %(% 0%8%`(% @ %`0%@8% %(%@% `%8%0%`(% @ %`0%@8% %(%`% @%`8%@0% % (%0%8%`(% @ % `(% @ %`8%@0% % `(%@%L`0%HD@<840,(%%'P$$,7<?0@0%8@0%<LHD@<840,($'Pf0ՏL@$0 LHD@<840,(` %'P` %G F`@%<b!<T!~3@&#!< $DH#gf % (%!`(%gf@ % &1 !`(%'& @ %%`%( @%@% %`(% `%gf`(% @ %@%@ % (%0%`8% `%@0% 8%@ % (% 40@ % (%`% @%,(`(% @ %0%`8%`(% @ %$ @ % (%  $`(% @ % $`8% @0%@ % (%0%`8%  $ $`8% @0%  %(%  $ %(%@% `%@0% 8%`(% @ %`8%@0% % (% %`(%`% @%`8%@0%@ %  (% $`8% @0%`(%@ %%(%<'T!'<0!<0+TPLHD@<840%8%7@%0@F%@ 0%@0%`8% EtDp `8%@%T` %PLHD@<840%%'X  0%8%0%`(%@ %$ʌG\ FX`H%< $c_bC!|C,  (%GDF@<?4Bb! @ %@% % `(%GTFP `% 0%8%`(% @ %$ % (%GF ( %(%`8% @0%@%0% %`8%`(% `%@%0% %`8%`(% `%$( %(%`% @%` % @(%GF `(%  @ %`0%@8%`(% @ %`(% Č @ %`0%@8%`(% @ %`(% ̌ @ %0%8%`(% @ %@%` % @(%GԌF `%`(% ܌ @ %`0%@8%`(% @ %`(% 䌆 @ %`0%@8%`(% @ % %(%`8% @0%$(`(% @ %0%8%`(% @ % %(%8%@% `%$(`(% @ %@ %`(%`8% @0%(% `%쎆 @%@%,$%($ !@% % `(%GF `%`0%@8%(%`% @%`(%  @ %@% % (%GF `8%@0%  %쎆菙` %@(%`% @%(%`8%@0%  %$ 0%8% %`% @%@%`0%`8% %(% `%$0%`(% @ %0%8%`(% @ %`0%@8%@+H%<?%%%8%<'!'<d!<f+<840,($ (%`%@` @(% ČDv @(%<840,($ %'@  (%@ %珙ď$ E~T<J4c C! ~$E<?5$B !@% % $ Ew % @(%@(%@ % @%@(%@ % @%@% %  Ȅ(% @ % %@(% @%B$ %  E~X@ %  e~\(% @ %@% %  E~`@ %  e~d(% @ %@(%  %`(% @ %(% @ % %@(% @%`(% @ %@(%  %%$ ! @%`(%@ % @%@ %  e~h@% %  E~l % @(%` %@%  ~p % @(%~p@ % @% % @(%@% %  E~t@(% %'0+'<?A%#(%<'!V<'Ш!<%'$B}<@%!$c}C+<8\XTPLHD@%@_%<+@@ @Gt Fp@ EtDp8%0% `%@%0% 8% %  (%8%0%`(%@ %<y@C+@<<$@\ 4\XTPLHD@% %8<'`4B+@4%  %D@  (%< @%&R_bV!&*6@ `%*@0% 8% % `(%D@`8%@0% 0%`8%@ % `(% <?~R4BB!D@@ % `(%`%@%  %GTFP  (%@@% %0% 8% `(%$ %  (%GF ( % (%`8% @0%@%0%`8% %`(% `%@%0%`8% %`(% `% %%(`% % @%@% % (%GF ,`(%  @ % 0%8%`(% @ %`(% Č @ % 0%8%`(% @ %`(% ̌ @ %0%8%`(% @ %@% % (%GԌF `%`(% ܌ @ % 0%8%`(% @ %`(% 䌆 @ % 0%8%`(% @ %`8%@0% % (%$(`(% @ %0%8%`(% @ %@%,  %G<^%@%b%%A',$ %0# (%` %w*`%(#@&%@~C% %`&`%%@~%@@&s(#0+#wf#`%&`%%%@L$%@C`F<!%¯%@%<U&w!&sw'0%8% % (%`%@%0%8% % `(%@ @0%8% % `(%@ 2@ 0%8% % (%`%@%&C~#X@St<PQ&@^%@&s0$ %(% 0#`%@%<'!'@$40,( %@ %<|$cC+@|=$b%` % (%@(% @ %@%40,( `%$'8@@%`%@A$8#8~=@~"@$ # b(*%$dޏ4!$c@|<8%$B @< %8@&8%8@@$cb(#&8%:$@%%3`5$<8!% %%<&b$cb`(% ` %(%@ % @%@ H(%  %@ 2@` % (%@%&5~# T<S&8@$c$ # <'!`<'!'|U(B3 $%@%! ' &'&`(% @ %@%8%@0% %`(% `%@ PhQl$% % '(' &'&`(% @ %@%8%@0% %`(% `%@叿$%%<'!'|=,B$ @%  %~x%~x @ %(%@ %H @%@ P~$ %'( %~x%~x @ %(%@ %H @%@쏿$%<'!{<'!',|U*b3$ <840(%@%%%<D& @ %  (%*s@ %``(% (%8% % 0%`%@%<840,(% % $'@% @0% 8%`(% @ %@%@ % (%0%`8% `%@% % (%GTFP`% `%`%@ ` %@(%GD F@`%@%Ǐ<<P& $ %G,F( (%@鏙<'!'ȯ(|=.B 40,$@%%<$&  %~x .R~@ %@ % (%@%40,($% '8% ~x (% @ %@(% % @%@%@ %  E@   % E@%a؏4<P& @ % Ey@<'!.<'!'<$b(%|+$ ,%%@%< ~$C+`D< 0% 8%` %@(% ,@ %($ %'0C %8%0% % @(%@叼%@8%<0%S&@%@ %`(% %^ (%@@%0%@ 8%`(%  %@ 0% 8% %  (%@0%`8%叙  %GF  (%@ 4菿, ` %@(%($'0 $ %GF  (%A<$ %  (%@0%䏼<'~!'| %<$b+$`%|b+@ (% % $ '(d (%  %@<(% &> %(%H @ %@ (%  %@(%@ %ۏď  % E~@ 4菿$ % j'(  % E~A<$  %@(%ꏼ<'}! <'|!N<'|! <'|!'د%($ " ' &&( &'@ % `(%&($( $M@% 0%8%@ % `(%$ '(*% ' &&(菼'&`(% @ %&($( %(%<'{!'($ `%  %&(d % @ %&(e$ $e- @ %$ '((`%  %~&f(d폼%~ @ %&(e$ %<'z!x<'z!'؏l $%ä%$ %(% 0#b'(<'zP!'诰% %(#' <'z!'<?|$c!C+84<%`&%<>PC+@<$@ GLFH %  (%@ %$ <% %48'@GdF`8%0%@%`%<C+@0% 8%`%@%&' 0B$,($C $H @߯@%e<`%&<`%<'x!'<?|$c!C+@<84LHD%%%`8%<>F4cC+@$<$@ GLFH@ % `(%@ %$ CDB@#"LHD@<84'PGdF`8%0%8%0%@ %I`(%#<C+@ 0% 8%@ %$@ %#׮' ,($ $@%,($ 2s@%"`%u $d`<"#@(%<R&"4<& &$#&24<'vD!'<?I$Bۯ(|B+,$ <840%%@3%<9B+@<D$@ EwL 3 BȮ<840,($ '@Ew` @%` %`(%j`%` %"@(% <@{$BSB+@H <@4D +$ <8@ % `(%@%`(%` %%r`%<b&#<8@0% `8%@%` %`(%%b`%"` %@(%% \X`(% @ %@%`(%` %%`% <&"` %%H@(%&ꏙ<@$B1B+@;< <@4D + `(% @ %@%`(%` %%&`%"` %%@(%<b&o `(% @ %@%` %`(%%`%"` %@(%t%B+@ (%N" '@%@%2c$d$d ` <42"<R&0<r&2b&"(<'rD!'ȏ$0,4%%'a' #"$ 40,'8<'q!'<?I$Bۯ$|"+ ,(@ %<9"+@<$@ EwL ,($% '0Ew` `(%@ %(<@{$BS"+@9 <@4$ +! @<8@ % `(%`(%@ %%r<&<8@ % `(%`(%@ %%,($  '0@ \X`(% @ %<&@ %`(%􏙁<@$B1"+@"< <@4$ + @ Ќ@ `(% @ %@ %`(%"+  (%@%3'0B$C $C <@ C&@ %`(%<'o!'%4 <80,($%%W% u,t(@%<@~$B.B+@f@(%/ %@%<?+@G`%<>P°+3<`0%`8%` % `(%`0%@8%` %@(%`% @%@%` % @(%GDF@ `%`8%@0% % (%`8%@0% %(% 8%0%`(% @ %`%@%<840,($ %% '@ uTtP ` %GDF@ `(%`8%@0%` % @(%`0%@8%`(%@ %8%0%(%  %<80,(  %@(%4$`8%@0%'@<'l!'Я$,( %?% Sy<B~R$BrB+@I @ %@%<?B+@2<9B+@$, (%  % (% % @%@% %  Eȏ@(% @ %@(% % `(% @ %@%,($ %'0 ŒS̏  % Eȏ@(%  % (%@ %ߏ`(% ` %,( @ %$@(%'0<'j!<'j!\0<'j!D<'j!'<?|$c!C+84<%`&%<>@C+@<$@ GLFH %  (%@ %$ <% %48'@GdF`8%0%(@%`%<C+@0% 8%`%@%O' 0B,($ 毢<'i!'<?I$Bۯ$|"+ ,(@&%<9"+@<$@ EwL ,($% '0Ew` 0%`(%,@ %,($ '0<@{$BS"+@' <@4$ +,@ <8@ % `(%$@ %`(%%􏙁@ \X@ % `(%0%<@$B1"+@< <@4$ + ,@ Ռ@ ݌"+  (%@%3',H0F<'gL!'<?4B믰 |+(,$@;<@4$B+@ 8%0%(% % %D$@`8%@0% `%@%@,<P&(% % $'00%8%  %`(%)@ %`(%@ %  `8%@0%<?$BX+@<0%8%  %`(% @ %@% % `(%GF `%`8%@0% %(%+@  %GLFH <`(%@ %@@%`(% "& % `%`8%@0% %(% % %<'e !'<? %$4cU|+,( `2<><A $B+@ (% %@ % @% ,<P&($% '0 (% @ %@ %  EwDw @(%@(%ݏ4cy+`< (% @ %@% % Ew @(% %ŏb$@􏂁 < Ey$ @ %@ %& Ew(% %<'cD!0<'c,!T<'c!'<T|"+XPtplhd`\%@% GF@ % (%<<"+@ 0%8%EDD@ +tz@@%@0%@8%`(%  %@/`8%0%(% % $@ %GЌFЈ (%@@ % (%$C $Bb!bctplhd`\XTP'x<@g"+@> D@%<@g"+ <`6 @0%EДDА 8%`(%@ % @%@ %(%L(%`(%@ % T PTP` % (%`% @%`(%@ %`8%@0%@@ % (%@%GwF`@%<2&  %gМfИ (%gМfИ$ %(% @%@׏$ 0%8% % @(%gМfИ`(%@ % ( % (%GTFP0 ,@4 $DG܌F % (% $c 8 $cϸA<$`%%%%0%`8% % (%8 !`(% @ %0%8% %(%`% @%< !`(% @ %@%'$`%8%0% % `(%@%<$`%&T` %@(%`0%8%`(% @ %8%0%$@ %(%`% @%A, %GTFP (%@%@ %`(%d`%@ %(%`8% @0%@0%`8%@ % `(%@% % `(%GF `%`(% @ %$BB!C( @ %,`(%TP @ %`8%@0% % (%`(% \X @ %$D$D$DF@H%8%0% %q`(%C$gМfИ % @(%@@% 0%8%`(%) %%%%%% %`(% 0% 8%8 !`(% @ % %(% 0%8%`% @%< !`(% @ %@%'$h`%H8%0%@ %d`(%@0%`8% % (%0%`8%`(% @ %@0%`8% ED D@`%(@%<C&(@C&4 (GФFР0` % @(%`8%0%`(% @ %`H%$@@% (% %0% `8%`(%`8%@0%  %@%,`%GTFP4D` % @(%@0%$4`8% %N@(%@% 0%`8%` %@(% `% 0%8%`(%@ %8%0%PH&8%0%@ %`(%& bh cl<'Y!' `(%4@ %`(% @ %' <'Y!4<'Y!'|U$ (@($<840,%@%0( $%%C0 $ $@%`%$#$C%@  %GdF`  (%@ %''u$T$<840,% %$('@<'X!|=$c(e %'(f $ $$p$(,`% ' Ew`$,($'0<'X!8<'W!'Я ($,%%%&R$$  @ %@R#"&1b%4&,( `%$'0<'W\!\ $cH`%$0?`0!$c!f<'W!'௼" @% $B$/@ !e$/@$C(! !' `$B`% $Bt<'Vd!'௼ &t䏿%' @% $B$/ !  !$/ $/!e `@ $B !@$B !@$B&<'U! %#<k4B)d$pb $Bb!b$B<'UL! %#<k4B)d$pb $Bb!b$B<'U!%@ $B#d$<k4)pdC!B$B $B#<ke$4)pdC!B%<'T!'|(tplh`\$dxdX%%% (@%'@\$$@ % 4('<< $$S($S$T$%&P0S`30BH$ $l@%@Q( E$Ɵ8%C% %$@>$B@(%@@%H%%)$ $| % ( %(S@ (0B@m<< (%|xtplh`\X`%d'&4&<&D 0%$T$c@%$X%L$(!d(!$c$c$B$6$ H$T3@GE3@3&3@>@<$BX$cL3&֟$  0%$| $@(6b8B$$b %-% 3 &1 8%$&3@&1 8%&&R@%@%$T`$:e$C$: % %@⏼($T@ҏ4%<'PT!'@HL8%D0%@%,'( 3'$@{l'@w' %' 0%p(% $'0< $<D '8@(@ $$$8H@%@"@ $@ 8H9(@%@4&RU&  %@8%0%x@(% %$B&Rr`` dC`B b~%$#!$c`$D d$:Lc`kR@ % 4@8%@0%^$$خ&RZ$:$#8!$c#!d@*$cU$h$h<'A !'؏8$'9!.B@D e$N%%$ %@&Bb!cu&$C$C0u@%%%0% `(%@0%Pۏ@SDA, C$b;& 'C!4 qW@%$B$(bD &$Z$ 'C!BU$/p!cb#`(% p !B& &%N$N$B'C!@0U. P$ ` %@ ` %@%$$/&(. '& C!$/DC&4#&&!,B@~'0T(! P !0%`(% @ %0! @'0(%&& @ %ԏ$@&&p!BD.&Q(+&@%T 쏼 X T P L H D @ < 8' `<'!!$ @ # @ %<'!!$ @ # @ % ` (%$ @## <'!D!'@'<D%$  %`<4d+` $$ `$$<4d+` %$$$ %(% 0%8%$ @ %@ #$  @%D@%<'H`<C+` <4B (`$<C+`<4Bد,$04'( $a04ݏD P$<'!'',$,%04 %<(%@0%8'௨! ' @ %@ # $'(<'$!'<$0%-$@ %\D؏$ $T d' ' <'!'PD\(%% %(^@%\bA2"'9c(2"@̏\B"% %('HD(%'@ @('t48%$ƃ($ @ %(\0B@ @($c%%$ \$B'<4d' 8%$$ƃ4$ % (^$#8%0%(% ! @%@V(^+_"!'&"C!$ DؠC&1d8% 0%,U(%A6(C$ b$c},b@4 b0B@Ȏd$  $T@ (؎d8% 0%,:(%A(0B@H<$ $l@%@(<8!$L&0#t@ %(@ @ %(0B @ <8!$L&0#t$(b  $c$$$'<'P!'؏L\ $% &$\RܬP܏T &$$@% '(<'!'Џ<',($ $\L &\@ $؏$"؏T &< (%,($'0<'D!'<<840,$(%%$' %\L &`0\$ ` %@%&D&R2!@0% `(% \P\2 U\BAT'9cT &< (%<840,($'@ߢ@<'!\'0Bܯb0B40,($@,@%<%$' %\L &d@0% (%'9cs %T &d< (%40,($'8<'@!'؏0'0$4'9i$'(<'!$ @ # @ %<'!'؏8%$0%''@%$'(<'p!'ȯ,D0($4%'$L0%`(%? %A@% BQ40,($'8<'!@'د $%%"+@  $ '("! !&1 ꏼ<'T!'< ̯į%䯾௷ܯدԯЯ%%$ '42"@ &`2"@2" % 2"@527 %0%(%%$ \$ `$ >$烜$($$ &(N" L%D%@$c\$$B0B,N!B\!@IH(M]>(M=8(B;@%$cch!@(N*27r%21 o<b+@C!D< '8@ '@e % 8:- @%e %X @ 8 @ < $K%$cJ<$B0B,B@%D%$cc!B@$c$4< (%䏾܏؏Џ̏ȏď%'88%$%$H$cc!BH$$c$c$% <$<$0%$ $ $$$l7$ƃ D $ $돼 @ 8o $<@%@ @ 8 $ e % '9k@ %v %&U` %$Bj@%,  @ % r` %@ r` % '9k@ %r @%!%W@, ` %@%@ &^+@B& 0U!(  %@菼 r` % ` %rd@% '9k@k % <$ &D  @ C#;. $$BD(e!`<'!$z @ # @ %<'d!$y @ # @ %<'(!$: @ # @ %<'!$< @ # @ %<'!'$$ PTs$%2Dd%04H,(`<D $C40,($ $'84c+`%D $ 0%`% M %(%0%8%@%2H%'௨$r ' @ %@ #$4 02:$P 40,($  '8<'4!%P@#$8!g(!h $($(#$ @ # @ %<' !'<4c+40,($`0D $ C$40,($'8%%%`% 'HH` %@(% 0%8%'௨$G ' @ %@ # ܏4@%<' !'Џ8%, 0%(% $0 ,@ % '0<' !$; @ # @ %<' L!$= @ %@ # <' !'؏ %$ % %(%$  @ #$  '(@ %$ $z @##%<' h!'$/$ %%b$/  %C`  P#*C`$.dBCD $C%$  %'(&*B@D $N$ $  %&F(% &$ 䏿$<' X!'@\<8D4b%,' %@<'$ @%< $BH %@0% "(%(%< @%,bbD $@<8%4'H<' x!'Џ(\,'$w@  @ %$, $('0<'!$ @ # @ %<'!0%C(%$ <'!'h0%\C|'<ts $D@$cȯ<$ @ @% %|Bb) @%# %  @ %$A$ 'J % %@ @%$ ݏ;$b`%  %Տ%'<',!'ph|xtl%$(,048<@%$@ %(%$ @ %@ # @%|xtpl%h'<0%$'$@%@<849'D$$ @ %(% @ %'$0%(%  %'h %ld'菼`0%(%p $8%@(%$z  '@'9z= %0%`(%p $D $ C$ @ %ɏp0%`(% $' < $  %  %<'9z %  (% < (%D Џ<<  (%|<'!'$/$040$`8%'004$ @ %@ # $'(0%<'!'؏$ $'(<'!'؏$r$'(<'!$ @ # @ %<'\!'p XTLHD@̏\P<8%%%`G%bqv <C!b+q!`$'(,ï(8%40%0(%$C% @ %$ \XPLHD@<8%T '`<4B"!(,8%`0%@(%% $% @ %\XTPLHD@<8'`%<'!'p XTLHD@̏\P<8%%%`G%bqv <C!b+q!`$'(,ï(8%40%0(%$B% @ %$ \XPLHD@<8%T '`<4B"!(,8%`0%@(%% $% @ %\XTPLHD@<8'`%<'d!'$/$$  @ #$D$ #P$@@%%' 0@0|;bB@$|$ 0$$<'!'௼%\$@D$' @ <%(g8!,`(%%(@h!<$$e(!,`D(!0%'  $XC$<'!<'!t0%(%, %<'!8%\$ď(0%(%V %<'d!'Я(,$-%\& @( "$,($'0@%$$(8%3',C`,<d *0d4 !4d! ⏣#%<'!'د $%\$(%$$ ',C`$$ '(<'!'د$\$ @$D $XC $'<@1| @+$'(|;bB@0B$%>-3@ߏD@H!$B$ Hi!%)i%,c`ϏD$cb%$@%#@%$c,c@$,B$<'!'<8,LHD@40(%%$9%%%'$%$'($ $0+@,.#`+ $@!P (`$ 0%q` %$C,c`3$C7@,`$$LHD@<84,(@%0'P'($ `0 ` %W ~c!#$`v###B!%$%լ@$"#b!$&s&R$<'!'% $%%_%680!$0%,^$) %&$|;cc` @ %$  % '(`| &10c&#$ @D#$ '( @%`SP$,2 (%<<44ƀ ! % $ !p#$,$>&$c&,3 !&&0 !$ %, |@& D JC#$,@ |&D $X MC$&$,@&$,2 <<44,d ! % $ $,$>&%$c&1&$($&1$c$,3D @ !&B$,@D &$XCP! %?&$,@D!&6 %<' !' 8%$ '$' <'!V'د$KD'| `+$'(|;cc`0B$$B>,C3`0b!G,@$p0$0&D0F!$F%,B@9$cg%`$֬$B,F@C%@$$c,e@Db%$D $XC$%<'x!,@ $$' '௼|;bB@ ,<$B !,B@D $XC$@ $C%0?$(%$4+@<$C !,c `<$C%$|)0?C%(%$!C+@ՏD$C%|+$b%|)0?b%(%$<'!'@<(LHD840,%%:% %'%'$%$%.w 0%@%^ b+@@0%  %!r#"@&&1!$LLHD@<40,(%8'P% %%<'!',<840($ ]%%'$ ,@0%;@ %S $<840,(  %$'@"!&&1bE$,B@4`2#0% %Tߏ!B#b$Bb.B@'$@֏$"?$$(% '8 $2d$&"D#C+@)$cd#q#&b!,&c &sS 0%D (% q0!@,HF(%'0@@$C. (C`"$C$$"$B $$$L't "$$(% '4$ CD$$M@ c$$ $ B׏ plhd`\XTP'x<'٨!L$<'ِ!'H\PLD@< T84%%$?',$" @ &4T  % @%@@$CTPLHD@<8%4'X{&1폼 P&0%`(%@ %VՏ 台,<'؈!'h8\|xtpl$'l%%%%0%8% @(%', @%A($B*B@ $BD$B$$M$B$$%lp $$ $ B$3$:s s " &S$BpS %#2 $  @%&~!b!$b!C+`C!0& 0'4!%"r(C!@"T P % 0 $$(% @%@ #&R!p"T(% D" D"@P"C!& D(%! &s&ɏ`$"|xtp'<'դ!'ЏPD,@ 8%0%8$,'0<'X!'% %$$%D (%$ C$ '($$8f+`$ 0$f$$0cd<f&$0c<'Ԉ!'T\LDd`\XPH@<$%bD%$ !$#,c` (%CfE$$($E!$<$ $@%@#$bT"&2 "&$$""!R#,B@-$@0B?b!CP@b@pb@P p0b?$B!R@ %<돿d Bb(%RBC,C` W!F^1$$B$$BC$B!$CF$&E  %F$,@동&&E  %$,@#"$ $(+& &E &,Ү ,@Ϗ#"$hlps&h&E &tBB&&h&2$&X& ""!R#,B@ $ @26.B&&D,048@c',$$  %T$8%0%(%'9X %fBCC,C` $C$C%B$$BC$B!$C$"B&G$B %B# $B%&G$ %& & %ݏ @ &h$$(%  %$$(%  %"&GB0%$B%F$,@&&E  % 0%$  %$"&"8'C!2R$r#$b"  %$`\XTPLHD@'h<'!'௼  %' <'!'Џ$',($(%%  %8% %TX$Ʈ((%@%@$,(%$'0\,<'(!'$  $% 8<$`8%K(!@$$ %'(<'!'h\p(|xtHl$%D%$  $,$$s'(%D@ H 2@9d2@ɏdn$,$  %$  $P(@'&&$@$.b0F0!E!B$c$T$ 'T(͎s$('dh8$@0%'X^ $@%@6(d@%l$`'d$ $' % (8@(%pg$` %@(%(@dTt8'd$ƴ(d@2'd  %W+@($l9 $N$ (% '('$ $P ` %(@'d4 $BPL'<40%b$@-(4 $#@($ C@4b@$ D$s$B,B@֏x`%`0%$߀D$| `$B,B@$0#(@'$`(% 'd(|\ %|(@'d$`0% (%# %@(2@$'$ D$B$c0C@%,c `"C$"$0BCꏙ'e@ %@叼($%C$E ` %q(C$"0BTD  (%(H@l%@i%(@%2(@d'$ `&1$B0"%,B @Rh$'d'X]9$ 2(@C@%'d$ 'T$ @0%$a` %@4($# ` %@(V@`%b@U $q$B,B@ %$8`$ (%  %Pڏ(T׏$$0 @Ϗ(30#(!@$ `(% 'd(|\(@ %(d@'d  %C+@(TH  (%(%x4<`;0%@ ('$b<(%$ ' (L< $ (<@ $@(B'$ b@C$B,B@&s|xtp'<'!8%@%H%'௨$K ' @ # @ %<'Ũ!'Џ\'$(\$,$&@%&,('0<'H!'<d$BD@84LH%%@$$ '$% %$B@ $LHD@<84'P#`2&b+@$"$T  %@$X  %@,$48%`(% '(A $B ,B@$ ԏL0%$5!3<(@*$b$BT P%$BX$<'à!'Џ\'$(\$ ,$&0@%&0,('0<'@!'`\hd\XLH lTP0D$%%8<@46%T&Rp@%$T@c 8% 0%$X@% % DYl 0%`$$ S#^+@.',$T @ % #&@),402 b!"&4'ņX@ % T ,BH8%0%$'4(C` (C`$C$"@ $'ņX @ %@ӏ $$ (%  %  % E@%쏼 %$ hd`\XTPLH'p<'!8%@%H%'௨$L ' @ # @ %H%'௨$M ' @#<'H!'&D$Ɔm$,&D('0<'!'(̏\į8ԯЯȯ%$% %$  D 8$|Cv%d$Ɔد %m(%U+@f8D 8$$ $`  %8  d       'H@M:20! R JB*"(! !SP!1H!@!l!($ 8!$Ɔ$dmp@ %8@%$B%$%D$:@A*"@'&bC!0#$:0#3(!&dCC$E(! D !8 @ %U+@8T@(%  %8b0ԏ 20!B*"(! !@!l!0,($ 8!$Ɔ$dm&@ %8^ %D  %"*`8 %&&@%%Џ̏ȏď%'<'!'$0(<84,%6%%$ $ $ 0$ .,$ p0$c(!i$0!$, ` $%<840,('@f(%(B0!(!8B,B$B$cL!(%%$ D $|C$$:Cb%$$%$:$ $$ g(%I2"@$B(]!@@s&( %`%&1(%% !$, `4 $,$)$cj(!2$ @$( ! ! $C%$"%8'`%(B$c$.*#` $C&1@$c(}!$`&&(@0#$B'Q#!@(%0@ !$(%%q#C * $B$&12#@$c(}!`$C$'&E@%d$B2FD$c`T&F (%'9,$N*!&1 %`%%E$<'<!0%8%@%H%'௨$N ' @ # @ %<'!'h\|b%'%t(% %m%@$  $tci $(% &D$B%B$$%  %@%@Q#*@@  (%'40%  %&x]!'$0% (%$ @<$Ώ$(% &D$ ծB$B,B @& %$  ' @ %`% c`$$C$%$0BC$ @%BC$%0B %@$$%|'$ $,B$$C0B$C $``$0ce(` `` `$0c8c$ ` ` `$`$$$C$$b#<'t!'@''h4''&1 (%%08<`dX\&7%"U.$rB>l %!8%$ -(%$c}!$(Db%'&]!~@@ӐDГhd$cC&R&17ΏЏ'H$'8'@'0 @ %@8((%` %%$$R$QTt!'P'X&R4$"`@Ǐ$(c` 0cfg$`$$B!Bd,B@$$r$8%@0%%:S !&1&$$$<'!'ȯ,&0($ 40%%%$0%(%  %@ rT5!Bs0!0!D$b4&R&0,($ %'8<'<!'$ %$B,B@%' 0%(%/ %$C| @ $,B@ @,B&<'!'菖\쯵䯴௳ܯدԯЎ$( %  $h''0T$@}D C,b@~<$B b0B$ ̎b􏙀 2$dZ$Z&1D`%x@&R&R@'t %@%@ (Q0#$  (%$'0%$Y6@ %@U$0R'$ ,$# @ %@Q@, @%@:`%GD@Ï b!AD@@%$ %&1`%7@$`r$x@(%b !@ŏ$C&$$`%@ %TT@%%%%&s$0%$X@ %@|SK % {쏶菵䏴܏؏%'<'|!'ȯ,\(40"%$$ HL`$'$@8%(!@ %$#<4 T'9t@ %@T @(%%(D0 $(%$$$pC0!HpC0!@$p0 !$ 0%ݏ$$$$ $0,('8<'!'\쯰诼 0!@!'P8'('į$T*@+8'|H'į8D'h %%dt*@ 'ď@,T%dt*@H< @%vr5t$@b!F&1ď$ȏTU!؎ܯ0%($8@%@(B@t%8} %&@lq!eDD{xq!`dC$0cbt$b0B@TQ!HPHxb!B@wHBB0B@0B @y<$(% $$rc |U!'!HlQ!ChQ!H3''<$0%$8@%$$$'$$ %@<ȏH %@P< (%DP!dC@P!$o&sw&`@$B`h'Q!$rb $@!&M $Bp@D}]@0%~< $@'" %&sS@%AD C$b%< (%dD C$b@  %$< (%ď0B@(Hl!B̏8$4Џdȯ@(% d$@@B!$BB$&s&&&"0B@?$̏Џd4'ȯ(% ď(%$0%@T!*@ BCC!(C `I$Cp*`$cp*d$ 00c`;Hx! $ b$"&s&1&&Ro&D@$c+$B%|xtp'<'t!'Xį', %%%(%0% %%@ `8%@0% (% %'$<'s!'lT\(XP\"'4L$% 8%0%(% %@(pp0%@(%@ %(C `(@($C$L#\ $0cd@ ($```菙@($XTP'`<'r!'D\LH@<840,%$$%%% `$@ % @%@%!$B,B@# (%'$0%{ %&(]!$.&C&f@(%{$ !d8%0%(%s %$L $HD@<840,'P<'q`!'4\<80"$,(D L@ p',$@0%@%@ LF* 0 {@(%,"b< 'L' 'D'$$@L$84%0'@<'pd!\$Bh$ $,B$<'p,!'܏\د䯾௵ԯЯ̯ȯĎ%$\$`$%Xh$''(G$@%@D C,b@<$B b0B@$+$$  %@,0B@)$ $U %SQ'0%$K %@揼|F % x0%$p7 %$T%䏙 $  %@T@%@O$4  %@C$c,c `$S$ '$x` %$s,D$d \$<  %@C $c,c `$S $ '$x` %$s,D $ d X$H  %@D$,c `$.$Q$ '$x %$q,D=$<d `$ 'ʼnT  %@'@%.@"*@{'@%%@%$d@%@$rx`0%P !@b`&$$cZ$$`  %@@%@N'@%$@  %C+`A$F (%zx %:$$h  %@1&1T$B,%&&Rd܏؏ԏЏ̏ȏď'<'kp!'؏$.$'(<'k8!'Џ̯, 8%0%(% $ ,@ % '0<'j!'Џ8%, 0%(% $S ,@ % '0<'j!'Џ̏D,@ 8%0%(% $T ,@ % '0%H%'௨$U ' @#<'i!',T<X&180D@4( %%$CC4@(A` %(?`;8?$#$8%1P0 $,c`1. <$ꏿD@<84,(@%0 'H% ! + ! $C!b+:B$$e!0 ` </4B!$$' 4` % %@ %<'hp!0%8%@%H%'௨$V ' @ # @ %<'h!'؏<@'$˲$s@$$'(<'g!'8%@% %%%H%'௨$W ' @ %@ #$$<$c$`<4` %($@0%8%@%H%'௨$W  ' @  #  % '@@ %~`2$$$| 2$$$| ꏳ $| <'f!'@%($ 40,%%%%H%'௨$X ' @ %@ #% @%ABD C$d$xd:4<$c$`54<4` %($@0% 8%@%H%'௨$X ' @ %@ #% @%@~@ T$&R$@%$@%$2 4T$&$%$%$4,($ %0'8@ %<'d!'','4\\\$Bh< '004$l$p<,'@<'dd!'Џ\\'$' , $w$,$'0<'d!'Џ<',($% $0%'\S&$A %< (%,(%$'0\$1&@&<'ch!'`< 4\|x8B%'D$t%% $`K$|@q @%40%(%@%] %@%@% @`BC폧4F %@0 <D (% %8tBb! E}` %@ӏ 珙F %@ <D (% D Q."@􏙇<<$B"0B@D.d$PTX\`dhlpr`$H'r$ F$$c0@%,c ` 'H$'P@%@ D Q <D (% D`(%T@FE % X@ \F= % D(%< $ @'r+` F. % D(%< $  B!'L,0<d0b*@$4BR+@=8%0 @(%@2 D Q' <8%$M$@ Fk %@ H@,L|"L,L'b+` 'b+`,B!b!,0$Bů0$ E % 4R$8%$Mr@(%@ҏ d$E+@d<@+@0 (@ d$Bd@5\Xb!C!%D,E(! D!@dCjX`! D]\D!B@Z`bU$$c(E!֬D଀{` %@ Cx %|'<']p!'< TPLHD%@%$'<,048l% % '8'4('0@ %', 0%](%@%b@ 80$c$B b!hC+``$"b@ #0B!8$B0 0!,v %," C#!"" %C#!"4# D!d!B@$` 4  , << (%@ D RTPLD@@%H'X,E#!٬b<'[!'؏T8$8%'9%@0%z(%$'(<'[H!'؏T8$8%'9%@0%(%g %$'(<'Z!'௰\D' <'Z!'8\ <௠04@  $`Iv$| @','4\\\$c؏'0$$?@ %,<8'@<'Z!'','4\\\$Bد('0< (%04$$ %<,'@<'Y!'','4\\\$Bد('0< 04$$t(%<,'@<'Y$!'<@<840,$ D(%%$'X\`% %$ 0%(%P %AD %@%@D P $ < (%ND IP#b!$:@$dz/$@ӏ$D@$:z'd@ˏ$R@%D$,c `;p^bC$:b$,B&P+@%C`1 $< $@C` (%P$,$@$C!@<b  (%%D@<840,($% 'H&Rd!$Bd$c$BF&C!%E(%&<'V|!'` |x%%%HLPT%e$ 'H$ '\(%$@%@Ï `@,%<d $@%@ d($8%$K@ %@ C %@ D $ C$Co %S H@ % %d*@Ca % $`H$|@%@p D B$C $C&$b$|"b$c  %d*`<p%tT!E?8<,0'P4 %@%@] D@ d%D*`E*$U   %  L  P|x`%'DV&$B`%yk % @&tT!B@8&R*@8p&sb'X,'L0'h4'D8'T$<#!cv&R(*c&s$B%$D $ VT<'R!'p\|xtplh$B<%%$',d%%  $`Ge$@n@%8%0%`(%@% %@%@#@BWB %@0<, (%%$dBbޏ Ex %@׏珙Bo %@ <, (%D Q."@􏙇<<$B"0B@,'4$$(%w%@ %.X\`&b%'b$ D$$c0@%,c ` '0 %0$$@0%@%@D Q<, (% D(%8@<B %@ @B %,(%< $L󏙄PTG%f%e%<d%5h+` A %,(%< $ G!F!E!D!R+@$0 @(%@ D QA %$8%$Io@(%@B9 %@菼<@0!L !P!DHb!efdcbgh c`TC!B@Ʈx %@|xtph %l'<'M!'<D@<84%0%$',$(\% %'(@ %,'$0%(%@%b@ X(b+@`$"b@($r %$b##!b##!b##!b##!b#"! $,< (%@D RD@<40@%8'H<'Ll!'؏T8$8%'940%(%$'(<'L$!'؏T8$8%'940%(% %$'(<'K!'௰\A' <'K!'Я(\,@ $`E$@ \\\'$$$$3@ %$,('0<'K!''$\\\,$B䯿,(%$$ %,$'0<'J!''$\\\,$B䯿,$$(%,$'0<'JL!'<840,($<%%$'P% %$ `0%(%M= %A"@` %@%@D P $ < (%Z@<840,(%$'@#b!$:@$vy$@Ώ$D@$:vq@Ə$C@%e$, -pU d$:$b`%E$, $pu  D$:$D@$:vO@$D@$:vG@@<$B (%P%$c!$B$B!$cЏD P%<'G!'D840,< %Q@%\b0@f0T $b0f0 \0'$$$ @ %B $<840,%'@<'G0!?$:BC$ C$ %$c,f pG0$!$$<'F!' %u$: @$' $D@$:u @T@$B '9;'  $:H$B  I($B  H $B  I($B  H $B  Ch$B  B8B +#<'E\!'\ 诳 % v%D @%@%B$.b$/u\ %@&db+@ $"  d'8%$Ɖ$Q %,B@$H<  % $@%@L'0$(%s@ %$D@(%7 %@<', $@  %,< (%ǎH40BC폙< $`;O %@%@䏼T'0(@ %@0% $;!%$@0%@ %@;v %@6$B !q:1 +$C$C $`C$@%@ӏ$C$C%0%(%v %@%@ޏ$$:BDقc$ b  %@ H $%dH $$"$"쏰'%%<'A!'`X$%|$tpld\ $x %h%%v䏵$B(' ,$  %<@DHLPT0u4$B8D',H D<$c$cU %@ꏼ@= % |" $|"$(|"($@c$b|$ˮB`%3!"C$B|#C<'>!'4<($%8 %40, A%B %GFC$A8G %$<840,($ '@B @< (%C$ @%8Gm %Ï0 &ʼnC %@%@&sB C!G0%揙<%&&<'=P!'%4(C % CCC $诣CGChF4'8<'<!'%HTF %$ƟG$矬C$e$ `%%E $$ h%(%H$  $p%@%I$ *$x%H%J$ K$%P%K$y%X%B $_%%8@<40,($ DC$T'X$ $$b%G%p0bH@I!0!b+F!,0B<';!'@D$` %b% AgDf@<?b%` % (%' <':!Hߏ@<':!(%@n$<':p!'@D$BC%' <':0!L도@<':!'@D$C%' <'9!P도@<'9!\$D@<'9!\<XQ4c-<L$-pE80$F!+b!B<A$BNmpb$c09¬C&<,$Vd$C&<d$C&C&B<'8!\\\c"d%\B8$Bd%C<'8!\E\G$8$$ \<XQ%\<L$-`85-%eH* 4$pFXP%dH+J!"!HH!$c"<'7!'؏L \$%} &$4T'9J  %$&$4T }s'(<'7!',,($ @8\L%&d4%|%T%I%@%. @$.@@$.@$.$$?P \T&1C\ %'9J Q%rT};&d4,($@% '0%$%<'6d!'؏L \$%|&D4T'9IL@%&\TC\$D\|d:0cD\&D4}C8$  %'(<'5!'؏L \$|&$4\F\C<A$BNmpr&09~pT|&$4$ %'(\\E8 H !(!$c!%$B%B8<'4!'؏ \@$%$l&$<(%@l$$&"< '(<'4d!'؏T$3$$'$'(! @#<'3!'X'-@ %L| T$N%$@%@T % -@ %  %'$~%|;`(%܏l$@PC| `@$C %|K$ԏX<'2!'@%($%\,8<'8(%$@%$$B$B#'%$f 8!\`  H8!$$B%,($'0<'1!'@%($%\,8<'8`(%$@8%$$B$B#'`%$0H0!$c0*$B`PF %,($'0<'1!'@%($%\,8<'8(%$@%$$B$B#'%$f 8!d̬`  H8!$$B%,($'0<'0!D`F<'/!$ @ # @ %<'/!'P\d`LH@\XTD%% ($$t< D @%@%$bB@$/o@ %@ `$(@ %<a &4$r@@ %@%,B@$Nb$$r4 %$B,,&"0C!$B % 4$:#  %P#@%,+@'"@)&040%(%j %! +$/0 !C@(%j !$(`p %b$ C$C$C4$"@&04$ %d`\XTPLHD@'h<'-4!DhXF<'-!'$D\H@<L%C%%4$ 0%`8%'௨$ ' @ %@ #$l4BbL HD@< 'P(%'  % %`0%` (%D D$$ C4BbߏLHD@<$'P<'+!'@p`%|@$'+ %PV| 'tx $| $X ${\L&T&(D@%y&0 $ t|;$q4D @%W4@% $EB@̬@@ .  %\T&1T&6("D0%z&16{X %|  %x  %+N %`%{.W%'&1! @#8% %! @#8% %(%! @#'% %(%0%! @#'<'(!'@'T$(%PHD<840L%l %@ '$+@ %&B$$B0B@^&7- (%@X0%(%%+ %$%B0B@gTB0B@ TF(%'9Y$ٯ @aB0B@T&1YP %}$Ϗ@(%T$Yt%$ί @O %p$@(%%u$ @EUT$$`(%'9Y$|B0B@&Ep0% $B`B  D Bg#-6 (%@&",B@ 0%(%%+ %^$$ %0%%+(%%'9YP($⯢ A #@ T' &Y$ 0%`(%%8$@D $@@%B@TT&Yt&T" S `(%% $ɯ @ۏ%$ "$B,C` !B\!@% %$1 ᏙT$%eT$ 7  '9Y0%$ߏA  $(%$|$ G8$$(%&Y$|&'4 &%&Y$@%@ & ϏT@(%'9Y$߯ @(%&%$%я% $%I&<'#!'鸏<8\@<40,(D%%%%$' $X \ď'$P(%k % '($$ %hF̏'@@0%p(% $Lw'8<D  %@T`%xFD Bp0%@(% $ < (%$5 T8%$A'$ $Z <@ @%`%xP8$ '$C @ 8@͏ ̏pʮ0L$0%'$~ %#쯢D@<840,('H<'!|!'؏$ % %n %  $D@@%$T$ @(%l&"@P0%$ '($ <' ! 'د $%$ %@$CQ `Cb@%$ '($ $ <' D!%@ 'د $%$% %@$CRQ `Cb@%$ '($ $ <'! 'د $%$ %@$CQ `Cb@%$ '($ $ <' !/'Я,($ % %%%mn%  $D@%@$@T @(%l<&"@P0%,($ '0$ $ <'D!'د$ d%$ %'(  %%%%%<'!'%$$f@ %%' <'x!'%$$f@ %%' <'8!'$Pj0(%%' $Y$Y$Y$Y,@%$%<'!'$f$%' <'|!'$f$%' <'D!'h\|x'$%%%(%t$P` %  %h4`8%@0% (%t 동|x'<'X!'D\TP<8LH@4'<$(%%,i@ %$$48 $ '8'0%(%)$'P0%(%)$@ %$)M'8@(%`0%*$')@ %W$);@ %P$b$)3@ %'܏5 %`(%_ %@(%L %$ < %08%$B($B,D0%$B' '(4d@% % D'$$L 0%_(%A@% BP0%(%($0%(%($0%`(%*A$ D Q$,T $PLHD@<84'X<'l!$ @ %@ # <'8!L(%0%$<'!'Џ̯, 8%0%(%u$ ,@ % '0<'!'Џ8%, 0%(%u$ ,@ % '0<'p!' % %  ' ' <'!'$^`\XPlhd\TLH%DC%$!C$$%b$]C$-B&s:1Dbl $$Cb$],', '0$-$[$cwubWWt$$ &e@c,0d(*d#D(#e(+ #d+`$Bb!&~=e$0,@9<$Bo0B@4&p$]e,b)$:&e&e#*b@㏙'4`0%@ %dʯ'&b8C! `쏼@(%  @ %@ @(%   %@&&` t,`%,RT&:1 $Ǫ`(%@$Bb!z%hd`\XTPH %L'p<'@!'Я$,(%@$%,($'0$\F@%0$$$A쏿,t0%(%m'Ai$$[F\$[$^C$!C$$$[$!F$]$]$c$ [4 e+@A!F !$[$c$$bE8+.!G+)$0B,F%J0B@"$bE0+0!0!$b0!@%$ ]e+@$[,$c$@K$c$c!B@$c$[$*C $?C %Q!xv$t$<'!'د $%%$ '(A$t0%(%'A$$쏢适<'D!'x0BTLHDd`\XP@%%%@%$.C'8T$$Bnp$x(%  %@%^WT'<`(%'9p@ %@%@+b'8$d`\XTPLHD%@'h&1&j %"! % %%$$+@x`(%j@ %P+`ݏB!(@%S+@T`%$Bp௢$T%$Bk@0T4x(#  %@%8$!,'< @0%( % V(#@%@T$Bk@0T$Bk47+@x@%0B %,x(#  %@%8!($ $t(#  %@@%,@0%0  %@0%$$4(%  %@ <(!x0B@<$$8V!v#"![#r$8T'9k@ %@0%$ T(%'9k %@a$珢80%$8V!T$(#  %VUJ&8&%8]!b@&sd&|;bB@b$B,B@@&sSV&.$WT<°!x0B@0%0  %@0%$ $4(%$Ykk %@$J,F,D$< $r(# @ %@ <&T $t(#  %A&T!E%(<' $!'<0840TPLHD@%%`A%TT$Bnp$/$&ql %@^',% &! $@8%$  %@@%^,V@2B@T8# 0%(#%z %@T,%TPLHD@840`%<'X&!0@TT$ 0%$'9qlZ %@%Uq8#&sb@T 0%$%J %@%%$/&ql%<' @!'௼  %' <' !f<' !'诼  쏾 %%%%3`,B $/@8.&s@%&B,Ed !8%0%(%%$ *$ ?$]$ [$ \($ /kklb!3@` $Bb!c$]d)`[b!cm !U$B&Rb!!0%$$!$d,Nb !!$d$B%b !i j h`6E!%!,@b@e3@C8$ 'H* %@- 'H*F %@9 %T &D@%@@ (&SB`0%(%Q&$a[  (@ $/,BC2!30!C(Q(%$8%$B`2:@.'H*s %@ :ˏ'HD E$ %$  %@>$$ %'$/e` %@%@ 3@@$/b +D$B$B#0B@$/&$\@0 $t䏙X (@ D ČE%$\ %3@ @%BC@3<,B0cb% 4$R#8T$Bx䯢DP( @%@ ,@"$C$ CrP&f %@% $R#"+@ZP( @%@珼 e\ (c$@Z&f %@% 揢8&f %@%8"+@ŏ 4(%` %@ 3<@$.b@<C$<.C ,44F(%` %@ ,&&`t(%0Q(!8%(D$  %@%@ \ (< Ƣ,&&`X(% Q(!$矬( @%@ 0  %3b%`@$<'!'p\|th xpl%d'`,<0%%`@%2b T&xh@0@/%Te %@%@Ǐ 2bP@̣dC$~b&B4$/d@ %W @%@$TB@j'@į$'d'D&D @r $ C @ % $`%@<@02b@, %f< $DT @%@%@ <&DR&@_(% <$0@&$0$(!(! (@m "!` <%%<(!$<$B$cB<Q!Q!2s@R!`VT`$x$@(%\D !L q% $h@ B@ '@0$'d'D@ %@@X(%'d$C`8!$$BB@$X'C!W$$XC!@T'<8%0%'d'9x䯢o @ % @%$m T @ % T'9xpA, $db @%(%BW&RT !  @%Q{ d!$B`$|tplh%x'<'!'د $%%"+@  $ '("! !&1 $鏼 $B b!B $B b!BcBb#8%$ AC$phP0B@I!f$f<'h!'0<84,($ %%%$"@& w$tP"b!P@!@<("P"bb!B@!b "#++C%#C%cC%#` 4B#`N% d(!@$BT $@$ <840,($ '@& "C"R!CR!`&R@# `(%c`-% U!@T&R  @Ю" @#%b@;`%b!^%&s w&1 خ&Rb!BAԎc&b!BAώE$c$  !!׎b@!$e@( !$B$d !(%8%"$c !D$DbA&1 "A%%<' !'40,($ <8%%%$$$S*$T U%<840,($ '@Ȏ@8% 0%'9(%@폼 8%0%'9HEDﯲ@鏼ݏ<ώȌED 8%'9H0%@ˏ<<'!'%  % ' <'!'د $ %b *%C!E $B %$ '(C *0$ D!q*b  (@Ȯ@(%'90 %%<'!'90<'!'0,($D@<84 X%%%&% %@0%$$$Bȯ$D@<840,($ %'Hw5" b*@폹  %CvC,e`6U^ $C`bC%b@ @%%e $BB!d$C$BѮ$c$BBE`%@0%E@%%~@@0% %BE<'!'90:<'d!'Я$,( E*@%4*@@%,($'00  (@$C"!$$0%j(%"<'!'$ $($,%%0%W(%@, $PQCC ,($'0%<'(!'ȏ$40,($ %%(%0%%$2%@0%$ %'9@%@ H |9Į #C40,($ '8<'h!'ȏ$40,($ %%(%0%%$%@0%(% %'9@%@440,($ '8<'!'$0̯,($4 %%8%0%(%%%@ $ 40,($ '8@%$`0%$'9H@ %@$ 8%0%(%%@ %@#C#C$bb @@@@$"0%<'!'$0̯,($4 %%8%0%(%%%@ $ 40,($ '8@%$`0%$'9Ha@ %@$ 8%0%(%%n@ %@#C#C$bb @@@@$"0%<'\!'`\X|xtplhd %%P+%)$$0%CDT$  8@$SDT$  4@8 $ |xtplhd`\%X'$4TSD$  DD`]%$D!$BdCb+`D(%$B %@%ί(% %$$B0@%P@%8ȯ0$B$$$BpT%, @" Pb*@4 0%@(%'9'` %B$D$C&TB$V!$^B$V!C,$B, B0B(,8 B, 4 D| 84̏$  %(,B@(Tb!B\!@$ ` %%$$c@$Bc!$b%4!D$c$C %@$YC `?@%(` %$$B(@b!$$D %$CJl( %$B4 (!$ peCp!@`T $@^Cp!b4da$c$C   %@%@]$  %@%@V$C,C`@QbA$C5(b@2(D$ȏ0%'9.(%@%B C!0CC$%e$d.$BtC$b!~C$$b!$C,$B,0%@(%'9P` %$b %$B & 4(f$ey$Bd4b!$CD$B%(b$.@яȏt$ (%'@%@i 0B@N&H @D  @%`(%@0%% %  @%  @%@0%`(%% %@0%.$B0$ D֏(D/ $B0B,B@t`t"$ $?Dt$$^D(D_"${$\D\ %$B|@(%F'+$B !E($B %'9{&1 <840,($ '@D$|Dt`V$ȏ<840,( &%$'9'@$&K&2(C@$$<I(=@$>$$+u`$,B @Ȏ$Ў$ 0%'9H$q *$ 0$$?]M@%$x*(y@${$b$$@Ȏ'9H$&Q@u %D$|`Ȏ$$'9H$$$$$$ #${b)&2&2$0%%<C!E$,H 4 $E,$B1$cd0!*@C!$C!C$}bm&R$'9H(%&R$`@%Y$ $0&sH$ `%(%@%<$4`%$ @0%@@Ȏ'9<@(%&1<4(%`%&1`$Q$Ȏ$'9H` $"@$$\Ct"$)C$|C$ @%[(%@ҏȎ'9<(%2!$cV$ $<'̌!'د$ b%"+@&  :@P   $ $  % '(@ !@ R!D &1$ &1 "@ r2D ! &1"+@ %$ $ '(<'!'(T دԯЯ̯ȯį$ %@ T@% $ @  %$ ԏЏ̏ȏď%'$<4BЮ$ (% { %(@ '9= %'$$(%@ %UQ,( ௷$ȯ$B0(% %@%0@%@ 0U%$B<$%%T("$\C-Ȃ"$(Cn$)(%&֋%O %@%@r @(%%H %@%@k 0`(%  %@%@d S&1&s&%%$(C$)CJȏȏ,'9b (%@%@L '¥4"$\CO$*C_$+C$?C${CY"${C&0$"$B,B @ %'9|' @%$,bf$$B,B @&'9|' @ %*@X(Y-$ &1Cȏȏ$$'9H$@ $  ⏤( '9 %׏ $+"C $?&1$B"$^#bC${C4 @(%@% O0$|$)TQT(% @0%@%$\M #$|bN&1h$B %@$ -@$ $\b$$}b$ȏ'9`0% $+C$8B?$@%b8 $$$$'9H}$ @E%$\$)"C$|CT$|&1&1v$ %$B@%񳯢H@% @&ȏ$$'9HO$@(%@` 4 0%@Z @%C $Bc$؏د&sSb*`ԏ<$D $@%@ @'®<a0B@T8%&1T0%(% % %@%@, (DT$  @%@叼 ($ 0$S@ % (< @$ $ @Ӯ$< $ @͏ (8%0% %(%@%@  ( '9 % $)}{&1v'95 %3@%@% V %%% |Xȯ$B(% %@%򰯢,@%@Տ 0(%  %@%@Ώ ȯD$Bȯl'p'|8t  %l L@%L@ L$bH Xb*@H6%"$Cx,C`@1"A$C"|C!b*`"䯢$C1, %@%@ 0(%  %@%@ %,  %@%@ 0(%  %@%@ŏ Db8!*C8 s$(0%'9HT(%@0%@* (4 (%4@# 4,8  %@%@X 0(%  %@%@Q ȏ$Bȏȯ<& 8b*@HT  @%@X  ( '9 % |0 2@%@ , (%  %@%@ 0$  %@%@ E,  %@%@ 0(%  %@%@ B(B@B(B@8|8$BO8 2P|B(B@ B(B@58P@'\'`'|dȯ<$B%hS<S*@/l0B$_b$ +TB0B@0l$_b0$ +T0 ` %@%l$_$ݏۏB0B@o ` %@%l $_g0$0B@y0`u408$ $L8%0% (%@%@`$  %(@ @ % @@ %Q@($L8%0% (%@߮48DBB l%(C*`  C`0%bA +%!$Bed!e!8$cD!8C4$B4%,"@,Al@ŏXlB@Q0B0B@Nl0(`X8$0$'8% (X!<$ED#@0%P D !@ԏ0 c @!b@$b<&Btb!TT!$@(%W!7l@%@@$$W!0<0B@40@4@z4B@v4!$c4Tl`t<T$!@@%@$$  %(@Y @Z 󏙉$<W!Bb+@#BS+@B@ 0C0@B0B4`00C$ P`+0C$ c @`0C`0Cl`&s'0C&R `(0B @>B0C@`H0B@Xl$_buP$ +U叼IB`0Cl`$ H`0C`0B $_b֏ ` %@ҏl$_ @ʏ̎BdƏ@`0Cf&R @$_bl ` %@l$_ @S&R @l0B$_b$ +UB0B@lB0B@4B0B@z08Dd0 `(%@q.&R  ` %@%l$_$ۏُB0B@ ` %@%l $_$0B@kώBg|80B@ E ` %@[B0B@80B@  ` %E  @ %@ ` %E  @ %@&R 5<$ $L8%0% (%@%@7Q@($L8%0% (%@)5<BB l%(C*` C`%&R !$Bed!e!$cTbA%"@Yl"B0B@ " b!@"4<"0"l%(C*`1$ !!$Bd, (   4(@U@%$   %E<4B+@>$%%<4B+@$rd&&<b ! @p!$ !0@WS!0B@$b#"!2"@4!$#b!(T!0B@$b#! P!0B@$b#! %$4*`(%$4C*` t$'lHl@%@@$0 $폿p(!b!$p"!P!e$B!$B۬d8S!D04$$,%$BL$B(T,AB@&R ltD$ 'l!@@%@$$DS!D,@)(8@'4(4B쏣 b!BT*@B@0C`50C$ P`00C$ Ώ@`0C`0Cl`+p0C`20B $_  %@l$_ @B`񏙂0B @!B0C@`+0B@\:lB`0Cl`$ H`0Cd@`0CB@$_l  %@l$_ @ՏBBl0B$_v$ +WpB0B@"li$_1$ +W^B  %@%l$_S$ݏۏB0B@B"%U*`C`)# b6%/U*0B@9B  %@%l$_$*# d!$d$BU *$!T$cbAՎ#$ !!$BdU*`$,8B쏣 b!TBb!&#C&14Ql 0ȏ,8'9А8%%(H!(!)%8!!B*@ $AU8*hb$ce$4$`(84((4<7,%A0$ꏿlhd\XTPLH%` 'p,<4B@0%  %<4 #8* @0%('@ +?<;<<4B&B?7$Dï@$4'0̯'8$=8<08%`0%O4@(%@ %$Ï <6 %8<'88%`0%@(%O $.% @ %lhd`\XTPLH'p!,<+! %4B@0% ~!<!P+^! @`%$pC%$$c <'|!0%$('9$<'|!0%$'9$<'|!(%0%'9$<'|l!'0%,'$  @ # ,'0@@ %ì ì ì$<'{!$ @ # @ %<'{!'௼ #' D $C$' <'{<!<'{$!'쯼4($D@<80,E%@%"L@%d  %@%D5 6HW@%&8%0%$\@w6H@5D@<840,($l <'H$TD@<840,($'H<'y!'X'%@ %|;d(%$ @ %@ #  %7@%%'<'yP!'<@<D% (!!(+f+(!j!%`D< %@$ 'H0(,4'('$  @  # % D@<'H@@ %î î î$<'x,!\$=~$T<'x !'XT\P%P%,c`,%$\B$T$(! %`Pc`\d` $4<@8$'40%$$c $d|B@$C&$=:' ' 0%'4@ %$$b @ #  %\XTP'`(% @%@8"4$"'<=&$菼<'v`!'$,c<840,`$,c`$D $$C<840%,'@ ď<40,`%8n'@'@ %%3%LL(% 0%`%^$TL@%4@ %Տ<<'uT!$,C`$, B'D $C$'  !$CC%%<'t!'௼0f, 0cD $ C$' 0c`D $$n @ # ' @ %%$!H!c)@!i$$BG%<'s!$,b@$, B'D $C$'  !$b'b$% %<4B$$ %<'s4!'X'% % (%g %@ 0%(%$'$<'r!'P%' $' %0%'<'rT!'H'%@0%(%% <4cC$@(% %0%'<b%$`$$%$,@B !0B%<'qd!' <'q@!'$<84%%(%?-'<('' %@$<84'@%$!H!c)@!i%$BG%<'p!'X'0%%(% % (% % %'<'p!$$d @ # @ %<'o!'p`@%@D P$%' <'o|!'ȏ(\40,$ B'%%(% %%>$${'` %{ % (%0%$f @ %@ # ` %@%Bb 40,($% '8<'nL!'X'% % (%- %@ 0%(%$'$$$#<'m!'8'D<4@% %%(% %A $D@<84'H$B'`0%(% %@' (%$K@珼(%'@$'U`0%' %@ҏ' (%$͏'$l %(%0%$$$c %'(%<'lH!'Џ(%, $g8%J$ ,@ % '0<'k!''8 0̯`,<'@\XP tplhdT%%%46.<$$V!b+q!`# D4Ï,$E@LH`0% @(%@ %^ $揿tplhd`\XTP 'x4!8<$0,$e`0% @(%@ %$ď ᏿t<'j!'P\"%0%'@ %# $'<'j!0%<'i! %(%<'i!'؏8$CB %(%0%$'(<'i|!$ @ # @ %8% %(%! @#<'i!'0%L\PHD@<TȎ&p%%4(%%$@%$b4bT LD@<` %%HP 'X$ (%%$|@鏼l (%'  %@0% (%%$% @ %4܏TPLHD@<'X<'g!'䏒\쯳诱௰܎H$ @ %@ #ԎBb 􏙀 $ ԎBb$ꏵ쏳菲䏱܏ ''%0%%s%@V040cd<*$ @%ԎBb֏쏳菲䏱%' %(%$$  @#$""$@@%l'@(%  %(%= %@%@ 040cd$% @% %$  %$(%`0%$ @ #@ %$<'e!0% $ $ $8% %(%! @#<'e8!'P\'h%%0%%%$@%'௨$ ;' @9#$$c$  %C`@(%0%&sH (%`%$w@%$$ (%`%$|@ %@(%0%$$ @%@@%#$bl'h (%  %0%(%$u`%@%@@%(,8x0|<쯢@H询\؏`ȏܯd̯L$Џ lXT$(% %;P$<R0$4Q$D$$$2d$%#2S%C%+<(He($E%88L0$P< 0%d$, (@#%TLXX$,<@DHTPd`\lh`tx|d$ \Bb| $nlqh|Hx 4$̯(8DX$0(%< %@;4H $4(< 8D$X@,0H8<P(DLTX@l|ïïd`htx#$/D %$c0%@(%$v'9H`@(%$u %@(%0%`8%$ @%@# % '<'_!0%8%h(%<'_!'<@ <$BB@+`$pg8$+@ pg,(4'C8%< $ꏿ<'@<'^!0%$(%$<'^! 0%$(%X$<'^!$ @ # @ %<'^X!$ @ # @ %<'^!8%0%4<']!'؏%%$4$'(<']!0%$ @ # @ %<']|!$ @ # @ %<']<! 0%8%(%$<']!'؏% $%$` %:#(% %$`0%$  @ #$  '(@ %<'\!'؏% $%$` %:(% %$`0%$  @ #$  '(@ %<'\!'ȯx|%'9%'@,$`(%9 % b (,0 H48 @L(0P<<\$@DX,D4%|x'$<'[!'ȯx|%'9& '@,$`(%9 % b (,0 H48 @L(0P<<\$@DX,D4%|x'$<'Z0!$ @ # @ %<'Y!'dXHlh`\TPL%%0%8%$ @%@$#$fo` %<? 4c<%$c!,c`%% $'<$c0!,!,c`%%,c`<q!3+&! %%0%<C!r+~!`% 0%<q!3+&! ï0ï(,48<D@'(8%$< @%@$#$f` %lhd`\TPLH%X 'p<C!r+~!q%`$<; 4@+*%$(0+,%'(040%$ @%@#$fo$` % %(%$ @ #<$Bb!,c`$$% lhd`\XTPLH'p@%@ %  '% %(%0%! @#'<'VH!'Џ($, %%9$8@ D $C%,($ '0T $@%@$(%8U@ %$+9@ %@C$8cr$ $e9@ %@ $$ (%'9,,$|D$a$ %$| 0C@#0C`4G$ (%'9,,$|4B&,$0$P0B@ <<@'$th (%'9,,$@$ P $(  PB@$$L$] %,<'T0!'؏$+ $9.%@0:r+$x9% %@6$e9 %@<%"$rC$wC $a6$ %'($C66<'S`!'Џ%($ %, %%(%$7%<` %$ $ @ %@ # @ %@<$$$| $ &R &1( , $0L,($ %'0%' |;Lp<4c($=$L%` <@%$`!%`$ '(%$8%$ @%@#r(%8%$ q($q0%%$L0%%`|`$$$ @%@$#$e$$$ <'P!'د $@%b$$'  %$C$(i@$$ '(PD$db<'P!', <@ %$ @ # ' @ %<'O!!'د $L@%dIb0%$(%  %8#$(7  %$ '(<'O!'؏0 $Q&2 %4D%8D$ <%D'( %18<'Nx!'840,<%0%+,C#%< $`'$$1 @ %@`% #`% @@%$$ D%%<840,'@$ (+d#,C!0`@%$CB2!"<'MP! s<<'M8!'@<40,D8c#%% $f!$'< (%0%$2 @ %@ #% S@%,0C!D@<80,@%4'HA 4B $"B#$(+b#D#&1&$ !$$#Ǯ#%<'K!'Я,($ 0c@%%%`$<@<$th'$ @@ 0%$P 0% %@%(%,($ '0'௰H$bC%Hb%$0% (%0C`4B $' ,0|Bd!#H$bC%H0C`4B $,0C!%<'JT!'؏@ $%@$$$ '( '  %$C$<'I!'؏D0'0$42$'(<'I!'௰LA %$C$' d$d$@ %l' <'I(!'؏H0'0$41$'(<'H!L %%0B@+$0B@+$8B|B8B|BP'0@C#%%@C#%bC#%E!4B <'G!'د$ L@?%dC@%Lw %  % @%"%@l~ %0B@"$P v %0 4`8d88`4d4CpT8C  `  %$  %'(%<'Fp!'د $LA%|B$ '(d@0~l3 %~<'E!'د $LA%|B@$ '(d@0~@l %~@<'Ex!'ȯ40,($ G8C`#LD@%<!',(LHD@<840|;H$q%@3X`$"Xt0#'$C,Cb!C!2 $$' ''$C$CB(8%$(%  %^(@X4B P(%$% %A鏼@ $D4B  $XC$3XLHD@<840,('P$C%<'<!'د$ LA$ d'(du% %dx@%@%@l %$  %'(<';!'ȯ40,($  %%40,($ '8L%@%dB %@%&1%$$  dB0B @`l|@ %%%2@ %U&sVb&1%쏙l<':!'د$ LA%<!$D $$ C$ % '(d@' ' %<'9!'Џ@,,C` TD $C$$,'0 $B(]!$B#/@*ꏙD+`b#/@*g+`G!%<'8!'Я($ ,%T%%E(E#$ab "#Q+C  0%(%- !"!b+`C + b!@,($  %'0Ȭ'9I 0%Q+@ҏ%b0B@돿,`ꏴ( C!@<'7!'Я$%(, PT %"+`,%"#3+@B %4BB `0%-K(!S!F03#D,&+ˆ !DB  0%-9(!`%0!,($ '0%<'6!'Џ,($ %% %$+1%e@%1$8@D $C,($ %'0 $A&DD $ T @%@鏼$(%0`@ %&T$<P&,$ 0&@0%(%0O %b c$rb1$ab1@(%3 % 8cr$$ b$rD$aC$BJ $BI$$BH($BHܮ PB@,$L,($  %$x'0 <'4!'؏ $%%1C$8@D $C%$ `%'(p@ %@% %4E $$ @ %@ # @%@䏼~1 @ %$$$| @(%T %@@% %$ %'Я ,($T0%0+% +F0#% , 0%%, @(q!b!$bb&1 b @0@%B#.R@,($  %'0%$ ,d%%$ $ <'2X!'Я(,$ T%b%@%# %yd0% (%A@%B@4B @@ BȬ'9PX 0%Q+@%,($ %'0TY  D%<'1d!'௦(0,T,` D $C$$' Y  D $zD '(A@%Ï(쏣,<'0!'؏ $%%040M$8@ D $C$ %'(T $@%@$(%.@ %$+0/ %@#$8cr$ &'0+n$$<P&$BO8 ȮT$BPX$&$BQL(Ȯ,$BQ,$0 $  %$$'(<'/T!'؏H0'0$4$'(<'/!'Я($, %%$L<?4E%C`d %P2qq,td($ds(%D%C`|`,@ %$$$ @%@$#$d,@ %$$$ ,($ % '0 (%I %@%<'-!LA 0%P0Ct@(%9 %@ |;`(%<4cC$C'9S(%e$ed<'-L!'؏$ %0%@8% %h@0%$@%P&$+ #'(<',!'0($<84,|;H$s%%@tX`$: %bX."@PQtC$CQtX<840,$ %('@ (% %@%$" $b+@, (%A$4B ޮb!' (%  %@%@x0%@(%: %R+@$<'+\!'د$ LA$ |'(d% %*% %(%|@%@%@lh %$  %'(<'*!'8\0,LHD@<4(|;$L$r%@%VXd %@%`$ %"%xBX''$@ $8%$(%  %@%$B,B@ `l' %%% 0%(%% %P+@㏼`$l %$$VX LHD@<840,('P<')0!'L4p0 ,($ <80%%%@!%d %@%#H%$b0C%"H#+€ 0%)@ %"P!P!"Ѐ#@ %(l`%%%B %@l %Ѐ#<840,($ '@9 0%@(%  %@珼#B! %`%<''!'Џp($,% % %%@%L@)d? %@%Ls % !~c`<<$$$| <4<$f0$$| @ %@ # A% %&%% %(%@%@D<<"$"<"0cb%"  "$ %$"(("  H@l? %,($ %'0<f%f0$Aۏ %Ï<'%!'؏0'0$4n$'(<'%!'ȯ0H.b4,($@$D $C$40,($'8%%b %@ C##+#q#@%b0%(@0% 8%  %@$C$%$(%  %@$͏4<'$x!'84<0,($LPA <80,($%4'@d%%i% 8%`0% %%@%@%@l %<840,$ %('@<'#!'؏8%$7Ï$'(<'#h!'،$$'('د $(0B@%$b&$ 8%0%  %@ $ #/d !+E!b!%$ '($$<'"!'Я ,($LA ,($ % '0d% % %@%`%`@%l1 %,(@% %$ '0<'!!'\@ % `%<C+`D $OC$' |;b<@@CLBD@ @C`b|;b$Dd@Dd<' !|;<$eL4Bb$G <D4cC$B$B$aL$L`%@`񏙊l'௿%' `$LD%<' !'$DC %PD %l' $BD' <'!'د $L%A % %H$ % '(d7 `|;c菄8e$ H`$*1$ H@Hli %ߏ$<'!'؏0'0$4d$'(<'!'Я($, %%@%C#R+@,$ @0%`(%$( % '0( %@쏼%P@@%$  &"b ! 0%$`(%  %Q+` q!Q# 0%&`(%Q!@%,($ '0@%@%<'X!'ȌL(p0 0$ x4,%%A%0%%(%@%4@0,( `%$'8d% % % 0%(%%@%@%叼l %<'l!'؏0'0$44$'(<',!'د $%$L<?4%%#`d] %d&$dp(%$%#`|`$ %$$$ @%@$#$d$ %$$$ $ %'(2 %@%<'!LAC$C#@ |;`(%<4cC$C'9fB<'!e% $dDb<'d!'د$ <?4L%L`dd%$dq(%L%L`|`$&L$$$ @%@$#$e$$$$ $ % '(@%<'H!LAC$C󰏄@ |;`(%<4cC$C'9hLB<'!C$CB<'!'L80(LHD@<4,%%X@*%dx %@#H$bC%H4B @Dl %D $C$LHD@<840,('PۯB@<?4B %$/X%0#@% #$s3!+@('` Bc#3!+@'`PD !%4`0%S!B% +@8B! %"+@8&6 %%%0D (%@)0D (%@"Dq#`0%% !HS!$bC%H4B @Dl2 %D $ %%B`,C$CB&#d +$db %`%$  %$C 0B@@\l %Y$D| !XDi`%BQ!@@l %H %<'!8%$ <'!'<840,($ "L@%d %@%%$$ "#C !$C#BU $ &s%%r %^$ C"0B@ @(VDe$$&&R$&$ hc%$f(0&$*ߏC$d, $$E!$ d@C8!$B p$0 \6s  #䯢\0`9D =$B\%\$.DQ$*DEC$d, 3$$E 0!$ d@C8!$Bu@'\G\8%$:$$,B:@Tp(!D!E$,B@-%#\$+$B4D ($֬C$dp0`󏙀D $du$B%$B\'9'\@%($@%$`H%8%B ! PE8JP!CBlh \ %HBb| 0%'9Q'h("0B @922B$CY$n$B$*Bo@`$cB9*Bd@]$m$CB4$SB2bD@폇$2b@ꏆ$Ɛ2b @珂$B2c`䏃$cL~s`Ꮔ$'t46S $e(!d4 $$Ɛ$&c,b@($b<4cC$`Ïl0Bq@\lh48%0% %(:@%B*Bo$,@28$BG!B\!@BD ( D(hh@*$B̯hh4<4B @4'`%D@BQtD$ (%@H(@I]$hT%%<V*@cD ($OhThThìTCh"<4K %!B@䏼(*B #$B@%`0%(% %4(@0%(%'9\ %4:f (% %(%+ %㏼(°!&R*@D*B #$Bد@@%`0%(% %('`D$$B\L&RV@:f (%m %t4D $4Db!L4$  %돼($$Ɛ$B$cM!$h48%0% %B( ԏH0@Ϗ$'9$ !E8 0%D !$($ !B@\$$$mB1*Bn@)$SBl$B$$CC$&$V %`0%%z(%$C(Bl (@ %௤d$'d'9\K %:f (% %% %1($nB+h$sB h%'<' !'8'(į%%$((%% %$'P'$&1(8%0%`(% %> %@1L@%d؁ %@%`$- %$0T C$`(% % %8%$0%$0e E t%%@lح %ď %'$%%,F `$ !$B$<'l!'P\ XB%LL@4%d* P`$ % 0%%D @4 D @%&R@ CC`$CR @ %@ @.B@$B&ѯP0&"Q+#!0@% %@%䏼 (%@ %돼 B$%C`$%E0&T$*z$&T%(%,$ $C,c `$$mC+D(%8%(Ck`$(CS`~$LC$(CM`$CC(CD`$AC%%0&"Q+#!0@%C%C`"$CS ` %@폼 S70@*.b@)$BP@Xl % XBbc H %@%ݏ CC`$CS@%8 %@% (%d` %a׏ ֏P$&"Q+#!0h@%, @ LC$$b L'9L@% {&T $BSwL,pf(!$BЯ,s(%}D$D$<_$A!d$`$jC0$hCb$$$$2/b*$n6 6`1/q$B,B@o%D$D@8$C,b@$b0C`^0CA` 0B@$lb$$$$$[` &R.B@$BR!B\!@$$["6 $cCCC`$CW  %@ 0&"Q+#!0@% %@%쏼 CKC`H$CW@H*@G$B*Y@F&*A@<&$Bqb0B@&R@R!$BR!,d'l$B.g$$ƒ$@ %ϯ %%'``0%d`0 @(% %$Cm `db %k0"!Q+!#!0@%F %@% (%r % ,C`S$<$0D$c^@C$`<<$cC$@H$c,,* ,@4$B:C`% D`[$H4^%]q[q0qWb$s*$^b&4H4C$]b44$T$]C@`%:B`%% ,@$,D@5$@&4$⯢H@&玂$B(4$䯢H%%,4$c$@H$BT@  @%@   %   %n % @@%@ 'lT8\CC` $CB4$-cdd$]$-Ct4%$c %A `,C`$B$cT@D@8$B8b8@<8b!@;<!8@4d$]:$- %Hd؏8`I<8 !<D@g$c@bd@08& (@q @8<@&"0Q+$ !@%,0,*#,$T,@$D@P$c8`Ri&d$] e$]d0*$cdD$c$D$$C < !, @(%@? <b!<D@&"@<$BC+@&"@0@$B@@(%  %@%@? @%Ꮴ\<(%8@ %h quC8b$cl8<'u%8%$D``%$H4-%%'<'!0%H(%򏄊<'!0%(%<'!'Я($ ,T%%#Q+C % %  0%Q!Q#q+b   0%(%Q!Q#@B,BB,( `%$'0<'!'0į̯ȯ%%%%%$'( $$(% 8 %$B$L'T$tx' !|D $OC$̏ȏď'%'H`0%@(%p %<'!8%0%<4<'x!'Џ($ ,T$%%%(%`0%9 %@Q#+b 0% (%z %0!3!BQQT,($ %'0<'!'@'%%% %$ (%Dl$B88$`0%@(% %d'<'$!'Я$ ,(%T%%`%%#`$t0% @(%A#A$`4c  '9ߌ0#$C㏼,($ '0@$#B!$c###$cѮ#,0C!`%<'!'(Џ\̯ȯįԎ' $%%$(%` % O%'L$P$&Rߌlp'D tD $OC$bԏ  (%0%` %@%0%(%` %@%r0+폼$Џ̏ȏď %'<'!'Я,($ T@$%%0,%8% '$C %,($ '0,b !@T@$bb"$<'!'8\į'%%%(%$ %  %l$B8'D$H$d@0% (% ď'<'!0%(%}<'!0%(%ݏ<'!'؏,',$04$'(<'!'؏ ,',$04$'(%#<'@!LX(%$ E $C,c` $+C $-C (%% $ $(%$$pG$C#$c,f #$ E $C,c` $+C $-C (%% $ $(%$$pG$C#$c,f #$ E $C,c` $+C @%$-C %%$ $$$80q"W$f0!#+0##$, # +#D##'ȯ0($4, %%%% B%40,($ % '8rH %R!  (%@@&3!#%%(<'!'$T\XPL\BD$,Bb0 '$$ %$pt%$8-,d\%$e&s&$!ce$b!@2$ !$BDBb \ b0!8c.+C!TPL`%X'`<'!',y \ $B%$x ' %@0%$ %8%)@% :1-.1&"]!C $0b&$$  !P*`*$$C P#$BP!C$ $t  !#揼8%0# %h`(%鏼  '(<'!'؏ $$ %%$% '(%%+ ###<'!'؏௲ %%8<$% (% @ %<8@ % (%  $ %'(%#%(%%+ ###<'!'؏௲ %%8<$% (% @ %<8@ % (%  $ %'(, @$ଂ0#0F%, @$ଂ0#0F%<'!'4\<80,($ $ 0!'%%$@.Bb< %B e0%`%%$0%"T!"&1T#840,($ '@<'!''$<? 4B@( ,$%%%%$%$#*"@ D"!b!!B0%#!(%`% @ %A 0%0%(%`%  %A&1%(%`% @ %@0%'9z %,($  '0&1b!&ƬP<'4!$e#$<kC$4)pE$cC!B@ #D$pEC!C$b  <'!'Xd@840,($D< CB\8#$`$B|(%$B%%4<%$,4$b 8@ @D@<840,($ 'HW!(%P# %  %@鏼*'$BC!'4( % P,@8%@(% % !&%%@돢$(%B ! % W#W!A(% %  %@ڏ0%'<'9` % XD@<840  0%`(%$,@ %(\'9'H<'!p('$ $  8<:#'@%%%!D@`%bd$cD!Q!bE+@$B댯($$B,T+@+'88$^0% (%%:@ % $B|0$BЯ,௢4$WQ#8PY0<@V$  '(8$0BC&,80% (%@ %  $` %'9@& 8Q!4B8'$BC!#B@C+@80% (%'@ %$($ ` %%ᏼ ,0% (% @ %$(% ` %$ҏ (*@ 40 ` %@%,@(%` % !Q#%` %$B@%$鯢(8,8B&8 $'$BC!8D@&$ !0% (%D #%($ ` %884B80% (%%Q #Q#% <' !'؏௿$$$'(<'!'@$'%D 8%0%%@ % %`(%@ % $` % @(%Db#b!!0%%'<'!'௿'90%`(% @ %' <'!'9$<'!'9$<'!'8$' į%$L(8%0%%@ % %܏؏@ %$ `(% ` %L$e#e!!0ď%'<'!'؏$$'9$$'(<'!'؏%<'9$$'(<'D!'؏$%'9$$`%'(<'!'؏<%'9$$`%'(<'!<'!<'!Tb@%$c$ @0H@+,h) @!@T $$8!*@ $B$c%<'!'\ b'%%%$(%N %'D $<H$d%$B,8 $@!8%0% % l(% % $` %@ @(%Db#b!`#!Pbb  &1%%'<'!'௿'90%`(% @ %' <'H!'9$<',!'9$<'!Tb@%$c$ @0H@+,h) @!@T $$8!*@ $B$c%<'t!'菙\ b' %%%$(% %'L($$<P$l%$B@ $@$8%0% % t,( %$ (%` %@ L$e#e!`#!Pc &1 %'<'!'؏$$'9<$$'(<'!'؏%<'9<$$'(<'!'؏$%'9<$y$`%'(<'D!'؏<%'9<$g$`%'(<'! <'!$<'!<'!%(%T@ %<'!0% (%<'x!'0%(%' <'D!9&0B@%00@.J&H! ,@#H!< < 5k5J,$@$ &k!'C$J$@$$ $F$$%$0F$`$$0@ 0 E $0@$%E$:8!,@8!< <5)5,@ $&I!'b$H$@$$%$BCe$%%% $$C$C#%'0% `'A%$0d$$c0h$0d8, ,$ a% aX!`8% $ e$l!00000hghg%k$cd$c%kdeded%k$c dd '1$$$qy$x$%ihd! %H%hed Vg jbF.&ZPP% @%(% %$c*(%$ q%)%$#(!0#!0000 #0rrr rqrpyxo n m l k ji$$conmlkjih$$c jihg$$cgd$$cy d '0n y$x$%i! % %ihe Rg nf JB*^PP%-H% @%(%$c q$%$#(!0#~!$qy$x$%id! %H%dhe Tgld$D,\PP% % @%(%$c*$(% q%)%$#(!0#T!%X%<'}T!'PD<8TLH@%%% $(,04% %$$!$BB$c8}!(f$8G(!F%b$$0%$ $ r$g@#`0%!p+@$$!G!#(!BH+g$!p+@$!$$0%$ $ ]$r#`0%!p+@&U$!R!#(!BEH+R$!p+@$!&U$U+`u0%4(!Q %@8#&#+B &8%v#P+@"%&P%$ $c8}!d2#j +D C!P%b#p+`F!c!B $8 !i( $P!b#p+`P%%TPLHD@<8'X8%$$0!$%$$0!$U +%D p +# !%# !C@!$c$cp +r#C!P%%C +$c#@!C(!ƏTT!P%%$$@%%0%4(! %%@8#v#<'y!'Я ,($C%+%@7%%`0%@0$/,Q(#e(#+`($6$Q$ ,( 8%@0%$E(!@ %'9\'0GCG^C,$DE(!2$%%$B%,($ '0,($ %'0GDFC:"0%d%f菿,$DE(!f $b%0c%$B$B$BGICHFD> LD8%2h%"8%d%,$DE(!$%%$B$B$B<'wH!%%?8%@#H# H@@#(@+P%H% &E(+)030D/$,z$D(#,sG(%0p(((!$%)D%J$d $0fD(!d# !$f$f5F !`a$c(!C !`S@ %$@ %$$O$0$`,`=$ H%) H0!%h$$c8!0`$!$$0*$D!$$$(!0f$ce,`%$c(!C0!,e0@0%@0%$0%%$(% %<'t!'%P!' $0!0$Ce$%%J% !0,CD,CC>, C:#00c0#"$C!0$ !,f8! !, d*,dd$$@0e$0#, d dddHe(!@@!$B$c@! $ <'s !(|&0c`%0`!<4!0'<f$5h$` $D!0'f$h$`$B`C$B$`C$B$0`C<'rP!'&0B@%%0@5#@ ,@<<54瀀,$@&h! 'D$G$@$$ $@$& %K(%%' @Ң$0$@& %<'q8!'د$ %@%(b  ( @%B"&@&1(`@ %( @ %( @%$ #'("<'pl!<'pT!'؏%$ %%`@%`&, %@0% (%@$ %'($ %'(<'o!'؏$ %% (%Tq !$ %'(<'oL!' %C2p& ' <'o!'0 %9@10Ce0&2@B@!@!< &4'0!g! 'C$< $C%5)I$@ h &g!0!' 'C$$C%I$@&@0B@&0BE%' 4!%' b$`$0Bb#0c<'m!'0%%' <'mh!'@<D%%"@  %P#D@<'H$ (%*'"@ $|C@$c8}!&1eF " %@d%`$%C` $B|e@($8(!fd$`D@P#<'HяD<'lX!'؏$ %$PT  %@ $0% (% @ %v'($ '(<'k!'؏$ % %@ %@%P+`  (%@ %W$F$ %'($"$ '(& (%0%B@ %P(!$"<'k !'Џ($ ,%(%%B%"4"0#@(%b !@%,($ P!'0Y@ %,($Q! '0<'j`!'௰%0%< %&0B@+&0@= %1@$0&`$B(`C#`.`< <5)5.E$` $B!8'g$h$`&&% P!$BP$`CF#@P!' %0@ %C0C`C`$B$BD#E<4!<('e$4ƀf$`E!('e$f$`$BC`C`$BD#<'h!4'Я ,($%@%$!b  $( @%b&1@&#(`@ %( @ %$( @%,($ #'0%<'g!,<'gx!'؏ $%%% B!Q0!$BC`&@$@% '(@$ 0! b$@ (%`$C#%C#<'f!'8%%' <'fP!'؏$ %$DT @%@%@0%0!@(%@ %$  %'(<'e!'؏0% $%(%%@$Q# '( %'(<'e`!'%!C ' <'e!'؏ $%%$ (% % <$F'(<'d!'د$  % %"!C` %$C@$ % '(<'dP!, @$$B !$,@$U$B$C$B`$$DC%$Џ` ' ,@!$|@0$ 0!$@ @%0%`$%` $|e@($ (!be$`#' %Cg$BD#' %' <'b!'PHDd`\XTL@%% $(,048<%%%$ G(%E`|b9@(!'$B8D! &1i($8'Q@!d !%d`\XTPLHD%@'h)(%$ $8%$ $@z$hH#`8%!H!q(+D!EC!BEEP+$p$!H!q(+D!$$(%$ $e$w#`(%!D!q0+W!FC!BF8+[$!D!q0+W!&%V+`]0%^(!@ %@M>#6"?%%$#Q+@(!'B$c8d!U c$`%'$B8C!C#F##b+c !#Q+@%(%9 %@[P#q+`@%(!'B$c8d!U c$`%%@%$$ 8!$%$$(!$&>#+ '%$ $@% %0%^(!@ %>%@&>v+%c B!c`%B!c`  !$B$BW#!%%b+$BB(!`1 !b+!!<'^!'௰%%' @C`(F"60cC``(%@ %'9' DC"*d%0%$Dfe%%0c$%' CC$D$B%%$%G000*$2 %F.f%e% %$E$B%$%%$B<'\!'د$ $%\% %0 (%!@& (% %!C`$%@& '(@$$C%C& '(\P&ݏ%$ %'(@&%<'[!'د $%$%% % (%!@& (% %!C` @$ %'($C@C$ %'(ݏ%$ %'(@%bP$P%0%!8!Cb @ $b,G 8i0`)`%$!8!CP%b$H!)%)-)  H!)%)-)  $h- 1@ %(%- $%- H!8!$FP+b#@$d, $E, 00#$, $$f, $F, 0%8%$(@ $B$B@!$$<'Y,!'@}% %l@%!' <'X!'؏D$ %P% (% %d@%$ !'(<'Xt!H$<'X\!L<'XD!'؏l$ %%  (%@; !$ %'(<'W!'௼%@@&%' %' l{!' C$@$`C *b*$%%$c$f<'V!'د$ %l"@%%% $& %@#$ '($ 1'(@ $R# '(l@ %<'V!'؏l$ %$PT  @ $0% (% p@ %'($ '(@%C`$BD#%<'UP!4'Я$,( %@%$ b    @%bB&&R@&1 `@ %  @ %  @%,($ #'0%B<'T`!H<'TH!'؏l $%%%C! `$c&1e%&`$@% '(C$@$$%C *b*$<'Sl!'௼% P$$`$P (%%' <'S!'؏T0% $%(%%@$Q# '( %'(<'R!'X%!C ' <'RP!'؏l $%)%!P+`$ P+` $F$B$B$  '( %'(<'Q!'د$ %%%%&a %@#$ '(<'Q<!',(LHD@<840%%@?@%@"@L@%%&#%d$B$cD&s%LHD@<840,%('P6b?@% $b$@%H%$$$ $@$f8#`H%!$!s@+"!H"!BHHP*$!$!s@+"!@%$$$ $ }$v#`@%!!s(+"!E"!BEH*q$!!s(+"!&$T+`m\0%>(! %@c&bV#V+ $^%$B%%#S+@TT8+(%G( "!d&!d$ $cF$B(#(!#S+@%T (% %@/P#s+`jT8+(%G( @%"!da%$cC +\L"(! !$BC+`R%! 0%%)k$'H!h$%%$@!$$!w#@%%%$$%$? %$$$<'M8!'د $%&%%` % (%!@'X (%y %!C` @$ %'($C@C$ %'(ۏ`%$ %'(@%<'L<!d% $E$%%C$$$%C *b*$% $0%$$c$$h% # + $$0!C !$cg@8%$$c$$h%$0%$$c$g<'J!'Џ8'(,%$ %$$C!|;dd!b!%0e0d8!(@$A(!$BFB,%('0<'J4!'ȏ40,($ 6%,C`D %$C40,($  %'8$P0!$&ep %@珼܏D$d$% %$h %@ޏ&R@% BT$&ep %%<'I !l0%(%<'H!'$ <840,(%%%,C`D $C$<840,($ '@$Cp+`P#&P!$&ps %@⏼<4B"$܏D$d61$%K %$ (%H @ %AՏ&s`% BU$&pb %$<'G!l0%(%<'Gx!l0%<'G`!'0̯ȯį%,C`D $C $P0!$$p" %@$d'`% %(%] %@D C$b̏ȏď %'&R@`%D $C0B<'F4!p$C$$C$ $C$ $C$4B0$<'E!$$` D'௿ $C$' C$E(%%<'Eh!t%<'ED!'Џ(%, $$$T ,@ % '0<'D!0% $T<'D!0% $T<'D!'0% $T +#' <'D|!'؏'$ $t@$$'(<'D<!0%<@$th$ @ # @ %<'C!0% $T<'C!',@$T ' D $C$' <'C!0%<$tg$ @ # @ %<'C8!'P |, " <$`0%` <4$ $a`8%e8!H!  %` '$$%`<$6<(!$8%$ @%@#r(%8%$ 0!(!%``0%a<4c(!$c$$$ @%@$#$e$$$ $ @#<'A!x<'@!'Tp +PLH\X%%%L <;6T+@ 8$\XTPLH'` %!'(@ ,(# +E#D#4 ( #,4$e,cC# !(,4(,$<C!b+d!4`'8̯<ï8D@@8%`0% (%$F$C <4B8<`0%̯@8% (%`%$$C @8%0% (%`%$ $C$oC$bC&$ B+<'>!'8<<40,(%%%'$$%*%P`8%<@0% (% %b$%(%@%<840,%('@|;`%BC!Cb!'$d % , $c` +$c`+$8%$ @%@#r(%8%$ f (%$B@ '<'=(!|<'=!$<'<!'$0(%%' <'<!$<'<!'h@$C$$' <'<\!0%<'DR$|;c|BC$ 4cC+@4$& '9Z@ %$@'4<8 '9[I@ %'@%$b$BU& $'9Z\& <$cC@ %@@%@%0`% t(%$i, (%$`% jal(%'9[(䏼4@8C@4C'@ %@%8` B #0c`4$'9Z\&$4`E%&2<0%%@ %4#$ 0c `$'9[($$0%$@@%'௨$ ' @%@$#$e $0%$@@%'௨$ ' $0(%`% %lhd`\XTPL%H'p"0B@$'9Z\^&$<'!!'ȏ௳0$ ,($'9Z%4` %S%%''9Z4@**@@&[%` %' $ %u&$ 40,($%'8(%$@ $B$8% &R͌(%`%@ %<' x!a0%%% $,B@ <C$E(%%$$,@/|BE%%$'% %(%0%! @#'LAL<'!'0+1&bԯ (%$%$4%$$C $ (%% $$$'($ '(8% %! <'!'Яl,($ |;rB \&1&@%@,\b&$Bb&,($ '08% (%`% %<'!\b&@$Bb&l\B&@'9c0(%<'!'د$ l$\8%&%& %"&@ $  %(%'9c0q'($ '(<',!'H|;$p$ 8!<@8'` %&$$Q$`%B@$"L$@!L&\I %^PT% %` % %YDB < %%&D<@&c0D> Pb$B@b$bbC$"$@` %H` %$ $ ܎( $$'9c0@ %$c(%%$(%L$D%@L`('%0<'H!'د$ `!%$$$$%#`$$$(% %`  (%$$c%(%$$& 0%$$c  @ %<'h!'௼ @ %|;`%c̬D|;`%C<'!''4 诤쯳䯲௰% $$(% % P@$Y|;@/$w0U D&c%T\ %'X40%$d$ 8d  %#<5f0!0+0!46 <Ï(8D@0%$F @%@$#$f $e.(% %$$`%@`lhd`\XTPLH`%'p,!04$0%$ @%@#$e`$o`Lb(bo@$b52R'8$$8 8%0%(%@%Q` %P$2R@|c`` $6$ `Lޏ$ lhd`\XTPL %H 'p$Bˏ$-$d`'`$B@'2W2$&2R   %V@%|@ @$#&b$Bb@<(%¢%0% 8%% %@%b$Bb@$b$@`lЏ |;cb&W$-@8% %(%! <'(!'|;,($ t~b$q*%2C`2Ca2C<@b$2C`_`\0'04&$'9l2R L@<$<,$d <?<4Bb+@S$c.%<?4cC<@($`2B2B@"2B@<@"H@ $"H$ &%D'9l$Տ@&<%&"L<@c$t%&b$ 2R B L$,($ '0` %2C@$#D&%D& d$D@ L$$ <'!0c` $$C` %D0b`<'!'4$ <80,('2% 2R2X%%&$wD%5|;$sd~}2$d2#`$c#%<840,($ '@<@$<6@&#cL$ #&eDed2&$$#&$6E$ `%@ɏ<`L%&15%#`!@`L! %6$$ @%@$#$d %$$$ % $+%$$%%<'!'$  %$(($C$%\#a'$0%8%$  @ @%" `%'##` 4B$z$,@)$C$E%%$<'!,`)'  %\#a %(%'$  @ @%" `%'##` 4B%$C$$`%,@$C$E(%%$'<$4%$ @%@$#$d< %$4$ '<'!(%%@$b'9<'L!'8@<40,D%%$$$@/ %@('0% %$@% (%H %$%@$bD'9 %D@<840,%'HTDU$Q$$D`%@$$(%`% %<'!$b%%<'!'؏$ $%(%%$"$ %'(<'<!(%<'$!'ȯ$ <840,(%%$C?$d`<`$B@<ȏ$6R% %S,<`|bR%<e(%&$B@b%@ 8%8B0%% %$c`$C$`%<840,($ '@<'!' ($D@<840,%c%$C;$d` `$B@ $<$`%N %R(D``%t(%&$B@b%@ 8%8B0%% %$c`V$``%D@<840,($'H<4B$F|bf$%`%$$ <4@%`+< 5)$ |f8%$gh@%@a8(+)4$ @%@$#$e$$ %<'!J(%%%,@%$|;$b<'!'`'l(%hd$$%P %'<$$(%ߺ@ %$$@(%0 %@"2<@%$bB+b 1<$b"+b bR +D bbQ +$ blhd%`'p$<'!'؏$ % %$$(%RwQ턮$ %'(,@ |;$bC 0c0D %$<'!|;`%,`$BC!0c0C! 4'௿7%' $%%$ $<'$!'`\\XTdb%%L$ %@%,B@PH"(%8%0% $@%@D PLbb:d 'd'($Ɨ %$"'$<$< %H $@%@<@0%(%@ %AD P@P %D P<$i(%ȏ%$"`\X%T'h<'h!'P'%@ %%%&\L` %(% 0%$@ #@T##TF` %@ %%'$<'!'X'%h %&\L@ %'$> #@T##T@ %Z %%'$|;`%c d!d$BeC"$|9ĠC"%$,c` $$$c @@%@@%#`%$|BD$%%$@ @`%@%$@%`%<'!%|B%<'\! ,'D $C$' )%<'!'x\ |xtplhd`C$%%$$$ %@%$ @` % 0 &$+ + %$!G&s&sBC&s&s % $+ `%V!U!PD C$b 2@<L(%0 &$++ 4V!&$+o@'P'0cH8D $$'` 'P@',$BD< $P8@ % \Dd,$@ 8,H (%@%A D C$b $䏙8%H< $  %@%@ D'p@ %Ao @` %  <$'`@ %$C @@` % ,D'pt` %@ %%$$$ %@%$叼 @$` % ,(%@ ,ID SB,`A $  %$bb $%^<f<+ R!4B P$BB &$+C B L<(%ŏ 2@SB<|xtplhd%`'<'!'؏L \$%&$+%$\B+ $D$cf$C!TC $c` C &$+$ %'((% %ED@&$+$  %$<' !< 5)| (c'D $OC$' `$}8%(+`)<44$ @%@$#$e$$ %$$B@<'!'4L80HD@<4%% N %@ %LHD@<840'P$d|c``&$B@&<& / %@⏼b$Bb@@%@('$`0%(% %@8%<0%<p %@%$H % ֏D Q$<'|!|b@ $e'D $ C$' b%@%<'!$ <'!(s(%<'!'Џ\,($ |;B+8cb$,D S@%\&$+\&D+ \Y+4\ D+0&$+&D+ &$+,($ '0<'!'@'\$PLD<8XTH%%@ % (%|;`%$B쯢<0',@ %篢\ %'(<$0%(%\&+ 0%(%\&d+Pc`.%%  %%&+ z%&q+{&d+&+ (<](%R\XTPLHD@<8'`$~ @##b&1\\V+0'@ %$$+4ڞ  0%$"@%$4%\+8$"$ $@$ D&+4+8%&+ &w+2$ $0% $"%$D@동&d+&R׎2 % %&1⏼) %& %&<'ݠ!'8%0%$@$ C$$' <'T!'<'0!'؏ $%%'$ %'(<'!',8%0%(% %$C@$' $$B <'x!'0'+@' <'@!4V|;`%c d!d$BeC"$|9ĠC"%<'!'Я \\($,&+@&2+<&+<$,($ '0(%`%X@ %<'p!\b+<$Bb+<@<'<!\+<$+<`$$+<`<$4$ @%@$#$e<$4$ <'ڰ!'(Я %<ԯ$ $ @ %@ # @%@ D'(*@ %@  %$ 0%ԏЏ%'%d%$$ %d@0%# %$ $菿0%<'ٸ!$cC!B(<$cQC!<'x!<'$cB<!4B%b0+40,($ $Bb<C<$B{+@$6R!E(+$!< %4Q0% @(%< %4Q0%@(%@%`% `%%a`%<$BQ.tb!Ԡ#&u& +$0% !`%a$r<4:0% % (%<4:0% %(% `%`%a<$c:C!&s4C`$ <<$cSC!$C`$$Kpe0$m!E$($B$0%$cqTp($!C`$e$K$$p8!`$,(G2$H$H;@!e!$dp0$H!`8%7$rc80%(!EH* 4(d <$ + !$c0%8%<$d ! + !'$c$B" $@#$d$2("$<@b@0"%40,($ '8$HE#$c$<'!'ȯ$%40,(." @'$ "@!$B&1 !E(+ ! !@(%8' %<`%@%R !/+!b0! <$c$BQpb$pb$$B%b0!$c(C`!f$B`!f$Bb!f4 $c,c`(Cb!(E$e !%<'!'8'84($D%@<0,'@%`%$MC$$JD%*<@@<&<$BQpbq!#+T!b!D'Q!!"+@<840,$C! %('H<& % Ԏ<Q!$F"+t!%(!C! +< 4:0% !<$BQb@#A$$Bc$$C$d*$ &ss#b!<$BQpbq!#+R!$  0$<'8!'l\tphd`\XTPL $T$@B@\\+l\ %+h&%+h:$X+l@Y$B@W@\U$\\\&+&+d+++`@`@` @ `P@ %@%,B@@$$\D$+`  @$+`D,&$  D$&&%(%$:b5&$$"$B0B,B@\PB@Q\$+p %@%@@$$@`+"@$B`$ %@LbXt \ E+p$e ',('('9 %(PB$B0B,C`$C0B@Џ$$p %@ȏ$t %@$:b$&$` %@@ %@%,B@$.d %@'L& (%Ҩ@ %&H'\C!&1&+p"@ %@%R#@0% (%Ґ % %(%%e&R@%@2!\"+p,B,@R%+p  %`+@$\'$%ί(%%B%+%+ %X%$%̭@@%(%\%H0%$+#+%"+``$C$B$B0B,C`$C0B@%%\$,H+$D $B$&+'9 %$$,D>$B$&+'9 %6$$x %@$1p+&,bB'9 &',C$B,B%0$p@$!\$cX!C+$\E+$b!\+b!\$C+|$pD8$\0!F+x!\+t"+p !$ X$B!$ %&$Bi$\$ԬF+\`+ $ f +@@$"@ɬ+d @` %b!#+ *@` %b!#$c܏@  %@@%XV@plhd`\XTP'x<'l!'L`@\h L<84,(HD0%&+D%%%2d'9x\B+@\$B,$ j+$B&bX \H+\ #c`F+|``%H%(%'9$$-@V hB$b"` ~ !'9N@ %@8%$bpH%DX%@8%\P%D+x #g!'; !@(%'%(#%+ ##+*@qf%"8+d !$B@$pg'9F !b\B+xC! `bpF !bLHD<840,(&+DT@'Pp!nxO !@8%w%D !x%@8%!DpF !@(%'%#"+ # #*@G8+h#H%`%_$BP $EBpPF8!pDPF!B%" !C+` !C$pb8 !p8!B`(% @!(%`B@ B#`bXB b<4X0% %  (%$~FÐ+B!8$$@ %0% (% *]P#+@Z/%'+R!$@ %0% (%P *q+@\$B(%$+@%x$$(%\@%$+ `%/D !+(!E!%\+/d !+E!b!% * *^& *C +# * * *2+@P#+`$\B+#`bB#bXB/B#'P*#+`@x$2+@sஂ\B+#sb<'Œ!'L\&+D'9x&+DT' <'0!'؏L \$(߲&$+D'9xm@XCpTBP\B+@ \\D+xc+t#d#C+@&T&$+D$ %'(<'h!'$E+$d!04,($`!%,B@$0`$$B<$cQC<$$B3p(Ï40,($%'8<`$'E(+!$0% % @(%$0% %@(% `%a`%&1$b(C`1(Cd(C,`+$B$@1(0B,D`%`(%$$C$ar"<$BQ<$3$#%!"H@FXPrd+!i(+JP! ! !<8n4e(!+D!$B8$`$B$% %(%<'X!\D$+<'<!'0D(@<84%%<8 D !(&R08 ! @%($cl$ d`8% $Ƙ$9 %(B@D4@<4 %8'H<'T!'Џ8',$@)`'`$,Dd"$$<4(#0pd@DH?!@h !<4c#!i(+ !(* f+`<$cB@pC !,'0$ '' 0%$(%$  @@%#8c$ #'$C@$<' !'0%$'$  @ # $'(@@ %ì 8% %(%! @#%@<'8!'ȯ0,H %($4%$% &Ę\@&P@0%&x&d%40,($@(% % % '8&Ę% $@0%@ \(%%$+&x&d$&x&d%0%40,($ $'8<'!\'،Y+ $% '@ a \0%$'9P$$$ '(î <'`!\'ȌY( 40,$% % @9$C $ꏿ40,($  '80%&1 @(% %M$3@%$b` %'$0% %A@(%@ %S@$0% %7(%@ %$pCî %40,($ '8 4<'!$p'<TPH@< \XLD8b!S+U! %%%@E'(ï0%((%,408%%$7$C\XTPLHD@<8#'`<4B!%(,@ 8%0%(%%ݯ$F$C⏿\@(p#p+#'P!s#+!C!B,PB $`%8% 0%(%%ݐ$$CÏ\@21 ߏ($<' !'<,!h+i! `'$?ï $4 @ %@ #$,% '0$$ @ %@ #% ,'0<'P!'L@P@ %' ' <'!'THL%'@D(%@ %LH'P<'!'%(#TE+ # #' <'p!'Џ8'(,% %$<$BB@b@ ,(%'0<'!'X\B% $@%'< %$H%b<(%Bb; $` %@%@\' &+ 0%$d %@%@ %$$ HC  %ՏD C$8c $ X0%(%` %@ڏB@؏&+%'<'@!8''(,%, %$$C` î,(%'0%<'!\$,(<'!'\0%%?A D %$OC%' @ $(<',!\T$,T<'!'<0, 4%$cB<!4Bb0+% %$Bb &(<$B{+@&(D %$OC`&$& 0%A$ %#'E(!\+ !0%D !@叼 40%,'8<'!'d |xtplhd`\% @%'L`'T'('P`(%%`8%$ % `%B P@ %LD(C#'"#"+ ##@%'###+##`(%`8%0% %`%P 'Q(!\+', !0%D !A D $$OC$|xtplhd% %\`'$,(%_@ %|<'!',8%0%(% % # ' <4B*@$l$0$l0 $dC``$C`,B%$<'!'$$e@$g#$gq(0#@(@8,$$5)$cs$b@$b!$b$'9p$b( ,$cb@$b$b $4$@􏙋'9p $(+$4%' $5$<'!'0௷į \̯ȯ$B%'<('8,'@0h%%%%4+@%B@ $%p!`$Bb̏ Cp!&b&RV$-)$_'$0&T&T%$+&($ L %<@%$CBC$F  T&+ F,04 8%@(%@p!`&TC $GC$YC$EC$OC&R% ⏢ T&+ L$+BC$-C8$$B88% !$0$B,B @$$G0#`888 %q+b !B$B,B @ (B@ p8!$-&&1!$0$$+##D!<$$8C D+@&&D0#b+@+@p!8#b+@888p ! 0%0!d&ȏď%'<'!'$,CV0(HL4,$ `%$BtC!%B\!@%<$)0 (%@0%$ƙ l 8%$d %@b%,@9< !0 (%,@/<$B, @)<$B, @#<$B$El'+$d0%D ! `@%@P%K$ $@IWÏ$ƙdd$d %b WÌ%(l + gLP!(b@X%'9V %$C%(k H+,P!$gb㏙$d0%@ %(%(ci`'9B %$C%(m׌WH%@@- @%H@+% @@%$%W@$-B$_B$ƙl%$&40,($% '8(B @<m$&[$ƙ8d= %($` %@# +C#DP#$$&D$ƙ@$WÌ$BC#$C`P%g@$$cd$BC#DP%'9 %@@%dߌ<$*$El'+D !$d 0%@ %`@% +#D #@#;P%$el+b!`P%`@%`<,'@:$ƙLd$d %b A$`&$C`$<d$ƙT$d8C`$dp8bm4 @珙p %@% %b $[&a $P%B$ @$$ƙ\$'&<$(<$+$ƙ,<'8!'؏l$|;b$'(<'!'L@840TPHD<%%$(%%$ @$%@ T(2R@O"$$dpd(!$B"TPLHD@<84%0'XC$+W $C,c` %@ W$B,B@&&&C&&$B,B @$$ ',,$$c0c,dU܏$!c|!`$$ @C$B,B@&&>$<@&s v !@ %7,@0%X %@܏&s$b폙%<&>$ &<$( @(% 0%A$6R'$(%$+f0%&&# $$(% 0%$ '9ްI %@%@\i%&#$%&#$ &#$n$$$, pDX!`$$ %',  fp8q @0!$Ьfh0*&f#D+@[0#3f&#$ &#$<< &&@ %@%@0%(%, %@%@ "$ C`"! &'@ %ͭ@%@0%(%, %@%@(#$ b@$c #<y$+ 0%$8 %$= 0%$@&#$<h$)<e$*6R'((%m$&$%Ai$lg$$%&@%' x$6$-f0%&$$c,c `!%$ P%, pi8#E#&!$cu!(CE`T$Bd<'8!'Џ8'(,% %,('0<'!'d\XTPL%@%'\`0%@ %`(%`%AD $$OC$\XL@% %TP'`$,`(% % $@(<'!'(\ԯЯ̌B|;$btC B $B@4'D( '@,x<(,DHL@@H$d诱  'P@('4'P$! %  $$H  % Ta؏xT|$ \ČBbԏ Џ%'<'!'؏Я$ %|;e`%̏| $  %<'L!'د $ %%%$d)(d $,dD( % $dD(  $,' @ %(%'$ @ %@ # @N"L%\'|b,@ %$z(%0%(%$ $b,>'X$$ % %ط$'@$(%` % %>T<48<0$'00%$$c `8%$(%'@%0 %D P$$  '(b %ď$ $$( @ %c' ,'$ @ %@ # A$$btbT` %@Ώ<B}C% $ŬC < @Te%T$ $ %$ @#<'! @T|$ @ # @ %<'!'Я,(0% @T|(%$8 @%@$#$e,%(` % '0'$  @  #% ,('0@@ %ì ì$<'!'Hd`\XTPL% @T|<!c!4+s+(!g!#%  '(&ï0ï8(,4<D@8%$9 @%@$#$g ` %d`\XTLH@%P 'h $(,04'$ @ #@% d`\XTPLH'h@@ %î î$$ @#<'!$ 8'(% %'' %<'p!'<0%  $04,('(%8%$<'@<'!'`\xTPH@d\XLD,%<'D0'@4'د8h%<'H%(%$+@%C` $%!@<bd b$-!&C&RV*$_($0&S&S%w$+&s0$ L` %D@%$CBC$F ,S&+,F4(8< @(%@!&SC $GC$YC$EC$OC&R% Ꮲ,S&+$ $d$C@ $@#C+@p@ @ц !@!%$+$-$0 $$B$`@($+&"d !(&w@! $0($-&d!&fP#+`+`@ %&`\XTPLHD%@'h<'|!'؏$|;b$'(<'D!'ܯ <' !$ @ # @ %<'!$ @ # @ %<'!'\'d`%$  %(%,'8 %($ ƾ(% 0%(%y %TPdC%L+`\C!'h<'!$ @ # @ %<'!$j @ # @ %<'!'Џ, , $̯8%0%M@(%@ %$ %, '0<'! T$E`$B`<'!$ @ # @ %<'!'0%$ %$ @ %@ # '<'h!'$$$$ @%@#p$g` % '<4c$`$$ @%@#|$ %$$|  %! @#'% %(%0%! @#''% %(%0%! @#'8% %! <'!'$%(,%$@ %$$ @$'9$'9|$̏ '$$$'9@$,(%'0@%$@ %$$ @ُ@܏$<'!'̏\ܯدԯЯ䯶௰Ȏ"%%%$`8%0%'9@|(%@ %Ď"b䏙 &|%%8%0%(%y$W@ %$폼$$Ď"b鏿$ꏶ܏؏ԏ̏@% '^,@% @%D<',@$@% Ď#䏶܏؏ԏЏ̏'菢08'D<@ %4'4'ď$ 0%0@%&s`%0$$(,`%($'$<(%$% %(,$'('9@$$C$句,<',!'8\<D@%4$% @0%@$0#$4bD <8@%@ % 'H %$$| @@ (%l'  % %$ @ %@ #@% 4ڏD@<8'H<' !'@\PLDTH<#%%%4$ @%@#$4"bT PLD@ %`%<H 'X@ %$$| @@揙l'@(%  % %(%0%$j @ %@ #`% 4#ՏTPLHD@<'X<'!'௨$ ' @ # @ %<'l!'Џ(%, $88% 0% ,@ % '0<'!'Џ(%, $8%0% ,@ % '0<'!(%$t @ # @ %<'!'ȯ(\04,$%#%' %$k @ %@ # A%"b! ''%$D $C@D$/b $⏙T %@%ݏ%%40,($'8$ @#$ @#$ @#<'!$ @ # @ %<'!'@X\B'% % %@$A.$Bd 0%%qc(!A$C  $c$`c!`'<'! $ <'!'؏ $%%@@ %@%R(+T(% %%$ '($$"<'$!$$ @ # @ % %$$ @#$ @#$ @#<'x!$7 @ # @ %$ @#<'!'<@$$th'$ @ %@ # @D D$ $%$'(C$<'!$ @ # @ %<'L!$ @ # @ %<'!'௨$ ' @ # @ %<'~!'(%0%8$''௨$, ' @ %@ # @$$'($<'~D!'$',BO@%(% %!*$C *$C 0%(% %@ D D$ $$C%' <'}!'Џ$, 8%0%(% ,@ % '0$| <'}0!'Я,($  %,($  '0%$ @ %@ #$ <,($  '04B$@$  %@%@~@ $&sp$`%$`%$2 ,$&p$%$%$,( @%$'0<'{!@P<'{!'Џ̏D,@ 8%0%(%Ξ$h ,@ % '0<'{l!'Џ̏@,D 8%0%(%·$ꏼ ,@ % '0<'{!'Џ̏D,@ 8%0%(%p$i ,@ % '0<'z!'Џ̏@,D 8%0%(%Y$돼 ,@ % '0<'zX!'Џ8%, 0%(%D$ ,@ % '0<'z!'د$'$(%$ @ %@ #(  $'(<'y!'د$'$0%$ @ %@ #(  $'(<'y4!'Џ8%, 0%(%$1 ,@ % '0<'x!$ @ # @ %<'x!$ @ # @ %<'xh!0%$$$^<'xD!0%$$$Y<'x !(%8%0%$<'w!$ @ # @ %<'w!(% %<'w!0%8%(%d$<'w!8%0%(%[$^<'w\!8%0%(%R$Y<'w8!0%8%(%I$<'w!$ @ %@ # <'v!(%8%0%3$<'v!`+'د %$ %&! @#"@ %$ @ %@ #$ $ 0@@%0$ '(<'u!'ȏد($4 $,'5$  ,4'8<'u!'Џ', $v %@%,'0<'uD!$ @ # @ %<'u!$ @ # @ %$ <'t!'؏<@'$ $tw@$$'(<'tx!'؏<$' $tv$'(<'t<!(%$s @ # @ %<'s!'؏\$ $ &,@ D @%Q%$ '(&,<'s!'h\b%|%%@ D B|c1 l'\ (%  %@0%(%8 %@菼R!@'a %@ߏD'C %@ُ (,$$"'<'r<!''8\$4' (,0 %L<$cB@p(T\'`!<'q!$ @ # @ %<'q!$ @ # @ %<'qT!<$BB@@'',  $p $^ %,'0<'p!'Џ8%, 0%(%$ ,@ % '0<'p!'Џ8%, 0%(%$2 ,@ % '0<'pH! %t(%<'p,! %(%0%<'p! %(%<'o! %(%<'o!'̯8<%,ï('4ï0 '(@<$<8'@<'oT!(% %<'o8!'Я, D ï'$ ,'0<'n!'H%$l%(%'<'   %$(,04 8$Dï@(LïH,P0T4X8\<`@dDhHlLpP t@* $ (,048 D$L(P,T0X4\8`<d@hDlHpLtP'<'m!'Џԯ(,%'@,$,('0<'l!'Џ8(,%'@<!d+e!` $D $OC$,('0<'l<!',@<D%,ï(04''(%$C D21 @$D@<'H<'k!'Џܯ, ï$','0<'k\!'Я, ï'$˞,'0<'k!'؏د$ï"'$'(<'j!'؏ܯ$ï%'$'(<'j!%8%7'-@(%<'j`!'8D'%$@(%@%@$h@(% %ď%'<'i!'8 '% @0%@%@$h@(% %ď%'<'ix!'Џ䯼(,%'@<b!C+D!@ $D $OC$,('0 %<'h!'<p ï0$,ï( '45<'@<'ht!'<茢ï$ï ,ï( '4ï0 <'@<'g!'<ï$ï ,ï( '4ï0<'@<'g!'쯰8<% '@$,4 <8'@<'g$!'@% '@%@$$8,'84&(  %'<'f!!'(%(,%'@<b!C+D!@ $D $OC$,('0%%<'f!'؏$ï'$'(<'e!'؏Я$ï'$'(<'e!'؏L$ï'$'(<'e@!'؏T$ï'$'(<'e!'8'%@(%@%@$h@(% %ď%'<'d!'<ï$ï ,ï( '4ï0 <'@<'d!'P'(%TLH$,%p@ %@ %`%<!p+b!` D $OC$TPLH'X$,@(%T %%<'c\!'ȏH4@ CB$ï,( '  4'8<'c!'ȏH4@ CB$ï,( '  4'8<'b!'Я, ï'$ɿ,'0<'bX!'@<D%,ï(04''(@%A D C$bD$D< %@'H<'a!'Я,  ï'$ ,'0<'a`!'ȏH4@ LCB$ï,( ' L 4'8<'`!'Я, ï'$v,'0<'`!'Я, ï'$x,'0<'`T!'Я,  ï'$,'0<'`!'Я,  ï'$B,'0<'_!'Я, ï'$^,'0<'_X!'ȏH4@ CB$ï,( '  4'8<'_!'Џ(,% '@$,('0<'^!'ȏH4@ CB$,ï( '  4'8<'^T!'Я, ( ï'$ރ,'0<'^!'Я,  ï'$ ,'0<']!'X\%<ï8'Dï@LïH '8T P@ \ $,4 \X'`<']!'Я, ï'$ï  (%,'0<'\!'Я, ï'$ ,'0<'\T!'8'% @(%@%@$h@(%z %ď%'<'[!'؏ $ï '$'(<'[!'$@<D%,ï(04'ߜ'(@%A D C$bD$D< %@'H<'Z!'̯%' %<e(!(+(! D $OC$' `%<'Z!'(<d ! + ! D $OC$' `%<'Z!',8<%'@$,4 <8'@<'Y!'X\%<ï8@DPLïH T8%0'8@ \ $,4 \X'`'<'Y!'48<% '@$,4 <8'@<'X!'X\%<ï8@DPLïH T8%8 '8@ \ $,4 \X'`'<'W!'Џ<(,%'@<!d+e!` $D $OC%,('0<'Wp!'Я, @ï'$ï ,'0<'W!'< ï0$,ï( '4 <'@<'V!'<Dï$ï ,ï( '4ï0 <'@<'V0!'@%0%H @%@ $$8,'84&  %''<'U!'@%8% @%@ $$8,'84&  %'''0%$$c !$c$B'!'`@%`$cd'C`C,i '@ %@$BH@%%b@?,I% $ kj:$d #<pH!$ `3b6LP!b!$ @6b@#$(!b!$ @=b@#(!(!`D#D@#?!$(% '( I!i$B i!I$ci!e%((!$c@!ì0I *(!@!$B0I*(!@!$BB0H@%B@ $|D!$GH@!H$c0I  $H! %C@$$0c0BC#$%!$B`$$@$Cf+` ,C `Gb%!C$F$@$%%`$|Bb!0BC&<'QT!'$B@ 0X%'90X$I($(E(!@%%' ,@@C!B@ A@!` %(!@'8!8G8!<'P!'௼0%C$!4BC$`4H% db0B@/%@@@!!j@#C#J!@!4 P@'90X 5b%,@J!B@ "H!0" %S(!@1k`%JH% %' <'Ox!'p%%0$D@<84,(%%%$D@$B%&1\&2$%Ad!x!$B(!8%0%% %@C` `C $0cd C 0c`C D0e$֍4 0%'91,- %@%0% (%%3 %ڏ$g 0w0c`D@<840,(%$'H<'M!'H@%$% %'90'0b! ,0b!0(f0!$0|@TF0!||@F!|0$b!<o4'91 %@<ob!(4 %@b!,'<'L!\<dt4RPk-d0%$$ $ $ $%)*PE#$(!C$E$C#0!H$DbEH(!EE@+ H(!@+0 E! E@#($EX(!($笅`폘E@+<'(@+(( ٯ<'K`!\PD-\$C\0@ B-b!$BoF!D!#C$<'K!\$$ B-@GCEJ$c8#h CDEH#e+`B 0#0+(!$c% <'JL!'(\Я̯ȯįԯ%&,|;$u\\&,&00N&,x@(%R %x@-TU4-T`4@/a@,$%x%'<$B B$@\C-xP-x0g&,2B@ H@"! ~R@@Ѕ&,$xam %&1|B!S!r폙Y &RԏЏ̏ȏď&,􏙀01'<'Hd!'pxh|tpl\P %T0%X'\,%\B-&,BL$HD8$B`$B38~<`0R$C@qDb!L@A8\\B-C!\c-d8cC8Q$c 8@XDb!$$&B@(%Tb!XU!\E-$~B4 @@<:G,0% '00@40%$E',B@L%؎q:(!(,(@z,@@$(%<`$B_\@$ pC0!E@!%E+`8+F++`F+`L(!  !C@+h +0 0%<'>H!'ȯ0,( 4$P%$$&RC` 40,($ '8U0BV@%(#($ % %(!@%$F0!#0$"&s!<'=X!4@\C-td4D-t<'=$!'د$ @!%D!$H $ '(D !  &1"+@r2$ d '(%$ '(<'$(!s$u$e$b!u#د$@0%`(%  %@%$ \#%d  %%t !D+@ !8'\0%(%@  %DDЌDF + DS|0 x%0%%D0! +8 %)J! DD$D$D߮$ D $$DF ! $Ԯ$ҏ\-dD0+<'0+ íؗ8"H$b6DTӘ!D $ C'9E % TӘ!  ԏ@%$$b!%C` d$B$  %@ "3@0d  % 쏰%'C$BԗR!"@DD+`!(!+` C!D#b!"T"R"#&RB!C0$B!C$|D0E %0B%2+@ϏԎ0B@ˏԎ ! !$C(!#$D0#0$(%S#R+@ r! D(#%%$ $ @ %$nf !F F(#g$䯣 $ @ %$\'9ED C$Ybq Rb!o3%D $ ۬C%%<'1l!'0%' %̯į$ȯ` %/(%@D $C%$lC!$i\ %E'90X@Z\&1"@\C-|Q-|q #% %̏ȏď'Ђbߏ\$bbۏ\&&1 %"@ $.3 %$RQ0# (%A %@ \$"@&R0X %@%@%\B-`@@%\5#$,#C8$ C%,8%$0% $@%A %$/ %@H<  %@%%@D' @ %Aa@@ %%\B-'90XQ  j %,B@t\E-l' '9F\ %@%$B̯$Bԯ$B' $(%@l؎1 $"@ $|$$@$|$%<1l \B-h@ݏ\$/BD@%8%$B%$$@%@,<+@"b@dP@܏' $@(%$$C,D C,b@<$B b0B@%' $YF\) %@%1l$w@ %@&D&$ m@ %@%,C`B!@($/@ %@%R#@$/Cbˎ$|r b ! $@%@Ů"6|$$1 %@%@ T(% %|׎2 $&Rt䏙#(% %@0%h0%! %`@(%$ 8B{$b !!`(%(% %8%$c %e8#,``$"#d'$$Ɲ %Z<H  %@%@PD' @ %@($  &$@%@"B-hd D-h$BB-h@ %B-h@$BB-hE-h' 0%'9F\ %@%ˏ@8%@ %$/%Q!%@D$+@P50#(! %A  BWʏd@%!ˏd!D C$bď$BB-h\B-Q  9\U-X@`(%'9Kg@ %@%@@ % '94` %$`(%&138$ƞ0 %\'@6$$ƞD`(% %R'@,'9E` %ԏ'9QD$L@%&P&T&X&\"@ @($$/$B"@c@ %1 \B-d@'9Dhh` % %$EɎB-d@#@b!\B-$Bb!PU<4BC`&U+@rE(!x $@%@ '9E` %%$$`(%A@ %"P"XԮ#T"lB-d&$ȏT#\$"eL(%($h$/$B"$-\\2b-$Bb-""#0#f$#\$B- #D$C!#"b!@ %G-$BB!$B$b-$BpU\2d-B!2&"b-\C-|Q-|\q #B-`@P"8%0%$ $ePꬂ <'%!h@'ȯ($40, %&sQD&xh@I\#-p %$R@px,@\$B,h %@+ hd!&1bB  @B $E$$B$ $@h\Y $T\B-d@"-\$ D-P"-P%\R!c`$hC!@p 40,($ '8d!&UU!0B(%`% !@0U!B(!  %\B-d@ \$ D-Ph d!&1b&R<'#P!'(X\ԯ&-0įЯ̯ȯ|;$s\&$,$&-0\`&1,ˇC-T\\P-x&,&0ԏЏ̏ȏď' (%~ %x@S4a@ $%%'~B@2R @Lێ$C$C!!$& &@"! 揼<'!!'د \$ \Xc&-0&$,􏙀$  '(0k&$,&-0`<'!<!'\'98d,xB@ \,$B,d ,' <' !'(Яȯԯ̯į%&1%!0&1\&$BLBB,\B!B*$$.@'91 %B'96@ %'94D''90m$%\`C!\D !$b-D.@ \4C0f`&$B& #'C-\@ %'9GR-8%@(%$ƞ''938@` (%B"! ` %%ԏЏ̏ȏď'<'!'Џ %t,$$'91(%8 %$P\C\$-Pc CP @ %A4\&E''9388%$ƞYB,((% % $"! '0<'!'$䯱ܯد쯴诲$$Bb!D%$ b'90' $ p$B1@%㯢ď|;`%PC 82#xb$xb$LPb֏T$b%\\&$BCTb,E\4$u0%@%0%$ $ $ @bH!bF! ܏'96 %%\$Q௢̎"@\\$cd-\c $-##$$e $D!$\#-\#C$#\$D$B4@%~ %\Q-t\&DhQ-|\%KQ-%H&$B@h$BQDЂB@̏'9]c$DD-'9EX$! '@$`"\\b$d,f*b!BDF$$ $BB@ %$BB$B` BhB-|BJ J-|\<p$$H$-$F5$$b8!}'9?x %\'97Pb,d\,@$~-\B,B@w%x $@%@qg$ $v$Xb*$|@'$$ `\b-l $@%GG8#g$'I!FGHGG$$y %@ %,C` $B$'90X !@\$C-`&$B쯢ȏ%$B̏\Ў $-"C#b&"#b#\nB-`@h$BT8%$ $$D$"@Q&ȏO$@$b-`%̏C$ @"$=C&1\Q-l@@ꏃ\&b-l$*$@" $=C&2 @@&@%$$ @ۏ"$=C&6@@&@%%$BH (%@%AD  D8%0%$p\&%'9K@ %@ 0%$ $|@ %&"C%c!D\c-``Q%FB$ $ $DDD !$c$B &RB@ $ C$C,c`$:C&R&R@%& $ ',B@$:@ % (%%V_ EE(!EEEKe(!(#$dF! !$!G !D!Eq$c\$ C-\&G%9C- %6 %^  @ %P @ %A4$u|;b`% @ %&1Qu\B-\@q\B-`@ %R-&138$$Ơ@(% %'Tx$C$$Ơ @(% %'T$C\$XC-d\C-$B-$c7HCRCϬ@ D &@D@%<'p!'쯾请䯶௵ܯدԯЯ̯ȯ<\B-쏾菷䏶܏؏ԏЏ̏''$\Xw$-0^$\XC-(\B-T@ '\Y$d 6\B-\B-\B-\B\B-p\B-t\B-|0C\C-X\ D-P@i@%\'9QDڌE-@\Y\B-X@$ 2\C4@4`%@\C-td&1EB @Dd @\P@ \`C-`\C-\C-\C\C-p\` C-|\X@-(@ \be$D+E!bd\`Ʊ$-0@<W(%NR B@% DcB|b% Dh %p% %BS DڬS% Dx$@'9]5xB@\e@$\h$B,B#.Rd@0%\&,&,􏙀0×Qa '9?xB`@B`@􏙋'9EX(%BhE!B@BhE!$Dp$hb!c`$B\\%$BĎh!S`R%fp %dceh(!c$B$cf8&W!@(  %@%@!Y ď-d@\$ D-P @%@h%$cpC+` h%D!@&h0@ %폼ch(e!cgc fcch&e!ehd!e$B$d\B-@g\@cB 0B@w&A%%BhQ!B@kBhQ!BB`@&1%BhQ!D0B@\B`@􏙋'9G0B@D\d0-p$ -p&R:L@$'97P\-"\\|;$rB-'S$Bl&1 ^'`%@%%l %0%-&!P􏙀\P-\+@" C4@4`%@\C-t@! FD-Fڂy2@B/("q7D#e͵M;/ۥۼ9V[H8Y?O^mB[Epo$1N䲌U }r]t{oޱ;%5ti&iJG8O%Ƌյ$ we-,oY+uJtn\ܽAvڃS>QRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGXAe?C@?>龈8>!>~OR>?VlQw?UUUUUL ^?US:B>BPi?V'@ f݋p?!T@=дabc1@ !T@=abc1@@|0@!T@=abc1?_0mȃC8!TD-?!TD-=дa`;.ps;.9{% IAp?!@>tD-p?@ ?!P>Qabc!`?!`=:Z|>Z+>W}?*a??UUUUUIUUUUUI>͇;F?*t?n?UUTˬw<&3\>*ptz?2?0&h?W?&n?Au`Ss?~7?CDe?mm"V(?d7?z?UUUUUc?b?h]N?3?TZ?8r?UM4ɟ?= ?Iu?(h;?UDU?o}?UUUUUU?ű.?lY@*Y@:'-K8p<&3\?.B9Gp(?_ʀQ ?@?ڍM?cYu8?TW5?kQ?&`c5?c\ٟ?Jo3?>f#?#ƚ\@TReW@g\̫@dL("f@O0 ˣ@%A&?4s`?4` d5tb@GHJ@[(H,@z!Wp@+!(h@{) Պq@a5 Rj!@3pv~8N8?@aj.Y@u(@d]C@1 U_Z?铺p…?49oJ6pBq-b@}tc@;@h$j@Q@t\" @>V&Q??ni?w#fh?*QO?}i?nhМCBa ?!]"?t"k?LU6κ?wy <V=+=<%hIv=q-=yd=|׽>. &֕>Ey0:>z򚼯H>>h?6C-?PbM?zG{??@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4@ O yq@$??ٰt?Xl?[Q?r<}Q{?T1h?8znub8?? 1?7:?ަL4"?`a-?6*'?+VO?HT)?~:U?f;?u_t?s?L?B*?7?đ?>%]?蟙Zӭ?v^G?݅R?7 i?X?|3{_?勞?v[nE@B?jK#?οP?.B RC8@GGe+>jK#?.P?.B R@gGe+C8v.B ;:??UUUUTwa^zf?n<]{m?Xl<?﬒+rG<>=p/?2Ѣj4n ?fVR*/?[QPNU?l1̼#?-<\U?zȥQ꥓H?r<}Q{U2=?j8:/`?T1hˆ8?MP"/V6?4?-?u_tJ}?Ht2U?VBg<^ ?iO]?{2ܹM?si;74?L^:?F#ǭPrWn?ٛD%]<11?ٞ0X?|3{_*;G ?F)ʆR9?۷?ZU?@C4Ck0A@>]z@pՑK@@fE""@|\@jSe>j)1>1;Tk?>>4?'w@,o@?)J@0@qK@Ha"C@-TN@KMc@2j˂?B@ a@EO-@eY^@d|!@T^C@;!@g{Ym@#r@zTW ==)̌?rL@W=@` @ ā@S@dx6[9@XNkcAfRTӌ?A(ڃ+CA)k( =m,0?,@'R[4@mc0%@M>m@f@68eYY@a臏@pB@c<:@-PD9 w'mbI^B69$C&b$c ށ@A풄}@v9FJ|@nma@Û~@e7%o᪆KEt5JLNM "B E?r@N` @m\~(d@Z`@̸v8@ dG̿p kP/Z}tgBcu(@]"3gQ@}PYi8@һn_@@AwO,I2 )дOyp{cjnM 6d=@]"3gQ@N` ޽G@A풄}Ӿ%o᪆@68eYYw'm@dx6[9@T^C==)̌@Ha"C>2j˂@>]z>1;Tk? PBm3s?> P9?(楶?>t]>;T΄թ?W?¤=i?>UW;N>s\?6M k?Ll?Ɲ?֙=P;>d-?x?p@=xd@ohۂ@I@%H)@c~^<>ֆk&D&ҿ>HiN3hE)J5_69nR@G#g@1>@hND|@T@z K`p) 15ϩӏO?QTp3Lq]lG_kf_\@TQZ@1{9@ d)@Wmї@K|6Ko.C?Y Kfmlti1sOh@d,[@b؄AW^A%SrA$Ww\i?0EgySv$@teМj@5o@_R,@mբ@]kz@ NQ>|UD?Bv @@(|7qd@1@KIt@AeI4@u 3_@[|P7#@}.1@Ym|.S>)!?[!{@v^@AH)@VÅM,7@HG>@Mꨯc=@6g@DW@@0o^Q=g}?C@6nc@[E&@-RI@~ @\Eel@ܖM'O@ Ż@,@iz -?@*z5@ye.@E}2@z'@\Eel@Mꨯc==g}@AeI4>)!@5o>|UD@d,[@TQZC@G#g5ϩӏO@=xd&D&?>jF >ƺh?W G,a=*Ϲ~>5},>3??(_Vd? c~S_0mȃxV>?_UHD?v),?f<=P9w*>:[>ZN?*l%wd?e ?M? `_0?݋aZ?bcV?>ptBR?,M?So?]?~@O?>Ub?g}?X7?P}?@Ɖ?g̷k?"T{?ԣLĦ?4ml?V-?xpD?ɨ5?+8?5>?As?b.?j?BA4$Ì8?L a?n.?f ?' Pʤ?ÊB?g+ ?N $?IvDP?G\o?@]?jZWa?US|?PP@%+@½a?E?^&sh9?H~a?»?ُOY?˄6x>޺@?I}A[?t.u?'??Ebīt@Z C?KgL?CˌA?J8?fl.\?UUUUU;?}iA?>RD?Fd?I$"Y?UUUUU?Ú xƟ?qx?ٙ?{ ?DP`=8ʚ=Y+6?Ge =.Ge+9? :Gdp/?wlPLHdz(꒼?b%.Ge+? :Ge+|??wlP[ v?av6?d?ĄTJ‰,883?ͣݿĔW?JX 90$?S"bYZ?n{@o?s%;zOw?Q \# ?0 j&)x?%~!w ?~ʧk?SP?De???M?W:Z?2W@?=?Ћ?w8?r@? rMC?P`?줲uc?vޠ??Q?Cw ?+O L?Ɏދ@?}l`? j? 6n.3?΄ ?p&)P9?y g?m'1?Ѭh?Ӽ???Ig?FNŀ?p|?- :? 9?Q P?Y?q?m?؎}?9<|9ڲ?<}3nRT?_Z`VL1?.?ay[0?qJ= h2?9A {?ɕӝm{?  d1?^"{ |;z?JJ4?㓯Ōڈ?*BE)'?"۲߿ѕm+H?G4׿Ag?C(@Д?>xȿК?%GRc?$Ԅ4"E?m- GJu?S9TΤD=0?:'DZ D? A`)w?>?]W )V?٠ Lˁ?`+?$+uڸE@.?"͟ɨwh?u[ńz miH0?]I6q E?FyM@֏0?/\$<9 1T?NAs}v$0? ѿ{0?*F,Q?z ð?r`0kI?}WW‡T@?h;y?S`%,?>;W ?*+@@?ReigNؠ?#W~|y /`?|t&鿹(? ,Fr?{p?w%ＶtE8?d5L1ڿ^m?Q'_ݿH\ޡ??2L3Mj?,rڿ y`?0(1Fb ?ڄ4lj?NkڍJw@?]*ο?Dc,!@?|X3?/6ѿq^gր?ۘ9\Ie?R߿Id@?{/N(r?j5URR?Y,=bρ?II,(?8𭩿1{ ?(ey25]?$'sHx?` y$?&?o?at?A5=?c.?Σ€?%k,?CN`?my?xǻ `?&m7m?C2 ?X]X? 1q`?&3?g+@???G?uۖ?&n0? J(?צP?e>,?<3?7HgɈ?ĺ6kz? K!0J?œ9(?~?j$?1`=?@f??X??W@ s?)T?,*K'?ɻ6@??ʋ,?ן$<?[Q\?%DZ?)g̼?./?5H`?\Ku?4F?4ƝH8?Ό? O/gR?U ?Rם?l?Ο|?q?ھ?kp?t'#?63K?O?ј g#H?*Ie>U?̀?`?Y_ch?%c)?ҹ0 ?羳wܵ?rC`?盪g%?w&m?yW?O0?V ?2/?Ok<~lB[~-S?<{fq yR?/g<&$?O߁jnn?pggqTt?~5<? p~)de??r{?&v<(m?<QL3?0,0?P3svߴ?0F{<NKv?Oo~b.?o<Ѽp&8?E d?ݘ.>@Z7?IfKip?Qxޣ?e [?@<|w?Oc'+?A\El;!?c ߼A. \?vS< S?K<`eqf6?0'z#2 ?OpLr?o_T<d?<~Ł?>A ?I*%G)?z~i?ay{?qJ=Ҿm?9Q:g?ɕ1ئ$?  dWO wX?^"{ +ǜ?JJ4?NvΌ^?#X庿?a`=/HL?0O;{??;F`%2]V ??=,^N?`?ZM,i<]?@? <2??3^]Y@=#\:G??jȍ`+h??X@=&FZ?`?9 -hE?@?9%4O ??'=!x-??+~#=,D84??a =lˁ??e@/bin:/usr/bin@klkkkdkkl(l(lkdlld  ]cc  (  *$2a$00$abcdefghijklmnopqrstuu8b 34345i1D709vfamulimlGcq0qq3UvuUasvEaUVUrPmXD6q/nVSSp7pNDhCR9071IfIReU@@@@@@@@@@@@@@6789:;<=>?@@@@@@@ @@@@@@ !"#$%&'()*+,-./012345@@@@@./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىy1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:rOrpheanBeholderScryDoubt_0.../9ZzX7iSJNd21sU_0.../9Zzx22/wK52ZKGAx   test./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz            @@@@@@@@@@@@AAAA     $$  $$ " "@H@H@@@@  @@@@@ @ @ @  @@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@!   !!    !!! !!! !  ! !!!! !                                                                          $1$    $1$abcd0123$9Qcg8DyviekV3tDGMZynJ1$1$abcd0123$Xy01@# !./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzjxǷV$ p|G*0FFi؋D[\׾k"qyCI!%b@@&^ZQǪ/]DSء!7 EZgoٍ*L9Bqma"8 DKϩK`p(~'09ۙ|ĬVe)"DC*#9e[YÏ ̒}]o~O,CNS~:5*һӑ$5$rounds=rounds=%u$$5$%s%.*s$    $5$rounds=1234$abc0123456789$3VfDjPt05VHFn47C/ojFZ6KRPYrOjj1lLbH.dkF3bZ6$5$rounds=1234$abc0123456789$Xy01@# !./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzB/q7Dۥ9V[Y?^[$1U }r]tޱtiG$ -,oJt\vژ>QR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqx$6$$6$%s%.*s$*+,-./012 34 5 !6"7 8#$9%:;&'<(=>)$6$rounds=1234$abc0123456789$BCpt8zLrc/RcyuXmCDOE1ALqMXB2MH6n1g891HhFj8.w7LxGv.FTkqq6Vxc/km3Y0jE0j24jY5PIv/oOu6reg1$6$rounds=1234$abc0123456789$Xy01@# !./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz     `  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxy P ߼@0?YmÇ^?=``@]/_ ? ;_ ? ======?? ???o?????_/>PCx >??|/?8<~~~?_????>????7?o?????pG@??? {? Cd{_??C ꖪ^4@HPXdlt|alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|x< @@@I<` N 0 o @     `8p0/1? @ !`{B ???p@?C80?0?0`?? 8?`? DhL>4?0?? p?????{??        ( ) _0V90 1 x !"###$#%& -:.=/>0?1@1C2D3E4P5Q6R7S8T9Y:[;\e?f@hAiBj@kClDoBqErFuG}HIJKLLMNOPEW{|}XYZZZ[\\]^^^_`aabcdefghijklmn---PiQiRiSiTiUiViWiXiYiZi[i\i]i^i_iuvpqvwxyz{|}â̤ڦۦjn&*+Nbcdefmnop~}ύДѫҬӭ԰ձֲ y$9Oa8$(3&~*+]*(*?=EG***.265OK1(D/-)A)+*)C*'%L$ Tt&%@?p P0 `@8AVJdp~ Aߺ 0  ZuZ0ZZZZZZZuh0` (@  "'Qow|  $++++++++TVVVVVVVV+++++++++[VVVVVVVJVV1P1P1P1P1P1P1P1P$Py1P1P18P1P1P1P1P1P1P1PN1N NN$nN1&nQN$PN9S1P1P 1P1P1PS$P1\{\{\{\{\{y\{\{\-+IHx\{ +(***+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++*+++++++++++++F+%+UVVVVVUVV$+ѲѲѲ׃1P1P1P1P1P11P1P1P1P1P1P1P1P1PN1P1PN1P1P1P1P1P1P1P1*++++++++++++TVVVVVVVVVVVVTVVVVVVVVVVVV *+++++++++++++**++++++++++++++++++++++++++VVl++++++++++++++++++++++++++++++++++++++++++lA++VVVVVVVVVVVVVV,V+++++++++++++++++++++ l%%%%%%%%%%%%%%%%%%%%%%%%%Vz&%%%%%%%%%%%%%%%++OVV,+VV9++UVV++OVV,+VV7u[{\++OVV9++UVV++OVV,++VV2Wo~~-~9oW~~+++++++++++++$++++++++++*+++++VVVVV9*++++++++++++++++++++++++++++++++++++++++ɬ N1$P1P1P1P1P1P1P1P1P1P1P1P1P1P1P1P1PSG++++++++++++N1P1P1P1P1P1P1P $P1P1P1P1P+++++++++++y\{\{O{\{\{\{\{\{\{\{\{\{\-++y\{\-y*\'\{\{\{ \{\{O*++++++++++++++++++H*++++++++++++++++++++++++++++++++++HVVVVVVVV+++++++++++++UVVVVVVVVVVVV$+++++++++++VVVVVVVVVVVV$++++++++++++++++VVVVVVVVVVVVVVVVV*++++++++++VVVVVVVVVV*++++++++++VVVVVVVVVV+++++++++++UVVVVVVVVVVtouppertolower !"#$%&'()*+,-./01  `0 `0@,$ P!?@??x`?'{? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUV?= >!  @9#!  @  =` @0  \?@fd  ?@ x` @<;@!|<?D`0?3 ~f0@ !@ n`x& @\@ <0( y~m~`< /dev/nullm  1%[B/SETdQsNFe]+8l!5GVo {/F`n 8La9I^No error informationIllegal byte sequenceDomain errorResult not representableNot a ttyPermission deniedOperation not permittedNo such file or directoryNo such processFile existsValue too large for data typeNo space left on deviceOut of memoryResource busyInterrupted system callResource temporarily unavailableInvalid seekCross-device linkRead-only file systemDirectory not emptyConnection reset by peerOperation timed outConnection refusedHost is downHost is unreachableAddress in useBroken pipeI/O errorNo such device or addressBlock device requiredNo such deviceNot a directoryIs a directoryText file busyExec format errorInvalid argumentArgument list too longSymbolic link loopFilename too longToo many open files in systemNo file descriptors availableBad file descriptorNo child processBad addressFile too largeToo many linksNo locks availableResource deadlock would occurState not recoverablePrevious owner diedOperation canceledFunction not implementedNo message of desired typeIdentifier removedDevice not a streamNo data availableDevice timeoutOut of streams resourcesLink has been severedProtocol errorBad messageFile descriptor in bad stateNot a socketDestination address requiredMessage too largeProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedNot supportedProtocol family not supportedAddress family not supported by protocolAddress not availableNetwork is downNetwork unreachableConnection reset by networkConnection abortedNo buffer space availableSocket is connectedSocket not connectedCannot send after socket shutdownOperation already in progressOperation in progressStale file handleRemote I/O errorQuota exceededNo medium foundWrong medium typeMultihop attemptedRequired key not availableKey has expiredKey has been revokedKey was rejected by serviceAssertion failed: %s (%s: %s: %d) d'B@  !"#  !"#1.2.4Dynamic linker failed to allocate memory for error messageUnsupported request %d%s: /dev/ttyrbe/etc/shellsrb/bin/sh /bin/csh UTF-8%NLSPATHLANG_.@.@n!=1;Plural-Forms:nplurals=plural=  LC_CTYPELC_NUMERICLC_TIMELC_COLLATELC_MONETARYLC_MESSAGEShphhhphhh4h gji8ii8l`kkl`kkjHjjlkLkl\k      !"#$%&'()*+./01456789:;<=>ABCDEFGHJKLMPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #z     !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOQRSTUVWXYZ[\^_ !"#$%&'()*+,-./0123456789:@ABCDEFGHIJKLMNOPQRy~      !"#$%&'()*+,-./0123456789:?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[  @AVW`ajk             ! " & 0 9 :  !!""""")"H"a"d"e## #!%%% %%%%%$%,%4%<%P%Q%R%S%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%l%%%%%%%%%utf8charwchartucs2beucs2leutf16beutf16leucs4beutf32beucs4leutf32leasciiusasciiiso646iso646usutf16ucs4utf32ucs2iso88591latin1@iso88592(WN)T5UVn"\N_XEVo 6W\I#@d1 %c25C4e5MMYts7J#@t9 s:C<e=NY`iso88593(( )4G.\$,2-DUG/@\# (1$243D#4xd5e6܄7#,9褣:;#<|d=>%`iso88594($RT)T%H["+Sd_X5QH\5P#0cJ %c25 J4LTc5؜6t7#8cJ s:NJDTLc=>x`iso88595(D'tUguevܵҝw߁xWy硗zמ{|W}ᗟ~ןX" 2ؠBRXbrء&b"Hb&b*"iso88596(bihlp)tix|'Z"2ڨB)iso88597(LL($l)*@İ",--9.dQVeafq֙gh@iZjZk[lF[m݆[n[o\p G\q\r-\s=iso88598( (b)r*+",b-r. BIdFdJ.dN> eRNIeV^eZn%40iso885994E#4Tc5d6ܰ47#8c9褣:;#D?iso885910($H()5ATVrUP4QH)-6EdWsE P#0cJ %c25344TcMW؜6t7#8cJ s:;DLiso885911tis620(x):*z***:+z+++ ;,{,*,:,J;-Z{-j-z-;.{.骻..;/iso885913(\,(`l)ؤ*1",b-.9AcD %E RMU4CUc5gW%7AsD VE!ŔMV?iso885915latin9)$R)V*+",rb-s.G!/#0c1$243D#4Tc5d6t7#8c9褣:;#?iso885916(TPN$c\)V*n\Nr]l-s5.G!V\#@d1$243$4eSee6X7#@d9褣:;$<eTf>\?koi8r 3\7㜳;\w`-vc2. ̰r=> A =4E}4I+4M;ttPG-TWmXgu*`8` .`z JX`jhbha}^}7x^z^{|W^xg}g_~koi8u 3\7㜳;\w`-vc2. ̰r=> " MbE}4I4M;ttEmuTWmXu*`8` .`z JX`jhbha}^}7x^z^{|W^xg}g_~cp437 8S9ꬃ;CL1ɘc =ȳO>XÍ(2]3>D.J/.`-6:? 5CGsK+7s3tH }5NuVK=FtX\s\{ֳ}cpWqmm*#w-1|˰|K 26(cp850 8S9ꬃ;CL1ɘc =ȳO>X >`s ]3>D.J/.`-6:# 0DsKR7s3<0H }5N5)@2ȴԌ3\s\|C4TS?hM6t -"/r.rK.26(cp866 ߁xWy硗zמ{|W}ᗟ~ןX" 2ؠ`-6:? 5CGsK+7s3tH }5NuVK=FtX\s\{BRXbrء}Hו݊|K&26(ibm1047cp1047$`4 4D !d #t" (p$"`Db$Tb d&T "93N9# <&:;| *- 13L1Dc %|$243̀@Ѓ؄!dah.O,mqȡ.b )1uqy/l+R-b / *tA5{!DaH$ =3O=}(M8QH>?\3UXqYh! 5H3M50 4` 806d'ASCIIC.^[yY]^[nN]yesnoSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %T %Y%m/%d/%y%H:%M:%S%I:%M:%S %p%m/%d/%y0123456789%a %b %e %T %Y%H:%M:%SC.UTF-8LC_ALLPOSIXMUSL_LOCPATHLC_CTYPELC_NUMERICLC_TIMELC_COLLATELC_MONETARYLC_MESSAGES.xx$x8xDxLxXx`xhxpxxxxx|&====|&=!><+-*%/%*.*fmessages          $*2?HTf$TH2Te $ HT     zpnND)'W4b<CAQc޻a$n:BMI. ђ)>5.Dp&_~A99S9_(;/Z mm6~' OF?f_-u'{=9Rk_]V0F{kϼ 6a^e_h@؀Ms'1Vs`{k k=/>*u4@I?3!h?1r{@II?IۿIIۿ@@@3.17i3"!h33!h>c8?I?{^?@?=|%> >G>LʘK =Q=>T>>h;3=? W=1>~B+C8C"eByWA("?1V;k>uԶ9 I;=*c>˻3ֿ577'Ŭ8ѷ:o<# =?A BDzF@GPIt$K@TxBr7?;?1q:0=h@_lACDS2)D\CTX4!=*?ĿAgATqABC D1lEg_EgEEW?Y1h=p@VB*|C*C&BEF>G]G ŧR-y=@CDgDKC#ƪEH 2IDIM3Yȧi=A4 =&/4!l8eD(w^ESBrE]D3}O[gcd>[5BDFxGBmFX&œyx67kī3#GC!e7EHI/I"ȏH,=9':=6A}BChFB[AՐ3N=@ACAA@ZMB *MCaDD^Bϓl1O =@{B zEB*BB<|BmUDwٱEJ#E%D-h3?=@ٰ#B؝DhD-Bj,Ed.G\5GfF=ASCEr+ESBj,BmU-h3?B *M1O A}3NC!e7BB>}OADT?2>3UW7.6:l=-YV~1dF59BH1-159TdK<(jF@Bq]xl>[ ?7Ӄ9gg:T;~==#?8<,u8E:4;=n<>f9{k:v;=MG>^9: 0;<(=Z':fg;qw<7=>!<1R=<[<^>jux?zK?:?";R=r?D@9-@.8g:5<@>>z>\$Z6׽:K0n?8?-;@:[=:\:P ;6 a=>L>x&>>?*5T'>`> KG}} Q𱖰DyCȦskhjp{љ:eĔ0k.u YTdĉ%V+ya؂PɁE€@%Gs4G''Cz }4ٳ{Hҭђ{i[QJHJOXdtŇĝ÷%s %n%s%s%.0d%s: %.*s/dev/log2>/dev/nulleval "printf %s\\\\0 x $1 $2"-csh/bin/shl\|/dev/shm/      %.2X:%.2XInvalid flagsName does not resolveTry againNon-recoverable errorName has no usable addressUnrecognized address family or invalid lengthUnrecognized socket typeUnrecognized serviceUnknown errorOut of memorySystem errorOverflowUnknown error %d.%d.%d.%d.in-addr.arpaip6.arpa/etc/hosts/etc/services/udp/tcp0123456789abcdeftcpudp%s%s%s Host not foundTry againNon-recoverable errorAddress not availableUnknown error%d.%d.%d.%d%x:%x:%x:%x:%x:%x:%x:%x%x:%x:%x:%x:%x:%x:%d.%d.%d.%d:0 2 #   (x   @ ipicmpigmpggpipencapsttcpegp pupudphmpxns-idprdpiso-tp4$xtp%ddp&idpr-cmtp)ipv6+ipv6-route,ipv6-frag-idrp.rsvp/gre2esp3ah9skip:ipv6-icmp;ipv6-nonxtl>>>>>>>>>>>>>>>>?%*s#+-%%%s%s%s%s%s*.*%c%cGTGGGG\GTGLjLLLjjjjj                  %.*s%.0d%s%c%%lln%*T@THPPMTPhhhlLll        ( ) _0%.*e%.*f000000000000000%.*g     @Unknown signalHangupInterruptQuitIllegal instructionTrace/breakpoint trapAbortedBus errorArithmetic exceptionKilledUser defined signal 1Segmentation faultUser defined signal 2Broken pipeAlarm clockTerminatedEmulator trapChild process statusContinuedStopped (signal)StoppedStopped (tty input)Stopped (tty output)Urgent I/O conditionCPU time limit exceededFile size limit exceededVirtual timer expiredProfiling timer expiredWindow changedI/O possiblePower failureBad system callRT32RT33RT34RT35RT36RT37RT38RT39RT40RT41RT42RT43RT44RT45RT46RT47RT48RT49RT50RT51RT52RT53RT54RT55RT56RT57RT58RT59RT60RT61RT62RT63RT64RT65RT66RT67RT68RT69RT70RT71RT72RT73RT74RT75RT76RT77RT78RT79RT80RT81RT82RT83RT84RT85RT86RT87RT88RT89RT90RT91RT92RT93RT94RT95RT96RT97RT98RT99RT100RT101RT102RT103RT104RT105RT106RT107RT108RT109RT110RT111RT112RT113RT114RT115RT116RT117RT118RT119RT120RT121RT122RT123RT124RT125RT126RT127RT128    /proc/self/task/%d/comm/dev/shm/tmp-%d(ހMȀv4~@\gUTZ/etc/TZ/etc/localtimeUTCGMTTZif/usr/share/zoneinfo//share/zoneinfo//etc/zoneinfo/UTC%.3s %.3s%3d %.2d:%.2d:%.2d %d __vdso_clock_gettime64LINUX_2.6__vdso_clock_gettimeDATEMSK%m/%d/%y%Y-%m-%d%H:%M%H:%M:%S+%lld%+.4ld%lld%*lld%0*lld[TVVVVVVVVVVVVVVVVVVVVVVVVVVVVWWVxV[WX0X8VVVXVVVVY YLYhYYYZ Zd[$VVVVVVVV[WWTVWVVXlVVXXVXV[YYTYtVZVXZZ`\\\\\\\\\\\\\\\\\\\\\\\\\\\]^D^|^\\\^_\\\_\\\\```a\a``\\\\\\\]^D^X^^\\^D\_\\_]\_\`t\]\\```LOGNAMEreaddir64_rreaddir_rError relocating %s: %s: symbol not foundError relocating %s: %s: initial-exec TLS resolves to dynamic definition in %sError relocating %s: unsupported relocation type %dError allocating constructor queue: %m State of %s is inconsistent due to multithreaded fork Error preparing lazy relocation for %s: %m: %.*s/%sError relocating %s: RELRO protection failed: %m %s => %s (%p) $ORIGIN${ORIGIN}/proc/self/exe%.*s/etc/ld-musl-mips-sf.path/lib:/usr/local/lib:/usr/lib__libc_start_mainstdinlibc.soError loading dependencies for %sError loading shared library %s: %m (needed by %s)__dls2b__dls3 [args]LD_LIBRARY_PATHLD_PRELOAD/proc/lddlistlibrary-pathpreloadargv0musl libc (mips-sf) Version %s Dynamic Program Loader Usage: %s [options] [--] pathname%s %s: cannot load %s: %s %s: %s: Not a valid dynamic program %s (%p) linux-gate.so.1%s: Error getting %zu bytes thread-local storage: %m mallocaligned_allocLibrary %s is not already loadedError loading shared library %s: %mCannot dlopen while program is exiting.Error recording dependencies for %sInvalid library handle %pSymbol not found: %s_time64__%.*s%s%sc.pthread.rt.m.dl.util.xnet.aio_cancelaio_erroraio_fsyncaio_readaio_returnaio_suspendaio_writealphasortcreatfallocatefgetposfopenfreopenfseekofsetposfstatfstatatfstatfsfstatvfsftelloftruncateftwgetdentsgetrlimitglobglobfreelio_listiolockflseeklstatmkostempmkostempsmkstempmkstempsmmapnftwopenopenatposix_fadviseposix_fallocatepreadpreadvprlimitpwritepwritevreaddirscandirsendfilesetrlimitstatstatfsstatvfstmpfiletruncateversionsort__fxstat__fxstatat__lxstat__xstat;(p@T`h|zR| (,T@@T t t t  L `C.UTF-8 \ h t  4  4  P L Ht n r f a e w W s S d D h @ + +< +D 25x5` x 2485` 265` " m XQ-˵F1)0p[ ]xP)YثHhlVͷw?p+Aot-/z v^ @p,o,AWXtJdS<_m (C9P7RW @  +Hx - 8T{ V`W b8  PdW  XD XtT5{Y4TKiK4LK |W\  tIDU\dS _`3Q | h)0$WZL`0Va u|`bPt++p PAL l$\ H٠ɴ`tʈDks0QU`dld<LpT0<2P+HϜ4rU( (P (TBɼDpT(h|,lH00T00011<1`11222@33D5055677h734T5 :@*:$88H8|;; ;x$X?x>@>x=4'A|  \ h aI` at( EMOPKJ<Pp S\ Q@TRLA\\ \$[\\\,L HD ,P8\%t zP (D6V lUdxP~P,lV@#=>=l9;NKm(al)8c 8d rː0# L$xvPdH,tlPl D ` h Dd+`p-07 @&#| <  u@ 8st|t*799FH0Wl@qix@L0l:@W3[T 56xt9D9 ,hՄ 09(9d php,  D"2CT'Gx6Wdrha 78t\ 8$8 |H HΈ ~(` h 0  $\dxd)(Wl LHj,Xj0TeX1| T79<,4`I<@<\BhM`_$#=Zx  hxx x@jkO,hwH pHv<T8 h, (͜/PPt, hpĜ$ʜɼ@d($ g)8d;@YH/=THlbT G,GH@HMRRU|RHN avFl F ^ P \<exf4eedv6D,$l;@` P(h$%4x485x5`2o8,o   7t|=8a|o`0cDtaa.1d$UH]^8_ͤD F0Pdbldla @WT70q/o\( (0P`(+/D-`*<76+601t$9@e:e0bO m M>@a0\mNM>@e:e @e:a@e0\ mNM>@e:e0!Og@e?e _`n"𐙄@e /proc/sys/net/ipv6/conf/$device/hop_limit [ -n "$RA_MTU" ] && [ "$RA_MTU" -ge 1280 ] && echo "$RA_MTU" > /proc/sys/net/ipv6/conf/$device/mtu 2>/dev/null [ -n "$RA_REACHABLE" ] && [ "$RA_REACHABLE" -gt 0 ] && echo "$RA_REACHABLE" > /proc/sys/net/ipv6/neigh/$device/base_reachable_time_ms [ -n "$RA_RETRANSMIT" ] && [ "$RA_RETRANSMIT" -gt 0 ] && echo "$RA_RETRANSMIT" > /proc/sys/net/ipv6/neigh/$device/retrans_time_ms proto_init_update "*" 1 # Merge RA-DNS for radns in $RA_DNS; do local duplicate=0 for dns in $RDNSS; do [ "$radns" = "$dns" ] && duplicate=1 done [ "$duplicate" = 0 ] && RDNSS="$RDNSS $radns" done for dns in $RDNSS; do proto_add_dns_server "$dns" done for radomain in $RA_DOMAINS; do local duplicate=0 for domain in $DOMAINS; do [ "$radomain" = "$domain" ] && duplicate=1 done [ "$duplicate" = 0 ] && DOMAINS="$DOMAINS $radomain" done for domain in $DOMAINS; do proto_add_dns_search "$domain" done for prefix in $PREFIXES; do proto_add_ipv6_prefix "$prefix" prefsig="$prefsig ${prefix%%,*}" local entry="${prefix#*/}" entry="${entry#*,}" entry="${entry#*,}" local valid="${entry%%,*}" if [ -z "$RA_ADDRESSES" -a -z "$RA_ROUTES" -a \ -z "$RA_DNS" -a "$FAKE_ROUTES" = 1 ]; then RA_ROUTES="::/0,$SERVER,$valid,4096" fi done for prefix in $USERPREFIX; do proto_add_ipv6_prefix "$prefix" done # Merge addresses for entry in $RA_ADDRESSES; do local duplicate=0 local addr="${entry%%/*}" for dentry in $ADDRESSES; do local daddr="${dentry%%/*}" [ "$addr" = "$daddr" ] && duplicate=1 done [ "$duplicate" = "0" ] && ADDRESSES="$ADDRESSES $entry" done for entry in $ADDRESSES; do local addr="${entry%%/*}" entry="${entry#*/}" local mask="${entry%%,*}" entry="${entry#*,}" local preferred="${entry%%,*}" entry="${entry#*,}" local valid="${entry%%,*}" proto_add_ipv6_address "$addr" "$mask" "$preferred" "$valid" 1 addrsig="$addrsig $addr/$mask" if [ -z "$RA_ADDRESSES" -a -z "$RA_ROUTES" -a \ -z "$RA_DNS" -a "$FAKE_ROUTES" = 1 ]; then RA_ROUTES="::/0,$SERVER,$valid,4096" fi # RFC 7278 if [ "$mask" -eq 64 -a -z "$PREFIXES" -a -n "$EXTENDPREFIX" ]; then proto_add_ipv6_prefix "$addr/$mask,$preferred,$valid" local raroutes="" for route in $RA_ROUTES; do local prefix="${route%%/*}" local entry="${route#*/}" local pmask="${entry%%,*}" entry="${entry#*,}" local gw="${entry%%,*}" [ -z "$gw" -a "$mask" = "$pmask" ] && { case "$addr" in "${prefix%*::}"*) continue;; esac } raroutes="$raroutes $route" done RA_ROUTES="$raroutes" fi done for entry in $RA_ROUTES; do local duplicate=$NOSOURCEFILTER local addr="${entry%%/*}" entry="${entry#*/}" local mask="${entry%%,*}" entry="${entry#*,}" local gw="${entry%%,*}" entry="${entry#*,}" local valid="${entry%%,*}" entry="${entry#*,}" local metric="${entry%%,*}" for xentry in $RA_ROUTES; do local xprefix="${xentry%%,*}" xentry="${xentry#*,}" local xgw="${xentry%%,*}" [ -n "$gw" -a -z "$xgw" -a "$addr/$mask" = "$xprefix" ] && duplicate=1 done if [ -z "$gw" -o "$duplicate" = 1 ]; then proto_add_ipv6_route "$addr" "$mask" "$gw" "$metric" "$valid" else for prefix in $PREFIXES $ADDRESSES; do local paddr="${prefix%%,*}" proto_add_ipv6_route "$addr" "$mask" "$gw" "$metric" "$valid" "$paddr" done fi done proto_add_data [ -n "$CER" ] && json_add_string cer "$CER" [ -n "$PASSTHRU" ] && json_add_string passthru "$PASSTHRU" [ -n "$ZONE" ] && json_add_string zone "$ZONE" proto_close_data proto_send_update "$INTERFACE" MAPTYPE="" MAPRULE="" if [ -n "$MAPE" -a -f /lib/netifd/proto/map.sh ]; then MAPTYPE="map-e" MAPRULE="$MAPE" elif [ -n "$MAPT" -a -f /lib/netifd/proto/map.sh -a -f /proc/net/nat46/control ]; then MAPTYPE="map-t" MAPRULE="$MAPT" elif [ -n "$LW4O6" -a -f /lib/netifd/proto/map.sh ]; then MAPTYPE="lw4o6" MAPRULE="$LW4O6" fi [ -n "$ZONE" ] || ZONE=$(fw3 -q network $INTERFACE 2>/dev/null) if [ "$IFACE_MAP" != 0 -a -n "$MAPTYPE" -a -n "$MAPRULE" ]; then [ -z "$IFACE_MAP" -o "$IFACE_MAP" = 1 ] && IFACE_MAP=${INTERFACE}_4 json_init json_add_string name "$IFACE_MAP" json_add_string ifname "@$INTERFACE" json_add_string proto map json_add_string type "$MAPTYPE" json_add_string _prefsig "$prefsig" [ "$MAPTYPE" = lw4o6 ] && json_add_string _addrsig "$addrsig" json_add_string rule "$MAPRULE" json_add_string tunlink "$INTERFACE" [ -n "$ZONE_MAP" ] || ZONE_MAP=$ZONE [ -n "$ZONE_MAP" ] && json_add_string zone "$ZONE_MAP" [ -n "$ENCAPLIMIT_MAP" ] && json_add_string encaplimit "$ENCAPLIMIT_MAP" [ -n "$IFACE_MAP_DELEGATE" ] && json_add_boolean delegate "$IFACE_MAP_DELEGATE" json_close_object ubus call network add_dynamic "$(json_dump)" elif [ -n "$AFTR" -a "$IFACE_DSLITE" != 0 -a -f /lib/netifd/proto/dslite.sh ]; then [ -z "$IFACE_DSLITE" -o "$IFACE_DSLITE" = 1 ] && IFACE_DSLITE=${INTERFACE}_4 json_init json_add_string name "$IFACE_DSLITE" json_add_string ifname "@$INTERFACE" json_add_string proto "dslite" json_add_string peeraddr "$AFTR" json_add_string tunlink "$INTERFACE" [ -n "$ZONE_DSLITE" ] || ZONE_DSLITE=$ZONE [ -n "$ZONE_DSLITE" ] && json_add_string zone "$ZONE_DSLITE" [ -n "$ENCAPLIMIT_DSLITE" ] && json_add_string encaplimit "$ENCAPLIMIT_DSLITE" [ -n "$IFACE_DSLITE_DELEGATE" ] && json_add_boolean delegate "$IFACE_DSLITE_DELEGATE" json_close_object ubus call network add_dynamic "$(json_dump)" elif [ "$IFACE_464XLAT" != 0 -a -f /lib/netifd/proto/464xlat.sh ]; then [ -z "$IFACE_464XLAT" -o "$IFACE_464XLAT" = 1 ] && IFACE_464XLAT=${INTERFACE}_4 json_init json_add_string name "$IFACE_464XLAT" json_add_string ifname "@$INTERFACE" json_add_string proto "464xlat" json_add_string tunlink "$INTERFACE" json_add_string _addrsig "$addrsig" [ -n "$ZONE_464XLAT" ] || ZONE_464XLAT=$ZONE [ -n "$ZONE_464XLAT" ] && json_add_string zone "$ZONE_464XLAT" [ -n "$IFACE_464XLAT_DELEGATE" ] && json_add_boolean delegate "$IFACE_464XLAT_DELEGATE" json_close_object ubus call network add_dynamic "$(json_dump)" fi # TODO: $SNTP_IP $SIP_IP $SNTP_FQDN $SIP_DOMAIN } teardown_interface() { proto_init_update "*" 0 proto_send_update "$INTERFACE" } case "$2" in bound) teardown_interface "$1" setup_interface "$1" ;; informed|updated|rebound) setup_interface "$1" ;; ra-updated) [ -n "$ADDRESSES$RA_ADDRESSES$PREFIXES$USERPREFIX" ] && setup_interface "$1" ;; started|stopped|unbound) teardown_interface "$1" ;; esac # user rules [ -f /etc/odhcp6c.user ] && . /etc/odhcp6c.user "$@" for f in /etc/odhcp6c.user.d/*; do [ -f "$f" ] && (. "$f" "$@") done exit 0 07070100E6779F000081A40000000000000000000000016524747F0000C369000000080000000100000000000000000000001600000000lib/netifd/hostapd.sh. /lib/functions/network.sh . /lib/functions.sh wpa_supplicant_add_rate() { local var="$1" local val="$(($2 / 1000))" local sub="$((($2 / 100) % 10))" append $var "$val" "," [ $sub -gt 0 ] && append $var "." } hostapd_add_rate() { local var="$1" local val="$(($2 / 100))" append $var "$val" " " } hostapd_append_wep_key() { local var="$1" wep_keyidx=0 set_default key 1 case "$key" in [1234]) for idx in 1 2 3 4; do local zidx zidx="$(($idx - 1))" json_get_var ckey "key${idx}" [ -n "$ckey" ] && \ append $var "wep_key${zidx}=$(prepare_key_wep "$ckey")" "$N$T" done wep_keyidx="$((key - 1))" ;; *) append $var "wep_key0=$(prepare_key_wep "$key")" "$N$T" ;; esac } hostapd_append_wpa_key_mgmt() { local auth_type_l="$(echo $auth_type | tr 'a-z' 'A-Z')" case "$auth_type" in psk|eap) append wpa_key_mgmt "WPA-$auth_type_l" [ "${ieee80211r:-0}" -gt 0 ] && append wpa_key_mgmt "FT-${auth_type_l}" [ "${ieee80211w:-0}" -gt 0 ] && append wpa_key_mgmt "WPA-${auth_type_l}-SHA256" ;; eap192) append wpa_key_mgmt "WPA-EAP-SUITE-B-192" [ "${ieee80211r:-0}" -gt 0 ] && append wpa_key_mgmt "FT-EAP-SHA384" ;; eap-eap2) append wpa_key_mgmt "WPA-EAP" append wpa_key_mgmt "WPA-EAP-SHA256" [ "${ieee80211r:-0}" -gt 0 ] && append wpa_key_mgmt "FT-EAP" ;; eap2) [ "${ieee80211r:-0}" -gt 0 ] && append wpa_key_mgmt "FT-EAP" append wpa_key_mgmt "WPA-EAP-SHA256" ;; sae) append wpa_key_mgmt "SAE" [ "${ieee80211r:-0}" -gt 0 ] && append wpa_key_mgmt "FT-SAE" ;; psk-sae) append wpa_key_mgmt "WPA-PSK" [ "${ieee80211r:-0}" -gt 0 ] && append wpa_key_mgmt "FT-PSK" [ "${ieee80211w:-0}" -gt 0 ] && append wpa_key_mgmt "WPA-PSK-SHA256" append wpa_key_mgmt "SAE" [ "${ieee80211r:-0}" -gt 0 ] && append wpa_key_mgmt "FT-SAE" ;; owe) append wpa_key_mgmt "OWE" ;; esac [ "$fils" -gt 0 ] && { case "$auth_type" in eap-192) append wpa_key_mgmt FILS-SHA384 [ "${ieee80211r:-0}" -gt 0 ] && append wpa_key_mgmt FT-FILS-SHA384 ;; eap*) append wpa_key_mgmt FILS-SHA256 [ "${ieee80211r:-0}" -gt 0 ] && append wpa_key_mgmt FT-FILS-SHA256 ;; esac } [ "$auth_osen" = "1" ] && append wpa_key_mgmt "OSEN" } hostapd_add_log_config() { config_add_boolean \ log_80211 \ log_8021x \ log_radius \ log_wpa \ log_driver \ log_iapp \ log_mlme config_add_int log_level } hostapd_common_add_device_config() { config_add_array basic_rate config_add_array supported_rates config_add_string beacon_rate config_add_string country country3 config_add_boolean country_ie doth config_add_boolean spectrum_mgmt_required config_add_int local_pwr_constraint config_add_string require_mode config_add_boolean legacy_rates config_add_int cell_density config_add_int rts_threshold config_add_int rssi_reject_assoc_rssi config_add_int rssi_ignore_probe_request config_add_int maxassoc config_add_string acs_chan_bias config_add_array hostapd_options config_add_int airtime_mode config_add_int mbssid hostapd_add_log_config } hostapd_prepare_device_config() { local config="$1" local driver="$2" local base_cfg= json_get_vars country country3 country_ie beacon_int:100 doth require_mode legacy_rates \ acs_chan_bias local_pwr_constraint spectrum_mgmt_required airtime_mode cell_density \ rts_threshold beacon_rate rssi_reject_assoc_rssi rssi_ignore_probe_request maxassoc \ mbssid:0 hostapd_set_log_options base_cfg set_default country_ie 1 set_default spectrum_mgmt_required 0 set_default doth 1 set_default legacy_rates 0 set_default airtime_mode 0 set_default cell_density 0 [ -n "$country" ] && { append base_cfg "country_code=$country" "$N" [ -n "$country3" ] && append base_cfg "country3=$country3" "$N" [ "$country_ie" -gt 0 ] && { append base_cfg "ieee80211d=1" "$N" [ -n "$local_pwr_constraint" ] && append base_cfg "local_pwr_constraint=$local_pwr_constraint" "$N" [ "$spectrum_mgmt_required" -gt 0 ] && append base_cfg "spectrum_mgmt_required=$spectrum_mgmt_required" "$N" } [ "$hwmode" = "a" -a "$doth" -gt 0 ] && append base_cfg "ieee80211h=1" "$N" } [ -n "$acs_chan_bias" ] && append base_cfg "acs_chan_bias=$acs_chan_bias" "$N" local brlist= br json_get_values basic_rate_list basic_rate local rlist= r json_get_values rate_list supported_rates [ -n "$hwmode" ] && append base_cfg "hw_mode=$hwmode" "$N" if [ "$hwmode" = "g" ] || [ "$hwmode" = "a" ]; then [ -n "$require_mode" ] && legacy_rates=0 case "$require_mode" in n) append base_cfg "require_ht=1" "$N";; ac) append base_cfg "require_vht=1" "$N";; esac fi case "$hwmode" in b) if [ "$cell_density" -eq 1 ]; then set_default rate_list "5500 11000" set_default basic_rate_list "5500 11000" elif [ "$cell_density" -ge 2 ]; then set_default rate_list "11000" set_default basic_rate_list "11000" fi ;; g) if [ "$cell_density" -eq 0 ] || [ "$cell_density" -eq 1 ]; then if [ "$legacy_rates" -eq 0 ]; then set_default rate_list "6000 9000 12000 18000 24000 36000 48000 54000" set_default basic_rate_list "6000 12000 24000" elif [ "$cell_density" -eq 1 ]; then set_default rate_list "5500 6000 9000 11000 12000 18000 24000 36000 48000 54000" set_default basic_rate_list "5500 11000" fi elif [ "$cell_density" -ge 3 ] && [ "$legacy_rates" -ne 0 ] || [ "$cell_density" -eq 2 ]; then if [ "$legacy_rates" -eq 0 ]; then set_default rate_list "12000 18000 24000 36000 48000 54000" set_default basic_rate_list "12000 24000" else set_default rate_list "11000 12000 18000 24000 36000 48000 54000" set_default basic_rate_list "11000" fi elif [ "$cell_density" -ge 3 ]; then set_default rate_list "24000 36000 48000 54000" set_default basic_rate_list "24000" fi ;; a) if [ "$cell_density" -eq 1 ]; then set_default rate_list "6000 9000 12000 18000 24000 36000 48000 54000" set_default basic_rate_list "6000 12000 24000" elif [ "$cell_density" -eq 2 ]; then set_default rate_list "12000 18000 24000 36000 48000 54000" set_default basic_rate_list "12000 24000" elif [ "$cell_density" -ge 3 ]; then set_default rate_list "24000 36000 48000 54000" set_default basic_rate_list "24000" fi ;; esac for r in $rate_list; do hostapd_add_rate rlist "$r" done for br in $basic_rate_list; do hostapd_add_rate brlist "$br" done [ -n "$rssi_reject_assoc_rssi" ] && append base_cfg "rssi_reject_assoc_rssi=$rssi_reject_assoc_rssi" "$N" [ -n "$rssi_ignore_probe_request" ] && append base_cfg "rssi_ignore_probe_request=$rssi_ignore_probe_request" "$N" [ -n "$beacon_rate" ] && append base_cfg "beacon_rate=$beacon_rate" "$N" [ -n "$rlist" ] && append base_cfg "supported_rates=$rlist" "$N" [ -n "$brlist" ] && append base_cfg "basic_rates=$brlist" "$N" append base_cfg "beacon_int=$beacon_int" "$N" [ -n "$rts_threshold" ] && append base_cfg "rts_threshold=$rts_threshold" "$N" [ "$airtime_mode" -gt 0 ] && append base_cfg "airtime_mode=$airtime_mode" "$N" [ -n "$maxassoc" ] && append base_cfg "iface_max_num_sta=$maxassoc" "$N" [ "$mbssid" -gt 0 ] && [ "$mbssid" -le 2 ] && append base_cfg "mbssid=$mbssid" "$N" json_get_values opts hostapd_options for val in $opts; do append base_cfg "$val" "$N" done cat > "$config" <