Z Ӱ(1)Oo/Oo   P!:0@" Р@HpG K`"_B_`"d"_B_d")K"_) pG6_ *:%+/+  pG++R#@@@@@@@@@@@@@@@@@@ pG(;+ pG pG pG pG0KFV_" K%\(:BɄ02:@Kh+opGhC`h`+*FpG pGFhhXh_h@CFh#hhQh@ CS` Fh"hhKh@#K` 8FF(F> `( o 8 pG!hiDR F3BшBH^o$h!D @+8F.HMz+ѓzzPzC#CC+'H/-_>O/@-AFHFHH%hO4BؽAH T<+@F(F1F8F?H!h8F8 HT, KS" H54K@q@@@w@@@\;@@'8 (-MFFF -J FR ,I,H +K@@F'K PU= P , M+ +x3+p0ƲBزEK:FS$0IH030 K:FS$0 IHK:FS$0I H2FI H\;@I@t@N@-@@u@t@cu@u@L"~ I H I H" I H@IH|-@H@u@v@9v@rv@-MT(єHe K(LOFKHdOHŸdOOFOGF %%p ''JN`JcIL4 OO `aOabb4PeMOv%FfOfOqOGF5@8eTU@\`d`lD L pPPpPoOO PlM=FP %%iMO PgM OO PdM!'P@%O txtt|`[Nlu@``@ذp PP@@A@LAOtADLа`` A@6$@+`$A8L8I(P찃` A(,q -ITP,I\QX*Id`)It!hOl%Ipt@@ @@@@$@<@@@̦@d@@Ԥ@@`@ܢ@@D@p@0@@@D@ؑ@|@@X@l@č@\@Њ@@@@@@( $$$*9 pG))9  pG)9  pG)9  pG)))9  pGa)9 pG+ pG pG pG pG pG_KJ""_Br_ "pG@B J)O $ $X_#@ C_P  KF6_*  ` sIHr H@s@(7F-F(FF F0C+*FIHO$$H@s@-M)O(##EFFSE- (OEO%C_ %KS;hPFWYFFFQFFXFh#"FIHG<O  7#*ѻ%J]. "F I H#"FIG<H\C@3C5H@v@@v@FFFe(F2F4I4H B //,C,!#F< ++H]L,3F"F%I'H!0F@!4,9FHOs$%IrX_"C_uP ) O@s $%#FIrX_"C_tPqrX_"RC_sPG@r@Vs@r@s@ @ -M)FFFF@F(F;9(F)FH( 1-$$$cp, ٣J_# @ C_2:5! F]PK2_O CC_J! F2H(ѺU! F=(щK! FP4(рF:F)F F(1F F&(! F (Ѹ  h uK2_F#C! F (! F(! F(Нzx, eI2_" @#_2! F(:F)F F(}1F F(v-! F(m ! F(f!! F(_"! F(XBp#! F(M% OO O @FQF(7! F(0:F)F F_((1F F(!! Fy(! Fr(@F j( ! ! Fa(:F)F F1(1F FR(! FK(! FD(! F=(ޮJ`_#=@ C_`4π@@(:*! F(:F ! F(1F F(,! F(-! F(.! FMF F*F M!HBX%! @-EFF%OB%OB%O4B* W(F* E5!(нW(F* 05!(X(F'/5!(-MFFp4FFFE ӸG$! MuPF#h#i*F &*FO(H (F!(ѻ +!(F3(  4!(F)(9F0FN(|r@H~H{Hx:0H$ F F(ѝ@6BH3F(ѝkF(HI@+@h@/@y@@ Hu Yt@ pG pGQ(  IH]  UH@s@(8F 6%3B,8,IH=%!%(,(F8G@Kr@` `pG)8F F JDX]8J M@@(F($ FhFchxPCX_T@,@T@_P pOzp 0XC -MhFkN p (23FPJ0_ 8Fh]EЦBHg ~@F [+   pG-MF F=(!FH IO$ Q5p%y,B qFBF[ 0 FG5{@@Ԩ@@8(K\ pGyG@ K8"_ C;+I!ՐF IH?F G@p@(FFIH+ KS mH@@@KL hA K&_cX#`ZSIH h$@@T@Y@K<_ pGп_@B@!K`JS_C@BpG@bп_JK$1_$1K6_# +01_###cC 3C s_01pG@spG8F F(0?"3@SB#@BؿO)F F8@>?DXРРT440 S PР 8/@@@ @F=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG-@:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡ pGpGH@j* e@C?  pGsF FF4 jF IF0 I H] p2F)FF!FH|@|@|@pF FF*!"H03F*F!Fp@opl}@"FT!HH!#"FF H !h JB H "!FdhFBH p}@w}@4A}@}@ L#h;hF0+ #` hHH#@$}@L}@H"*! HkX !# JF8@HʿoH@he@l}@$@e@v@-AFFDLFDHl " `F(V?H>H\=HY*ЋB#O ah0F95FKBchBo#hOS 0Y3ѺF@FQh( h+  (D"9F0G#F#h8F#h+Dh+#h+D30F`B+@FQhn0 h+DZhF;XD"9F0G(#h8F[D`#h[Dh+?v#h[D3`k(Fs#hS 0++FѢhchB?`UF#h-^Q#h@F^mp`#h8F^g` h(DCh+?Gh+?Ch03`h h"(D9F0Gh"#h+D`O2#hZQhD`s F#h+D3 `##@-E&F F3FF8"oK`  ;F"1F@FG("KO0` O2#h-ZQhD`@-MF;lFO # FF{`"KP4F "}K` AF*Fc;`#cUk;lcRFylxh3h{չ 7F3h+0Fh@01F8Op1(k+Lc;`#x +L +J#+K%F; [E;hB+x+=Ѹ{hVMX;lETH1FkI!h(aPF(ѕ )уBғ  239hBx)ѭ h#F" De,FF0UF=+  0 [EO+p;l[1F Fk5O+pUF Fzh9l(\)Yx)+F Fzh9l((Fkx+л=ЛE#RF+pSFF YE#p#x+?;l+ѻk`#h+RRF!FHK@i@i@Ri@j L;:۲T#0 ЋFL"WB{:D3LD?C@۲T#0B V[h@ŲT%P%T  ŲT%P%T  +@CC-AvBF FO/0F^)Ff#"$mARA,u ۼBu ӧBv ?f@[CsRdS DtOU8F)F(FH$(i@FIFx3\pGTI@F8CH#DBF#Sp Fx;A\TI@2+ͿKZ"2ؿTpGe@2+ϿKZ"̿2pG@hZ`xt("m(S(d(0(pGn+ pG pGOp`pGOPpGOPpG pG pGp FFF!"pRa D23D2p-MF k FFF%9])9K+8]meN3hBF8FSFk;FxDBF3`;Yx8FSFk!D;Fx(%(F0h;xB[xq*FD@D(3h+D3`45hSFBF8Fk5`;[xDSFBF!F8FSFBF!F8FSFBF8FkyF(SFBF!F8F;[xSFBF8FkdF(SFBF!F8F3hSE =I\ 3hSE 8I\33`4H3hSE 1I\3hSEx2hREs!;x[xP3;DBhϬE22`y12hRE[!;x[xP3;DBϬE?L15hm 4-@5h ]B]A;Zx3hCDK204;Zx3h [2 CDK`"FHTI@w@-MFFO F;F(FJ Yx;F(FJ1D(F-MFFFO FCF:F(FKhYxCF:F(FK1D(8 F!2+ʿKCU28h@ FA\F)Fѯ]+;UDix]D!R= F")F6fU2[+˿Kd2cph@-MF FFF'2+hZ*`x.*.#**g+`b+hx)@!p$ )P!UD@sC@sC@sC@D@)E@AE@AE@sC@sC@YD@\*q?*̀[*Zxb^*aO 3+`+hxgK2^*$|*/9F F\"AF F#02+˿YK2Sp#U+`! FW !!bZ*`x\) ])YF FEQFB (F\  FC F>FO (FbEOF F!!QF<2 F !bQF)F +hZ*`x)+!K2! FQF/+`9F F+K**Yx ?) "3+`1F F?)3 "+` " ""XF(+h FZ*`xK@K@h@K@K@7% RRRRR x!^SBSA 2)FFxx+! Fm F!!@ 0 F-MF! BFFFFBFF F!F+FBF8FF6B,&F B;?+pG DDB;?+FxF2,;+/*FK;,FDB K ,FɲxFBpG*FpGFFx3)pG8F F+F)BНB 88F00PF$ F8)FBFًB F FFDB  F9DB xO3DɲB FKBFh hOzrF33 hFh "]iFhRFH]h@ pGFOzs!pFKM!2[BRO(!EE)D @0 p4ׂCpFF0F F$EbEBAppFNB%F(5F(Fdp 2#FFFQ #0 h]By۲C +40"W"hDL` p#q0+F `hZ`ppGF-MFFFF %)(FhGFFsxO -+ x660+;O0O * ! 30 ;0 *"l+;/`i+*q %+o+лFrc+fd+T+* +`-#RB 0p;ڲ*+R#J@J@J@J@J@qJ@J@J@J@T;;+hZ*`0"p#+qO 0J(FS-K OѯT;3 +`0# 0O OR(F5 Oє; *` 0T"+hp+hZ*`xO0O  һ?5)?0(FhG :AF(FhGʚ;K FFhF]I@RK]pGI@?RK"p]pGuI@ RK"p]pGuI@x0+ Cx J\D 3۲x+#0 ` h # `pG h+# `TI@ Jò\D D 3۲9+Կ0WpGOppGTI@ F!F&F0xB.`F "pFF8)KB J \@Fl;]v `!p@߿B!`O0pTI@"տ! pG8?0 ?!F@ wF8!"F(F)(F8F8@ j-M FFFF#;`phF8P! RF(o @FO24Ccc,bc `Ca <d<@abd[hZlCh[ldh) +l H(3kk cl Ccd1k(Р`[hkIcl Ccd( aͱ+hk+j[hlIcl Ccd(`k48c#d FVF(hS}[hhǹclC@cdv FG(ЀFp+hj+ FG( FG(<`o]4#9FhFFF"Fl_ O3(F#oO08F(FCl-Ԁi(%hjP#j[hXk0bj"Yl8`bikhPkj[hk0j#)lb#hiùclCScdhcl i+)lo 8al* FG(o8F(7Cl 8hHi`cl FCcd`cl#cd(cli;+is F(h[j+ FG( FG(ohpGhpGipGipG@jpGjpGP4?B #<; `pGhki42B #<;` pGipG@ipGj[hXhpGill#Fl)F*))Fl1"1FlJ бc5cR ;1Fl0DO0de@!C !pFJ K LB$ Fp0F!h(D4@@@IK[FHDB pGAhBH0@@@-MFO &KLX'=FB  .F 5Ѹ0FXF C+-F7F.F@@@sFFFFFH*F F#OpoO3]-MH0܀7M8LFF #`0F3I 0F*Fd% BDF B F5D B CBD4((  0 30F"lSջ[F!F(/;`@@@w@)-AFF,l%@tc(F F}!FlH#!FF8F^FH.F!Fl5F@t-%pFFl9cl F0p( #hl[T4_<=<B ((F1FkTKF \d \ ` F JT3_hT dT(  o@FT  lCjF!TdF K(FpFT *FFTM6.p$@ pGF Fp FP F0!F@T^0FTJFPd0h8FTnS_B 0Ch[hBХpd0FF+A# `F(7(FF(7! eFo p)k) [( `#acae```d hK`!aba`js FGX+k ##`ci"iS``##aca 4`o"o_-AFFFVO,<,BollB@(Fj#s F`FhB!F,;FR,OBo+`p,9# F `f0R?B,;#`-EF#FF0!PFȹZ_,=,SEo :F1Fhh%FPhh=BP FjopFFF F)3FF!F(Fp@ChFZll hrl#FS/,:FQ,OB0O0lBF,#s`K FFop(R?,;FQ,oBЙlB+`,#F`o(T?,;FU,/BlB;`,#F`o(T?,;FU,/BlB;`,8F#FF#`FlO2"F(F8@Ӿo88FF!F%`F8#F`"FF@#F`5"FF@׿#F`X"FF@ȿ#F`j"FF@#F`{"FF@F##`"FF@# ` F0#h#@FZ F #h+oj,h`3bc`iFj[hi G(#kjS``#b#cjF[hii G(j[hj F@GFiF+#j[h[iSFj[h[j+ИG( F@G0FA#F Il?(#``c`(F0@9h@sFFF Fl1FopbO DP< +`pooJF"ۿ"]FlF F!FS"l pGpFl6F F!FSFX@"Cs+`k`x FpFl@pFFl F!F"8  pG8FH F("F)F8@ F8|@ pG7Fh FhhS"0#hYhhJ H+F*F&o0o X]@{K@F0 FHFh,<,3B(FclմB FWCh`Dj,<FM F@ԿE!F@h&` @ ſo FOSL@ @@H@H@ppG8F Fch+o8h`BhBch+ hh`-EF0@F< FhhFS"0(FvF0h3 hhC"p*F@FG(oo h FkFhFS$0c{h# hC$!F(FG(op FIF(-jh(hHhHd kjV4B3Fhp@G"@ !C `h"Fh[i),ѩhp@hGpe@-AF"IFFFth$Ѩh_/@p @Mbp Fbih3F!(FBFh_@#2FX!(F`_Fkh_1F(F Fp-AuFhhz_OD `9F(FF_.`_FH d1F(F`&a@Fʚ;Fl+0##0 8F7F(F `O3 Jll``# Jll rJIl` 8o O|@Z|@Uw@-MFF"F! \,ƀ,À,RFh9FF  )40,h0  `-if/:R+F! FF(P?! FZ+FB>F(=)F FPFh DL9K0_c`_@#*F(! F`|!.տ""X!P!B@_` F*FjF()F FFbh_+>s)F FFR+F! FF@#@'FD+)F F*FF/: _b`_(!*F F`#WFF;_c`_(!*F F`FO:w8F)O2FIl ( `o 8de@pFO3`Fi54(!F+p@4 JK F$h` pJw@-MFll<@tc D FiFXhZFHVFphRF8FNJ]DDi F iYh AF(Fqh(FAF(F9F(F*F#F0F IH!Fl@to 7w@:w@pFFihkh-!Fh+Fp@Go%ppFFihkUh-!Fh+Fp@Go%pFiF|F(FFP9FphF(F,F F-EFiFFaChFh<0(FF`BF9F0phGF(F,F Fo%-EFiFF9ChFh<0(FF`BF9F0phGF(F,F Fo%F#h0 F# ~sFFF F "PC KRhj\*CҲ # F1h `p"@h%@pFF(F"F Il `X "Hh+ o c`pode@h%@Fh# F sF#F"3F(FIѣh!0F p~@ pGhk$hF`GLL(h{ @Ɓ@FkFh#`pFF F_"F#AnGppFF FN"F#nGpA pF=F F6F>E5 Ho Fp(FF(0F.F(Fԁ@@ۺ𵑰FF iFű)F8F "왹)F0F  Fi@"hFUiF FuemGoHpGHpG-MFFXĠ(F 0"!hF,#F! !0 ! 0# 00KCF  0iF$^iFp A!  D (F(0D0DFv-𵍰FFF!0"hFF@0#iF6p0 #! (]F ]I?FF(FWB 0K hHom F( C$1/ #p! F (/Н0+JI@̂@ׂ@𵍰FFF!0"hFFc@0#0#iF6p  pK 111h_OO &&FV_##!0KjiOa$ ! &+x4+kx*;+#$0R COcT0k#V0yKyK@c00##p#caO@cc`hSC"`pJ`eoJ1"fnJbfkiWkiXB$1C $1kiB#3@L#@83,!S,<!Ҳ D*1+x,++, +^є 1+@Ā++𦀄 1y25h+o{(F(-[.F0F8pBM$1C$1 F@F! F#F@F(ar F FF( F(F0C h)Ho'J'I#5! Fg(۝ B F w(3F2F! F#! F( FqF(#5! F :(۝0+Иd@@Ql@al@Yl@;@J@̂@ׂ@1JBs$# 1+x+ki !!)KxBZx! 1+Q+x+ &I1)#+ki$1[H1x+ +,+ Ѐ#!(1r#+#!F#!F F8#!F F2#!F F,4@l@HpGph )F Fk !)F FhG 0phkhGFpG pG FܿpG8 *PD8(F8 Z@#hk+i+! F+iG(8 R hkh"GpG0lP-G(F-I F(F+IF!Fg  0Cs0 0:!8!F(FD FF,#T!FHg(L( H )Fg ()Fg y(g r@~@@ FqCi ```h`Zh"shshbsi#a-EFSF(FwF(FCѨi(F(?2KF.3FC`Cl F(5`0F)ChFC.-hSE/$``瘱R;FhRh hH;FJI(F8FF(Б0+гBRF1FF(8F@ @̂@ׂ@pO2FFl)I0`(J)Ilp`'Il&IDl D#IlD!IlDIlD"Il(((Dt"Il(((DT` pDdDDDTDDde@݂@2@;@D@P@Z@j@{@F_lF+ F@ 9)HpG*@_ H pGo_oOO pGph F"0FIxع+z#0Fiz+~+"0Fi~`*jbZB0F)ZA@ p  x Ԋz Ԋ~J x+ƿ pGhFi F$hk$i$dh#FGFFڿ-MhiFh Fk(0F +ihs!F0FGF0FPF7Fej-a#jj+]ШF% z#x"~DD`3c  0(L#i{`ciFCyh  @ + AA ; 0!PD%-##hRF#0FRF(Ѹ-#ajBF0F+FA(ЂFO #0hFi Fhki2h+F0Ghaixz~*DDBo0pGj("iBYjBZbYbj*[j+ Zj8F FhSh_#CHCSHCc!HCC_S`yñ(Fhi_ I#_  ,C_a 8C@h_"`_"a_ XapF FF0Fh$hB(F4K6_2JO2KFh)FD (EF?:# #<;_<;O<;*O3;8D[B@F豰?6# #<;_<;O<;*3;+ o#ZCCCs_ c`p -MiF FF4h#hxC#`ch# c`-$B{3x"i""a_`#"i_3[EPF3Fh_;=f-3F#h##` 6#|@pFF(FF(FZ `3x #qp pGpFihF Fh%3hE` Fp@ pGh+ o 8FFl("I ` 8Uw@h Fkh#G o%h B 2 pGhXi_C@h_Կ_O3Ca_)ahCc`hC`pGi_3pGF`F FxF FU!F F(`. K6_ JO KF;`(h1F Ko  @x}!HH@x}!HK_C@vK[\+JSpK [\p#ppG pG pG`J@pJ@P@h_@`pGKsFFFO1\@4@\@_PE,`pJ6_9C@_ 6pG#@OC `K hK`pG @!B R!@_@!@1!B P!@_B!@1D` CbCpq CC|C@SC_ J6CC_6 K;I H _) BBH@/@-MFFFF!F -FO4+F"FYFPFȹK6_ ` 0C+F"FAF  6_ B(0E FF   "KZo_ ZoBrZgo_"B_gBpCKo_dIH Fo_Bso9q ZCDS D#Ozr SCJ#s!@G@dL@MbpF FFPFMNKx+)FMHF pKK2_JJDC&_TFJGJ1F2 F+6ٶ3OR@HFOr>HFA0 +9J:KR#0_0J2 FXO123Hj FMBOAA$P_ "OQ%HW"Oq#HQ"!%HLOrOA"HEOrOAH>*O|QH8OrHF2"OqH,"OAH&"OAH "! H署@oM@@F@8G@ B %@ dB`BhB "HFԆOrHFԆF! LB I Hx _ёB1H@x@"A0FȽIHX 4_2BIH"LB `H@x@x@"KppG@QKPKPK OKOKOKOKOK OK OK OK OK NI Z 5!"FP"!FK"! F" !FA"!AK`x"@K`@K`@Kp@K"_L#6DB_ @< *٢ ( @4H@,*# 2J`] *Q"S@S@1@1@-@݇@W@݇@S@݇@݇@݇@1@-@## **SZBZAS* ### #9@I@y@ @Ʉ@@-@@@Ղ@u@@@@X@@@@(@]! K L #` K*`ЊB J"`"` (#h#3#s#` ^3@T@0 pG pG pG10#*+ "OCFFOS] 4K_L#DA_H)!09?(2S2;;  "Kx+ !HKx+ !HKx+ !H Kx+H Kx+ H ))) ) @н@w@w@#x@]x@x@-OF F4_O  $_#@@@!! N_!6@ C*  %#! 0H))FHeH"H)F H[ H CCxo"L@w@h@CL@pEK6_+\+M3@J8C8JHxOT!F@Fn+yO3"F#F0F:P@F[PFXA4B-HP$!F@FI+y O  EO E# H48  B "SFF0F[(H  0C "#F0F[FA(@F  ^@^@h@^@94"K0  @KpGl@(KS HpGD%@Q@8y@|L#x+!zHzM+h #x+wKhFvH+hX #x+pKhFpH+h #x+iKhFjH+h #x+bKiFdH+h #x+[KXiF^H+hX #x+TKiFUHr+h #x+MKiFQHd+h #x+FKjxFKHV+h[ #x+?KXjjFEHH+h #x+8Kj\F?H:+h #x+1KjNF9H,+hZ #x+*KXk@F3H+h #x+#Kk2F-H+h #x+Kk$F'H+h #x+KlF!H+h #x+KXlFH+h #x+KlFH 8²@b[@@l@q[@[@[@[@[@[@[@[@[@\@\@(\@4\@E\@T\@k\@-MF.yF cH$bNbOᲙB^`H0O4"]K3i貐GF!YHO7"ACF(FQF(7QH"l"F!FAs(Fg=F GH"Y"F!FAS(Fg*F>HRAFE74H=$ F0F58F204.H).H&O QF@F   &HO QF@F  AFHO#&OO @    @3 H03A6.3z\@\@h@@s]@y]@\@V]@Y]@f]@$"F!F3F(FVHD"F!F3FJ(FOHCO3"F!F(FA8SlF(R F@@ F(F3F@A6Hp "F!F(F3F0H?` "F!F(F3F(HP#"F!F(F3F H@!FH<H9"F#D3F(FhH?4' ,H""F" F#D3F(FNH?4 ,'y]@]@]@|]@V]@-MF!FF0FyF#F  B  A"F(F# 3-MF!FFFyF$FB 0#A4X$08F#KFF(-MFFy]$F&Fܠ6/W+KBF#!F(W/>s,KF1PE%B-(њ)!#H\ K) HXR0+!HJ0+ HB0+H;,,F   [E F KBFF!#(FF²@@@@@@ @pF5H r01H$ FpF(FrF #{#J#-# # D#. O2O ؿ#3 F+F FFFHFI HH jL HxL@}L@L@L@L@KFx+H ²@a@F4'LFD&FF5$kF`G@-MF FbF@Fb#0FFPp9FFH4"KF3@FjGF8FFH@F!F8F] ' !(F3gCB !(F,F!F8FK. !!(FBFO (F8>FBـ !(FFO C# !E(F8FB !(FF!(F!F!(F!F! (F!F !(F!F!FF8F!FF0F!FFPFOz|!F !FF@F FY:8 L|;L =p`-?L?>Cp'6=Cpf5CCC 4!+N@f*ChO1A@ :G!APG03"OqAPhG4#NA@fJhIGK!xA@hG"A@FhG! F('"O1OPhG#FB@kKx+2F!rHO'3B##BF! F)`.[Kpx`+2F9FaH !YFF]H<F@FF4 ZK]pNK8 CAPt!0GRKO`a AP0RGMKAPhLKh0 C@f!GIKJJ]0h C BBAPOa0GO4x 7B OL p,B  BR? BR%OYxpcC CA(@0,IGrsB"Oq0A|@BG%Kh+"A@F0G4&"vFhA@G! Fs! F(hJI-²@#k@Ų@Uk@@@ }@ck@k@@B4@D@@@$@@h@A$@G4#s h!A$@GKh* *𻀐BBBA4&v!A@hGOBOAA,@hGOrOQA,@hGAPhJIG0!APshGOaR A$@hGJO1A@hhG! F( ObA@FhG"OAA`hG+y2! Fu(F@ FnF-#FFB[4!|K3h!OPG0+@4#uM"U!A@hGqK!xA@hGnKh+@  F*(?ADAXH CaJ AD\HC07FZIZJh( FXI-ZB"AAh9z-BHBHB MHB@ HB37! FFO FF_E*z4 7Kh3Bhq0C 3~BhiB4Kx+YF@F  6! Fu%FFO O E?Q0+A ;i+ "+FFF {i+ eOr"#*F)F(F57CHF F2,@< ?@@@X@@w```k@²@@B-M!FFN4$F lO"tOQhFOPGBpORhFOPGh貘GF(@𶀂FE @O O OcO SF2F!(F4F(@" F"SF(F2F!F(@DO4xF0O@AAPGFd jF FFPFbOzsXCQO@BAPF0G.K2FAtco#(Fl0(Kx+'H|4#u"hOAOPGBp&OBOPFhG*A   lOc#"SF2F(FF" "SF(F2FF( F@@B²@J@-MFFFF"4"FMpU XhRFh G;y;y AAK # FFF0Kx+H [6 A@B"h@qG@Ȳ@@B²@Gc@-MFK hK !F # 0PFK x+!F H + # y#!K FhKC"J!h# F#yE #B+0`0SE@00Kx+[F!F Hn'M0+9F0FhF(F^7/tKx+wHT# B@ K4"qK!3A`"hG4#lJ#h@"4%!A(PGeK"5!A@hG"A(PFhGRFOqAthGRFOqAhGRFOqAhGRFOqAhG4#NJA(P#"hFGJKZFA(S#! F0=Kx+CHBKh/ +^ G  ! F(4#5MPFU+jG(h@M"OpqA@G'4%,K5!A@h粘GRFYFki8FG(KOpa\A(PhG$KOA\A(PhG H\F !0FAFKO!\A(PhGNTN2hAt Ch@f!"h@l@²@'S@P@S@2[@h@@@BS@,@4@$@D@@@G2hA Ch@f!G2hA Ch@f!G2hA Ch@f!G4%K"5OQhOPGBpORhFOPGhQF8FGF(@RFOf' E@4&M"VO@AhAPG F Fd OzsXCO@BAPFhGKZFAtco#! F0Kx+؏H4#U"OAhOPGBpOBhFOPGRFYF FOKhco {HvF F 4#uM"S!A(PhGA(W#ZF# FF~0lKx+mH4#U"@qA@hG AAaKZF # FF`0]Kx+_Hp4#WM"U!A(PhG"A@FhGVNAP\p Cht!GOKAP\NKhhBOaG1 ;A1SA2A"A(@hBIG2;B"BhOqA|@G;Khh*׀"FA@Gt!\ #pC F"F(KKFxC+x+TH F+x+OHBKh+Ѱ2h9h1"+ FH F0F# Fp+x*+9h=H.Kh+ш2h9h1"+ 4H F0F# FG+x*+9h*HKh+_2h9h1߻"+ !H F0F# F+x*+9hHKh+6o@L@8o@\@do@wo@o@`@o@o@o@p@2p@8p@Cp@Zp@}p@p@p@q@+q@ FF(?&;x+?)F H IQ ($0(,+!HF"F"F . :+? 1FH6F(?lF Hfy4" KXF3:F[iGq@l@tq@q@&r@@-A!FDF4#"F#OFsOPhG4y#OTt(F#FFF0Kx+$ F!HADAXH CCE*4#"wFA`hGFF @@B²@S@K `pG@)##QpБB pGB B(FBpGB B8FBpG-MF!yYKhyO3"!FAcA(@#FFAc&(@GKhD3@#۲y "F=I>H =NDDӲB.;K:KhSE69Kh ##O5KhByZO3"!FAc(@@F3 #@A<F ##")F R(@Kx+0HiIiFZiHihhZhhRF+Fm/(F, GF&"(&0;Jx)@ހ)S&0;p,K&۲3TzHx( |I+FRF hyH/6.!(z(!)s(jKx+#F*FQFmH&sF$oF"v"r"c$j$[$WF"^ FYHOJB(8FLD0B8 F۲0_6[۲۲*F#FQF?H=Kh+@8I7J D D]]YB@ƀQDBƀ+ÀBБB"I x)*F#FQF(H(KD"U&Kh+hB%0*'@+8@#@;*<#F*FQFH^)\?+;p@;;pKx+?#F*FQFHI@M@M@M@P@WN@N@@@JO@|@P@@\@M@N@Kx+#F*FQFHKNx3D]+*"F)FH4䲣BT8'Kx"\뱘0ӹ*30;F"F)FH7/тKD]+Ϯ!3DBU;F"F)F{H+@*?CrKx+#F*FQFuH+A@΀O#DFFB%0;`&AcKD]+"dHeI hD ]`8B_HD];+#pBػOKx+r@#NKD]IK*xk+"F)FOHsLJ D]IJD]DWKp/A.O F p ##"!F+F0F$  (A(Kx+0!i%HiZiihhZhh"F+F  # #FFP#\#3+!P Kx++F"F! H8FO P@@@ @Q@@^@._@!*(PF5@F<(F?\ "TK!Fh0FS03+F(F 3+(#0"F3F0F(7B>Kx+*F!F->#@OU0O0O0OU0-, K5m@ O3XC#FI<Eڲ"\@3C+-O0(O0 (FɲJ\(A@#<䲣@زC_#<䲣@L ز (O0 C("FiIjH%,S$@@@@@@@@@@@@@@@@@@@@ @5@5@5@5@5@5@5@5@W@W@W@W@W@W@W@W@m@@H7-?#:IF1FF<1ݲ%t]@ CL]@3"C+Ҳ "@@-A-?O0 C$KEx+?+%HO0#<䲣@زDCC @@@`L@K+Op <+ H OU0O0O0Op櫪~@~@ H@~@UU#!J3 +B"K`pG@@K Fh KS$@@8K FhF KC$P8@@-M$F!F O@s:FAC!F@FY(CO3 F:FA8S@FY(5%FF S<2N 2KE)5-(%OpC=-:FA(C!@F)64vf,($O$F:FA(C@F S+ @ E OOFNBTFUE(UF  9F@F" U( BF3:@-EFFF$O"#FQF0F20D+U4,-MMĕ#Kh!  F(@I hKh"` `yFKMNO !BTKp# &#$|M+`,`xKx,6.%ytL#x+)FrH "xB@*nHy$cKaMbK \K]N B@Ӏ 3 B +y@$XN[M[J#WKx#; B #+pLKx+#"FOH<45)p# F#FhF(@|F"B"FgF(@k5Kx+"#"FC6Hyf+?c!F%FOz{$ D RFOr B?M0+AK[]+ 08 1F08570+A*KH357$@h@x@t@f@L@u@p@W@Q@V@|@@Hb@h@\@c@@a@b@2[@0#A~՚0+Os"F!3xH3x+nК0+Os "Fx!0H p 1x0B)u+x+b"H2px2p *P3 /xB8F0"#F#FyF(@W |":C"FFtF(@x0+ Or#;C"FoH43 53  3 6OrfH"F3+F("+#3pҲp *pp)ѓB8F0+xp xZBH#QI3p x3 pӲQJ+px*33/x"#F#FF(@W |":C"FFF(@0+@#@!"F1HB ",I2p x2 p,Jx*@*p)P#3p+x 8p' p;+p F#FF(@)xQ " CFFF(@𦀚0+?8*x@* R ,#C%jb@b@V@b@b@@)"'F#F^F(r xQ " CFFYF(]њ0+xOpR ,#C&H"F#%J3px3p0+@R#"F!+xH30#A"#F#FF3x+@e#"F(F4 B# S` K` K`@FFFb@V@b@x@t@𵅰F FNF3h3Kx+H#y#)F0hLKF)FhF?D KFx++F1F Hr"#F8F#  @@P@@P@0K[CcCEcCESC3C#CD C0A0cKDX\pG@)0 +@B * KH@KFHHX@@@-MFFFFF #O O;SzSE O3 :F1FA8c F7 0*_@B**FAF FvAc :F1F F*FAF FgAc :F1F FHAc:F1F Fzm*FAF FIAc :F1F Ff(5  -EFF\F #O2sCx\RBC{xXB"xFB20BBbBrA0c"!(F1FJKF0!C(FA0c F8O F AcQF(FFй{hFQF(F3F3!F(Fs( OC"FQFA0c(FF8 F#"F!AC(F(DF$0 #'"F!F7(FACF(pOzpHyF(O@O@C!A0c(FF(O3FA0c!(FF(F(F(OzpP@ @B7FKhy!KC"y #"FAc(F|0$,$(F!F4, h@l@JK (FF@b@JK (FF@X@-MFFFF"A ! 0F _  B؋Kx+'FHUEKx+ )FHK$+@Kx+؁H@$ F#*FYFAc0FF(xK#! 4sK!+ иC@!*ajKCC@SCdKO`3I/@aKhO+@7[KhO}/WKhOtOr YF300F*F(@7GE' B&Ow B@[OzpsCHY(j[ $!`"O3FA0cpcF 0;AO EOr YF300F*FQ(: YF300F*FAX3Or YF300F*F/ȹ7 B'OzGE *F30YF0F7#F翲@wT@T@T@ @P@@B-?$+?#,*FAcYF0FF(ۮiKiKhC*FA0cYF0FF(Ȯ $ *F\C YF 00F #/?ɮFFUK0Fh[ 0 *F]YF;FF(/ "O@B`##O1C*FAYF0FF(!+?+??8JC|S*FA4YF0FsF(doxC:"YF[C#CcC0FA<O(*FVF(GOs*FYFA0FFF(7+/rKhO_O3*FH(HCYFA0F%F( O+?+FF P@?-MF0F FtF! dF##[ ZFAc!F(0O@cOcFZFA0cFrKx+BFnH s+ eKx+eH&0FTE^Kx+QF_HYKx+YFZH *;F ͱO c"F RK3 E 0C CKx+RFYFEH+DO+'F7Kx+:F!F :H  FB+K+5O2 !30ZFF(GS,!+ѓ DK*`x+ 4BҥGFDFJ+F!FH4HBٕ4`Kx+5BيH 53 BK4x5+H &B tF;翲@]@]@wT@T@@-^@Z^@@^@^@ s@-M F!FFF5F(`JKx+^H G C&#C C+ظ $+ ++E .x+BF&$EHOoѝBFO F$ 9Kx+'*F &YF $7H #! (3F(2F ')F &XF $#$! ;FyB# &:FQFXF(_'4B W-FO  ,"$!翲@V@V@W@-M'Ȱ F$"9F+FP(w p*!wN B؝Kx+ 1FH;Kx+H]!F\ [ Z Y X WVUTSRQ#+F(@,#T"[ Q F[ yK3y#A@l("!*f#dPBX+P%3XYOS ] \U [ #T)FRQ"F 벚BG]% \Y [ #U TR)FQ"F벓BiO O 0+A@&skD 4B@#'pOO0"(Q!FTg+F (@M/4(hpKx+ \0*F!FH3Fh%0!T+= JDZ]BZU6   3'@wT@T@@@T@Kx+0!F\0H#3F*FKD"ZU#3\ +!#!J0DZ]@BZUskD, C,uKx+3F*F!FtH#/#0lKDZ]BZUpdKx+3F*F!FeHbK_ID/S] x CSU)p?n3F*F!FXHEf CSU)p?Z3F*F!FOH A5FI"D D\*rjD&7F>OCBJ" Q!FTg"(@6R U6 A5"I"D D\*rjD&O F4_BJ!FQkT$"l(@YU67@U@@T@IU@ U@sU@0A3gI  D\kT[TskD@!>4T\IB0s \<ɲRH!FX  _B'(_SE143BH[ !F?H-qiDEDhU\ B 30C )K D K+)@@ skD<+!DK D! 7D# 0)RF!FH*O OJ;;KY@3KQKY@3KQ0+[FRF!F H  5E{@@(V@U@eV@V@-M F FxF0 H +&&$F!8F<4,J !8FF(T8FIF(N( ( 0#F8FF(9>O;x+F;H    +FT2KO h&FbEӬB:x-N *F50+F" )H9#s` F["0Z"2Y@^%0B6*++F"H;x+ H ;x+ H $P@@dc@@:@@c@c@)d@fd@-E&d2FF FJ1`# H02F1F#F(F(O8#sC0(F#FF"!F(F(<M(F0#FF ``."r"rB"0(F#FFo!F(F(.ټ0"rBFF(F"!F(F(n6"rBFF(F~"!F(F}(W@P@-MF%U ! FJ O F 7\\\\\E@FOx BOOzEE0C "30! F(@5" !30 F(Ѐ3Kx+؎H*H/F0Kx+၈HO3F!A0cj3yժF B@ !}Kh}KC"}Kh+tKx+yH#"!AS FCF(@ O3! FAS5F(@O5A0c! F'F(@A0c! FF(@^Kh3 ;`B|#F ;`B#;`3yO3ZFYFAc FF(@сKKh;YF FwF(@Ɓ2y@Kh>KS!0+C"H4K" F30 FOsFh*Kx+F5Q+F!:h/H! 30F FF(@;hh3kD+D,[FO0+A;h Fh3kD+D<2Y C#FFX5 B;h3a3y%@$Q@@BK Fh=KC"O3"FAcF([#F FAcrF(O Fb#"!A0c FbF(?;h30!00F F%FH![k F#jO3 A! F5FK F9hB#CC!A4#F(?ˮF?@B@Q@h@l@?<FF5#&FB0y4O2CCC"AS!(FFȹD `O@ASN"FI!F#F(F Kx+ H$ Fp C2$@B@X@FvF#FF B/O2CCC@"AS!(FFعH3yO@AQK"F #F!F(F8 Kx+ H$ Fp C2砆@B@vX@-A F!FFF"%#*F#`EE њB##hc#` p/A Ց'hB '  '`51-M&"F 1Ff ! FTyF.!O7_K Fh^KC"2FA8S1F(@FF FA+y#AG2F1F3F F06Kx+5H#Ѐ0Bd#0BO+y "O6F FA8S(6FF FAJKx+IH+y@&A#" F# K*"30! F:(֮7 03A6"30! F!(м0 +3'Kx+(HE&Bе03A2O230"FF *2F!H!^"C& "30"FF0p3kD3D,6?<@B@Q@P@$Q@Q@03A]O 0Ip3kD3D< h3[DsC#CYF[F FZFkO3ZFYFAc F((#@ @@%ܱ0+ 0tHp3kD3D0p3kD3D 1ɲ0+gH6B&"Ac1F FM(F F(7OS2FOS F@(֭OS" F#4(ʭ#&F!AS F (#F!AS F(AKh3QA#+y>FB ?!9Kh9KC"/03@03A&S&0#0p3kD3D<[ ADC# F)#s#FFG6" F30"F(U0+F2FH'FKh#Z"AC! F(?5p@@Q@Q@P@h@l@Q@d@-M!FyFO \FB%kLlM̀jKx+eK"hhH"+hD#  aKh^KFS!@ p'A("YK(FC4 0D"F#F(MN3x+NHX!F(FtF@3x+"FHHK4(F303#FF(0F3F#F(Fc(3x+!3H!F(F;F@3x+#"F-H(F;03#FFL(0F3F#F(F*(p3x+oH!F(F3xF +o+ٻF"F! H"+h<P@l@h@@R@@R@?R@qR@R@R@P"-MаFF !_0'P"!F(QP"!H>K]+x!4Kx)!50#A045F+И0+&Kh*xO 33#FFF(&KxB"F+x"H0.&A32F!TT1) 0#A4765$P@@@IJ@X@Y@X@ Y@@4Y@@Y@OYK0;x+!2;O2 "F(EKKx+ BFHH#F4 DKx+DH*#!;p3p#AJ+pU@2xB8F2p*xB(F*p;ъA՚\JC3*Kx+,HOO''$B,$%K $K $h#0"F# FQNMB?0#A(4560#A!43333@IJ@Y@Y@@Z@@@@@%0-+x+pKhOO T22FFF(qKhOO U22FFF(YKhOO _22FFF(A"pppzK # yH h  F FO26; !"F(gKx+ *FdH#F 7"aKU^Kx+_HxkBkApSKhO 33x#FF F(֭JK%x+?9"FxJH1x p3x3B8ٲp xB(ڲp F-pѧ0Ӯ'/K*K!2;O2 "UF(}x+Kx+ :FH#Fg Kx+H]#+p07/ё@*x0B8F*p2xB(F#2p JUP@@@IJ@Y@@@Z@KZ@@iZ@AZ@@0#A3'KMO0!ՓKJxx+K")!HJKh"C! K*pU2pKx+"F!3xH7/46hS! :"C! K2xCD]+p0#A@ǀ3x+yK"F!]xHmKe tKh3x:+!qH+RY9xnHmKh 33D#FFF(5ExxB[K9F][K]XCŲT 0UI"DwA"Pj3YFZF[FKF(exxYFs[0ZF3K[FF(K;O0\T3YFZF[FKF(50YF\U3ZF[FKlF("3x+ )Fx$HxjC433Թ %JT0OTTT H@@IJ@h@l@Z@@Z@@@Z@@[@&[@P@@@@@6[@!!JIHw@{@{@.0OzsXCpK0 Mb}%!!N07F" N 2*G;5- "H1D2*@? 4@@J#FRKBQ#3+ 4@}#|}@B*  `~{@B*J`B"ZC`)@* "ZC`B~z@B* a~y@B*Ja~D $x "*ۊa~"ZCa& w@B* b' v@B*Jb( u@B*ۊb$@% "ZCb+@, "ZC c+@- $ "SC Kc{(( pGy +J\ pGG@pG@{(( pGC{(   pG{y8c+  pG)C+  pG pG pG pGxpGxpG@@CB@.CB@3BذP@#Bذ  pG pG pG pG pG pGpWF! 0F+ @ 4B"c{bcs FF FFj*I \+>@Cp G@%F! ^0F+0+i(F (DH O0(Fq(?H(F&(F)(FC'F#FB (FY8 (@C@-Hr3(F@BF&HFE#H`7(F1FD,H +0P+00`300+1F(F0+1F(FM{@y{@{@@BtS@GS@s!F #Bд A#F"zBH0+3Q(@B K@@XBXA7 (O0 Kh_K@+Jh_PQh_Th_Xh_\i_`+Jh_pQh_th_xh_|i_+_"+pG@@@JDh_! C_ `pG ( KX_0( (  pG pG pG pF#-BO2F(F p(1o E5BpK#Dh_$D_`__"_ J_iBa  (F a(KDhB `) ("KDhB) )( KDhB(KDhB8 8F$B8! F FH@A54EK@k_CM.`Pk_AM.`Tk_n`Xk_`\k_``k_.apk_5M.`tk_n`xk_`|k_`;_+a#'FO Bѿ_"KO @[ 6#F$!OB, +B5C^6 5C3  B ,M_=`_>b47C`eCPeC0eCeF@@@P @-A#"'H#jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-                                8(H*@@@i@[i@)i@@_@^@^@^@^@<@d@@@@@@W@;@@@J@@J@@J@Ӊ@J@[@@@~@~@J@^@r@@ f@d@c@#@+@4@H@\@Su@=t@t@ct@t@=s@4800T $go048<@ @"@@@@ʈ@ֈ@@@@j@i@Zn^MM *XX4 @  JӅ@م@߅@@@@@@@ @@@@*@5@A@I@H@N@]@@k@ak@l@k@      @ %2%5 %6%7 %8%:a& `%9#a( a& `%:a•:`%;a%<a a a$ A(”<…;…:†:…9„<€;;:„:€99ƒ9„98„87„7M@`M`M`@M`@ M`@ M`@ M`@ M`@ O`@!M` @  M`@ M@`@ M`@ @@ a@@!`a`a`a4*`H4*`H4*`4+`H4+`H4+`4+@    @000 ` a0@@P`@@a` a`@ap ap@a@a0`apa`apaa`apaqa` a a@ a@!aP@a@ a@@a@a@a@aaaqa"a 4 @*T` 44@@JJTT` ` 4  **` 44@@@JJTT` `  __of_translate_addresshws_ref_clock_sethws_is_serdes_activesys_env_model_getddr3_ctrl_get_junc_temppattern_table_get_wordmv_ddr_rl_dqs_bursthws_update_serdes_phy_selectorshws_serdes_get_max_lanesys_env_unit_max_num_getis_prfa_donehws_serdes_get_ref_clock_valmv_ddr_is_training_donehws_serdes_pex_ref_clock_satr_getmv_ddr_is_odpg_donehws_serdes_xaui_topology_verifyhws_serdes_topology_verify%s: Bad cell count for %s (((((AAAAAABBBBBB#gpio-cellsFreq_set: DDR3 poll failed(1)alloc space exhausted spl_init() failed: %d ddr3_init() failed: %d Trying to boot from %s SPL: Unsupported Boot Device! SPL: failed to boot from all boot devices Returning to BootROM (return address 0x%08x)... %s: %s: error: gpio %s%d not reserved No closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\cyclic function %s took too long: %lldus vs %dus max Error: Wrong device size of Cs: Error: Wrong Memory size of Cs: %s: TSEN not ready DDR3mv_ddr: failed to update topology %s Training Sequence - FAILED DDR3 Post Init - FAILED 0x%x mv_ddr: completed successfully DDR Training Sequence - Start scrubbing DDR3 Training Sequence - End scrubbing DDR3 Post Run Alg - FAILED 0x%x A38x does not support interface 0x%x TXRX%s pat %d IF %d pup %d Regs: 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x pattern %d IF %d pup %d bit %d subtract 64 adll from start pattern %d IF %d pup %d bit %d subtract 64 adll from end cs %x patern %d IF %d pup %d cur_start_win %d cur_end_win %d current_window %d Pup locked, pat %d IF %d pup %d fail Lock, pat %d IF %d pup %d continue to next pup %d %d fail, IF %d pup %d bit %d fail #1 fail, IF %d pup %d bit %d fail #2 pat %d IF %d pup %d opt_win %d final_win %d waste_win %d st_win_skew %d end_win_skew %d cur_st_win_max %d cur_end_win_min %d bus_st_win %d bus_end_win %d win valid, pat %d IF %d pup %d fail win, pat %d IF %d pup %d bus_st_win %d bus_end_win %d Tx special pattern SSW - TBD IF %d pup %d SEW - TBD IF %d pup %d fail, IF %d pup %d bus_id %d Res= %d ERROR: ck_delay is not initialized! ck_num_adll_tap %d ca_num_adll_tap %d adll_tap %d Un-KNOWNtraining done failed training result failed odpg disable failed _r_l: DDR3 poll failed(2) for IF %d CS %d bus %dRL exit read leveling WL: DDR3 poll failed(3)WL: IF %d BUS %d reg 0x%x WLValues was changed from 0x%Xto 0x%XWL: IF %d BUS %d failed, reg 0x%x WL Supp: adll_offset=0 data delay = %d WL Supp: IF %d bus_id %d adll_offset=0 Success ! WL Supp: adll_offset= %d data delay = %d WL Supp: IF %d bus_id %d adll_offset= %d Success ! WL Supp: IF %d bus_id %d Failed ! WL Supp: CS# %d: IF %d failed polling failed IF %d dev %d access %d IF %d freq %d mv_ddr: unsupported cas latency value found mv_ddr: unsupported cas write latency value found Freq_set dev 0x%x access 0x%x if 0x%x freq 0x%x speed %d: Freq_set: DDR3 poll failed on SR entry Freq_set: DDR3 poll failed(1) Freq_set: DDR3 poll failed(2)Freq_set: DDR3 poll failed(3)max poll IF #%d pup_num %d not valid if_id %d not valid error param 4 if_id %d sybphy_id %d bit %d l2h 0x%x (e1 0x%x) h2l 0x%x (e2 0x%x) if_id %d sybphy_id %d bit %d BIT_SPLIT_OUT if_id %d sybphy_id %d bit %d BIT_LOW_UI if_id %d sybphy_id %d bit %d BIT_HIGH_UI if_id %d sybphy_id %d bit %d BIT_SPLIT_IN if_id %d sybphy_id %d bit %d l2h 0x%x (e1 0x%x)h2l 0x%x (e2 0x%x): bit cannot be categorized if_id %d sybphy_id %d bit %d l2h %d h2l %d if_id %d sybphy_id %d min center %d max center %d center %d if_id %d sybphy_id %d byte state 0x%x if_id %d sybphy_id %d bit_id %d added 64 adlls train_status is NULL wrong parameter train_cs_type %d edge_comp %d pattern %d direction %d search_dir %d control_element %d result_type %d pup_num %d pup_access_type %d if_id %d access_type %d dev_num %d, access_type %d, if_id %d, pup_access_type %d,pup_num %d, result_type %d, control_element %d search_dir_id %d, direction %d, interface_mask %d,init_value_used %d, num_iter %d, pattern %d, edge_comp_used %d, train_cs_type %d, cs_num %d polling failed for Old RL result polling failed for Old WL result -- Fail Training IP -- FAIL EBA %d %d %d %d ADLL shift results: -- EEBA Fail -- EEBA Fail Training IP -- FAIL EEBA FP I/F %d, ADLL Shift for EBA: pup[%d] Lock status = %d Lock Val = %d,%d Update ADLL Shift of all pups: FP I/F %d, Pup[%d] = %d Per Bit Skew search, FP I/F %d, bit:%d, pup:%d res0 0x%x --EBA PBS Fail - Training IP machine ##########ADLL shift for SBA########### SBA Fail adll_shift_lock[%x][%x] = %x Per Bit Skew search, PF I/F %d, bit:%d, pup:%d res0 0x%x PBS failed for IF #%d The abs min_pbs[%d][%d] = %d Final Results: if_id %d, pup %d, Pup State: %d dq_map_table not initialized result_mat: %d , PBS tap=%d [psec] ==> skew observed = %d IF %d Status: Init Controller: %s Low freq Config: %s Load Pattern: %s Medium freq Config: %s WL: %s RL: %s WL Supp: %s PBS RX: %s PBS TX: %s Target freq Config: %s WL TF: %s RL TF: %s WL TF Supp: %s Centr RX: %s VREF_CALIBRATION: %s Centr TX: %s Title: I/F# , Tj, Calibration_n0, Calibration_p0, Calibration_n1, Calibration_p1, Calibration_n2, Calibration_p2,CS%d , VWTx, VWRx, WL_tot, WL_ADLL, WL_PH, RL_Tot, RL_ADLL, RL_PH, RL_Smp, Cen_tx, Cen_rx, Vref, DQVref, PBSTx-Pad%d,PBSRx-Pad%d,Data: %d,%d,%d,%d,%d,%d,Read_from_d_b %d cs_type %d oper %d result_type %d direction %d search %d pup_num %d if_id %d pup_access_type %d ddr3_tip_read_training_result load_res = NULLif_id %d start_pup %d end_pup %d pup_cnt %d start_reg %d end_reg %d interface %p reg_offset %d value 0x%x addr %p *load_res %p -- dunit registers -- 0x%x -- Phy registers -- Special: pat %d IF %d pup %d Regs: 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x Special: Pup lock fail, pat %d IF %d pup %d Special: PBS:: I/F# %d , Bus# %d fix align to the Left Special: PBS:: I/F# %d , Bus# %d fix align to the right Special: Winsize I/F# %d , Bus# %d is %d DGL parameters: 0x%X 0x%X 0x%X 0x%X 0x%X 0x%X 0x%X 0x%X 0x%X 0x%X 0x%X 0x%X ck_delayphy_reg3_valg_rtt_nomg_dicodt_configg_zpri_datag_znri_datag_zpri_ctrlg_znri_ctrlg_zpodt_datag_znodt_datag_zpodt_ctrlg_znodt_ctrltip_dunit_mux_select_funcmv_ddr_dunit_writemv_ddr_dunit_readmv_ddr_phy_writemv_ddr_phy_readtip_get_freq_config_info_functip_set_freq_divider_functip_get_clock_ratiodq_map_tabledfs_low_freqError: %s is not initialized (Algo Components Validation) VREF config, IF[ %d ]pup[ %d ] - Vref tune not requered (%d) VREF config, IF[ %d ]pup[ %d ] - Vref = %X (%d) current_valid_window: IF[ %d ] - I/F[ %d ], pup[ %d ] STATE #%d (%d) I/F[ %d ], pup[ %d ] CHECK progress - Current %d Last %d, limit VREF %d (%d) I/F[ %d ], pup[ %d ] VREF_CONVERGE - Vref = %X (%d) FINAL values: I/F[ %d ], pup[ %d ] - Vref = %X (%d) write_mrs_cmd: Poll cmd failXSB-compt CS#%d: IF %d bus_id %d 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x supplementary: shift to %d for if %d pup %d success XSB-compt CS#%d: IF %d bus_id %d num_of_succ_byte_compare %d - Fail! XSB-compt: expected 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x XSB-compt: recieved 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x bootcmd=run distro_bootcmdbootdelay=3baudrate=115200ethprime=eth2loadaddr=0x800000arch=armcpu=armv7board=turris_omniaboard_name=turris_omniavendor=CZ.NICsoc=mvebumtdids=mtdparts=regDisabling MCU watchdog... omnia_mcu_write failed: %i set_dir_flagsset_valueresetting ... RE is too long (code overflow).flagseth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,## Warning: Unknown environment variable access method '%c' ## Warning: Unknown environment variable type '%c' ## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" arocsdxbimenv_buf [%u bytes] too small for value of "%s" bad CRCCannot import environment: errno = %d import failed*** Warning - %s, using default environment ## Error: Environment import failed: errno = %d malloc() failedspi_flash_probe_bus_cs() failedspi_flash_read() failed#address-cells/aliaseslinux,phandle#size-cellsranges/chosenstatusokayMissing DTB Jump offset is too bigCould not read count from timer (err %d) %s.%s%d%s.%s### ERROR ### Please RESET the board ### himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! MiniPCIe/mSATA card detection... omnia_msata_slotpcieforced to MiniPCIe via env sataforced to mSATA via env autounsupported env value '%s', fallback to... omnia_mcu_read failed: %i, defaulting to MiniPCIe card none mSATA MiniPCIe WWAN slot configuration... omnia_wwan_slotusb3USB3.0 PCIe+USB2.0 Init_controller, do_mrs_phy=%d, is_ctrl64_bit=%d active IF %d Init_controller IF %d cs_mask %d cl_value 0x%x cwl_val 0x%x WARNING:Wrong configuration for pup #%d CS mask and CS mirroring for all pups should be the same DDR3 Pre Algo Config - FAILED 0x%x with adll calib before init Dump before init controller INIT_CONTROLLER_MASK_BIT hws_ddr3_tip_init_controller failure adll_calibration failure SET_LOW_FREQ_MASK_BIT %d ddr3_tip_freq_set failure WRITE_LEVELING_LF_MASK_BIT ddr3_tip_dynamic_write_leveling LF failure LOAD_PATTERN_MASK_BIT #%d ddr3_tip_load_all_pattern_to_mem failure CS #%d SET_MEDIUM_FREQ_MASK_BIT %d WRITE_LEVELING_MASK_BIT ddr3_tip_dynamic_write_leveling failure LOAD_PATTERN_2_MASK_BIT CS #%d READ_LEVELING_MASK_BIT ddr3_tip_dynamic_read_leveling failure WRITE_LEVELING_SUPP_MASK_BIT ddr3_tip_dynamic_write_leveling_supp failure PBS_RX_MASK_BIT CS #%d ddr3_tip_pbs_rx failure CS #%d PBS_TX_MASK_BIT CS #%d ddr3_tip_pbs_tx failure CS #%d SET_TARGET_FREQ_MASK_BIT %d WRITE_LEVELING_TF_MASK_BIT ddr3_tip_dynamic_write_leveling TF failure LOAD_PATTERN_HIGH ddr3_tip_load_all_pattern_to_mem failure READ_LEVELING_TF_MASK_BIT ddr3_tip_dynamic_read_leveling TF failure RL_DQS_BURST_MASK_BIT mv_ddr_rl_dqs_burst TF failure DM_PBS_TX_MASK_BIT VREF VREF Dump ddr3_tip_vref failure CENTRALIZATION_RX_MASK_BIT CS #%d ddr3_tip_centralization_rx failure CS #%d WRITE_LEVELING_SUPP_TF_MASK_BIT CS #%d ddr3_tip_dynamic_write_leveling_supp TF failure CS #%d CENTRALIZATION_TX_MASK_BIT CS #%d ddr3_tip_centralization_tx failure CS #%d restore registers to default Auto Tune failed for IF %d Warning: Algorithm return value and Result DBare not synced (status 0x%x result DB %d) ******** DRAM initialization Failed (res 0x%x) ******** DDR3 Post Algo Config - FAILED 0x%x %s: Error: Lane#4 on Device 6810 is not Active. hws_power_up_serdes_lanes: unsupported ref clock %s: SerDes lane #%d is not Active %s: Error: ref_clock %d for SerDes lane #%d, type %d is not supported hws_ref_clock_set: ref clock is not valid for serdes type %d hws_ref_clock_set: not supported serdes type %s: Device ID Error, using 4 SerDes lanes %s: Error: REF_CLK_SELECTOR_VAL for SerDes type %d is wrong %s: Error: SerDes type %d is not supported hws_serdes_seq_db_init: serdes revision number is not supported hws_serdes_seq_init: Error: Serdes initialization fail %s: Warning: Wrong serdes type %s serdes#%d %s: Error: serdes lane %d is configured to type %s: type already in use %s: Warning: serdes lane %d type is %s: current device support only %d units of this type. %s: Warning: serdes lane %d is set to type %s. %s: Maximum supported lanes are already set to this type (limit = %d) %s: Warning: wrong number of lanes is set to XAUI - %d %s: XAUI has to be defined on 4 lanes %s: Warning: wrong number of lanes is set to RXAUI - %d %s: RXAUI has to be defined on 2 lanes %s: SerDes lane #%d is disabled %s: Warning: SerDes lane #%d and type %d are not supported together u-boot,i2c-offset-lengeneric_%xi2c_generic_chip_drv->i2c_mux_bus_drvi2c-parentclock-frequencyu-boot,i2c-transaction-bytescompatibleunknown cmd (%d) at %d Warning: Unsupported freq mode for 333Mhz configured(%d) Warning: Unsupported freq mode for 400Mhz configured(%d) Warning: Unsupported freq mode for 533Mhz configured(%d) Warning: Unsupported freq mode for 667Mhz configured(%d) Warning: Unsupported freq mode for 800Mhz configured(%d) %s: timeout %s: NULL result pointer found DDR3 init controller - FAILED 0x%x DDR3 init_sequence - FAILED 0x%x %s Training Sequence - Switching XBAR Window to FastPath Window ddr3_fast_path_dynamic_cs_size_config FAILED not locked%s: cs %d, step %d, subphy %d, state %d, low 0x%04x, high 0x%04x; move to new state %d new lock %d new state %d; jitter on mask new state %d, solution %d %s: cs %d, pass_lock_num %d, max_bus_num %d, init_pass_lock_num %d %s: subphy %d %s %s: cs %d, min phase %d, max phase %d, read sample %d %s: final results: cs %d, subphy %d, read sample %d read ready %d, rl_phase_val %d, rl_adll_val %d mv_ddr: unsupported dram device type found mv_ddr: negative timing data found mv_ddr: unsupported dram module type found %s %s mv_ddr: 14.0.0mv_seq_exec_ext:Error: SerDes lane %d is not valid ngpiosmvebu%d_*** spi_xfer: Time out during SPI transfer cell-indexu-boot,i2c-slave-addrreg-offsetreg-shiftreg-io-width/configi2c@11000->i2cmux@70->i2c@0Cannot get I2C bus %s: uclass_get_device_by_name failed: %i Cannot get %s I2C chip: i2c_get_chip failed: %i Memory config from EEPROM read failed! Falling back to default 1 GiB! MCUEEPROMdm_i2c_read failed: %i, cannot read EEPROM bad EEPROM magic number (%08x, should be %08x) bad EEPROM CRC (stored %08x, computed %08x) error: %s: unsupported pattern type [%d] found RU3mreset-gpiospoll_op_execute: TIMEOUT U-Boot SPL 2023.07.02-OpenWrt-r23630-842932a63d (Nov 14 2023 - 13:38:11 +0000) error: %s: polling timeout board SerDes lanes topology details: | Lane # | Speed | Type | -------------------------------- | | | ^%s$Error compiling regex: %s IF %d exp: _i_f %d rcv: (0x%8x High speed PHY - Version: 2.0hws_ctrl_high_speed_serdes_phy_config: Error: Serdes initialization fail Error: too many serdes lanes specified by board High speed PHY - Ended Successfully serdes_power_up_ctrl: serdes type %d and speed %d are not supported together serdes_power_up_ctrl: bad serdes_type parameter stdout-pathconsoleNo serial driver found%s %s: Invalid cs %d (err=%d) spi_flashjedec_spi_norSF: Failed to set up slave Invalid bus %d (err=%d) %s %s: Invalid chip select %d:%d (err=%d)  ; F J R Z b j r z  N V ^ f n v ~                                         " & * . 2 6 : > B F J N R V 048048<048<048<048<048<@DP%@u_@@0 6@5_@ 6@"w@65@:w@45@?@46@e@5e@e@6@Ɓ@m;@k@k@;@0@bD6@u@l6@@l6@y~@5@6@@g7@u@es@ @7@@u9@e@9@@7@:@j@j@aj@:@@@h5@m@n1@ .@/@%@!@-@!@:@L@|@0Z@[@[@@4-`@_@b@b@3@6@7%h@g@g@@D9T@@I@@gq@q@@hY@ ω@l9T@!w@U{@v@ }@n@mk@@u@@ 8 ( Turris Omnia7!cznic,turris-omniamarvell,armada385marvell,armada380aliases ,/soc/internal-regs/serial@120004/soc/internal-regs/i2c@11000'9/soc/internal-regs/i2c@11000/i2cmux@70>/soc/spi@10600soc"!marvell,armada380-mbussimple-busCN`Pq    internal-regs !simple-busqi2c@11000+!marvell,mv78230-a0-i2cmarvell,mv64xxx-i2cx |okayi2cmux@70 !nxp,pca9547xpi2c@0xi2c@1xi2c@5xcrypto@64!atmel,atsha204axdserial@12000!!marvell,armada-38x-uartns16550ax |okaytimer@203001!marvell,armada-380-timermarvell,armada-xp-timerx0@0P   spi@10600)!marvell,armada-380-spimarvell,orion-spi xP|okaychosen /soc/internal-regs/serial@12000 #address-cells#size-cellsmodelcompatibleserial0i2c0i2c1spi0controllerpcie-mem-aperturepcie-io-aperturerangesregstatusreg-shiftreg-io-widthinterrupts-extendedcell-indexstdout-path` @ᆳ (OР iHMP  H4P 6 OР iHM  H4P , OР iHM! H4P " HOР iHMp! H4P  OР iHM! H4P  OР iHM0" H4P  hOР iHM" H4P 1)  yOo/Oo   P!:0@" Рx////////00S+ Q \& /A-P@ ` pV: \ : "& \*000C0@0//@-@ @ Q/000@00000M-`@qQ41U: 1`M.8LT 0 W00X03S0 RS  R 0 0T0F0 C 0??$0ttR0P S :!  Q *  <0S}  @-@T000Ѝup@- `@P EoRU P @@oT RS   P0p@- 0 E-P@0 `R` T 0S0:00P긠pP  0P T 0S0#0%P ЍPPV0 0S%P T00PUTRQ00P0SA- ЍP@`@pP  P0SX: 0@T CR  SQA-p  P RP`  @rP W00V  0 R U @T:P/p@-p0p@Q#% PU00C B0@  BpM-ࠟ`PA@0040p C@ Q&"     n j 0f4 8b P    B  BQЍ00 ` ///e.0@P/ R/0@- R 0 R0#s01 # @0 PUS0 B0` 00#s01R #0 p .~. p .~. 0 @-%s: Unknown relocation type %llx %s: Relocation at %p is out of range (%lx) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-IBI SYSTdHx# Das U-BootRUNTSERVdPH4,0??Oo/@-k@@-@@-60???Oop@-@P+?0 00#0b0UOp@>?0@-0???Oop@-@P o0 P  0``&UOp@6?0_00;0 0Q@o0  CA_ov^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovVY@T S@No/N-N//@-@ _SNSL/Р3yР3ybHРP L8o$$0 S뽂뽂 8H4% _/_ РP/8 /0Od@P TP  Q:< 80QR:/(x x Т 0- $M<0 @ 0DH ! 0 $Ѝ/s@-0`40P@0=P  ,Pl,L`0T\\ ,F = ;q0S 00 8 T6/Ѝp 됉O./@-@4=0S LP@'͉G\p@-`` @P p  @-@P (˽PڠP 凚@$ꃑ0/@-%$0 4& 8' <|S S@@ ho)(0 4* 8+ <0-,0 4. 8/ <0 +(obox0+0RA-@P`p`R h B(0H@ RAA AA / RS̴ P/@- R39C R- 0l@*H@ R ` R<\|Q RQ`r l  0@P`p 0@P`p*/0@$$0@$$@/l\0@Ѥ0@ R \3 e R$ l@ B0!:-` R<\|.4 RS<$DL%T\&dl't|( ) ,Ġ̌`r .4\<0RA R$ l@ B0!:-` R<\|.8 RS8$HH%XX&hh'xx( ) ,ȠȌ`r .8\80RA R$ l@ B0!:-` R<\|.< RS4$LD%\T&ld'|t( ) ,̠Č`r .<\40RAL@01_  02_0 _ _00'/|(0P:_ 0'/_ p@-@P TT0*@@  48(*P00U_ 0'p_pG @*{K~/@-0<4141,D1$H1@**ZfovH D H  BH /9 4 nD0 00/@//@-%숉p@-@M t8 <d@P) b L8L <0 @C4),00 4$) 0$ ()0 00 )00 0 )VNnZ z C0c0vV)@0 @01 0|)x Gl0 02 PP , pЍ010S x0 2``!l\ LP1< PP2ь按1$/=Jp@-@MP@ P1  ,P"1`!01T!0L P , T@Ѝp ,P ,+P 0P#b00`0L*0(0,0\ b`N/0X(00N b~)`*0Q0OkGk`HPHdktkkk̎"@-M-@pMlyP 0l"ְP l"彲P@0l0 mP0:`P  v\"嫲PP H" PzP(AyDpЍ=P!*PPt!P0pP!P0pvPt1t!kPP`PE0 S .   0S  U 000408U000402P'  00 B0 P/. mo?o-R20S`n U =c #U 00400S4 0 4V`ሰ儰 P PX 0R 6弰RPċe0S  PQ Px  [ 尋P始Q"V 0S S S@00 03?0S45 C$@  0` D0 00000d0  004 P40L`P000TH0000000 @02/0003?0000SS=L$40B 00?003 R  |%TL iPTL rPTL ;PTL DP LT LxP %D0S03?0P0S 0#TLiP 40"0A0SQ0SS0 $09P 8Ѝ|0儰(00`,040␀05 00@0 P0[ P4 ( `A( &rU V :84U  0 $ 0A???0AX[4  ,0S(0R D0S "0S圊噊 B}` /P@  U 0 @6/P 0 6/P0  6/P0+ `U x xb$ɉˉˉˉɉ ɉ'V$$ɉ]ʉ;ɉ$VɉZɉ(yɉʉɉɉʉ'ʉ>ʉʉʉʉ8ˉˉUˉˉ̉/@-@0 P0nP[P`Pt$P @LЍ(F00$PDljvljljA-`Q@pPB@p(V PD @-R00@ 4//vȉ|ȉȉp@-P`@e-P,p03/ȉM-PM@ ,`P   UD0S,ЍpQ=pGorpW p HPZ   80 ЍMXfQ * 0Q0( P PPt 声pP,PP `000T hIsPqX T <h,N͉Ỏt̉|ȉ8̉}̉|̉E{̉̉̉ PE-PD0Sl Ѝ"0`Sp V"@YV@᥋ 0 @P`L0 L 5/0  N0S ,P@@lj|ȉljO͉ P!0@-@D MRpp'Ѝ0P X0(P 0 m' 0 f'g/rȉ|ȉٿ P%A-@D0SxPp+P `U` 0 @<4/,+P /(ȉ|ȉ/ȉ8ȉ͉//A-@`pP0 `6/ TP@0/>0 R R/00 R 0-A-p0@/SP"M 0S00,I`` V l#"ލ@H @lP0 5/PW00 ٿs@-@P`+P  P0 Ѝp@-@  $ ( @M-p@P0S R R`JℊPPV 0000X0   r  ꓀A-@0P0 Q Q ^#Q 0S S^0 Q  Q 0 000ЍR0 0 `,p熁Q P00 `XGs@- P @`P00  AЍpO@-` Pp@T  8A ЍP 1_N@-@,*P  Pȉ@-QMlЍ@C! L-#P 0 00 00 0000U M-P@#MM6 h408P$>P; @[8 0S@D3@@G00| 6~P (ЍM~Q <ZP0S <RP @p w}P p(nt (Ѝgfffh`!!["A-@`p P0U 0 0p`0 L P*|P  HuP 0 /Q0P 0C0Op@-P`1@P0'pV00Ap]@-@M@@ t@ n03?@o@Ѝ@-@ @82/N03?@o<0 R/p@-`@PP @1<@3?0^p03?00 0S/S/ @-@P@ e pc eM-MH`Ps@U 8p @-@P0@-"00G@-<`MV; @P$ p@`冚 W0H0P  G 0p/P00x@P w`<00 :L0Y0@-@PM 㕐 0 P ነ4 0!Ѝ0 0l 00bA-P@P Ѝ` `G@p刀T0SS R P`  '@%*O@-@ P@oЍ@-@ P@oЍ@-@ P@oЍp@-@P%P@t@4O@P@0H P)@ 0, PI@ 喑P@p%@-Ppኑ`P#U 0PP` #f@P @D@p@P `   P0  !`p Ѝet@- @tP  ЍM-pSЍM`"@PЍ 0  PIp P0W  T@P@p@-PH@P0 PppM-`HM00R$00l$S00zP00ES%ԅp C@P  HЍ[ 0@ 0T#hS@PLm@ 7 (U 0H0 Z4y @& 0$(0(0S {mvPtm @pmD D0z 0P P PU4  pPpWpBUU  Pp8 <08 Pt08pS<@pi @ PF t0S`hW@dUUD 'D@hP 0 A@N dpP ^P XP RP  LP FP W U t @0RSG  URD  1Q  R @  07 70P@`L70S(0H UU" U: 0W ,00o`,0@@D  0 0(,!P,DpJ6 D@@pW tx0@ |0$0S0S 0 S00 0 W ZolW  QpU70S U P \YlW70GkKv&VɉQs>D@-LpP`X $M@IP000 000000 `PI$ЍxM-`0(MpR000VL0B PUB wPP 7 #3@P000DUP5$00 000 0Z0000H00 0 P   PT h[ 00P0S$0P 0W00V00m(Ѝ@P@ꪎp@-@k8P0Sp0 P \@-@F0S 0 P @/M-PMUЍL0S l@ShPT`V`0P0@qT PpPh ᙗP/ P ӗ 0S/ P  \P% Am  [PPIPa  0 3/Pភ@Z0 9x R h=P pL$P 劗0J x|̉攉͔ )X\t[Pt    @0 $t0 G2T" PfTX ;P6@VP@P )PЍ hP -P H6 8P ׃P  % P@P  P t  p l@0 l0  0TP < pW7剉}=A[Ԋ+@- 0 @pЍ@-M`@PP(V 00-SPЍ@0 `@0`h sT00p0ShP"P 8PP0Shh@ƉVA-`0BSpP@X oP 0 DRU(0^p0A/ح0@-@0MR0 050\P0 P  0 POkrЍ08 0 D@-  = Ѝ@-@8gM@P`U pP0< 0@ xU` @0pSPPH@<48,L  @P0   @T% lptl R l gߍtr `ĉĉĉĉĉĉĉĉĉʼnʼnʼn&ʼn 8ʼnJʼnG,hʼnzʼnʼnʼnʼn0ʼn\ʼnRA-@PD`B pnP 0 A//R p@-@ P@ p/ы-$M %0 000p$Ѝp@-0P0@qq0 00 00p舑0s@-`P00Kx@P Lh~P lExЍpL  .W@nLT ,4Q /qM&ƉsƉKƉkƉ000 000/ᄑE-P蠟M0@0 S`p 0U mP P@PPx0P P@ P0`P @H0 T   `pq 0 ЍtꄑA-&M/ RX,aq@0X*PD 8@PD  04 8< \P PPD:A&ލP$ 0P  /@ 4OJ@0$FJ 0o`PV &AAJHp %L%T\2/@,@@0  PPTcc.Q@P ,c0B-!-.Dj0A-M 0|1`pP hAQ@ 0@p_0P 4 U@P 0  V`pTЍr^P'mK00p0 Q@PKT pP @@hP`&A @ m@P f`@ꈑA"x/͉RA-@Ѝ@PrP H@T @ P@ P P  JP f@P@PP Pp `P@dfX  @P /A@P@800V00@ $@ʼnʼnʼnV ƉE-0PM@B(0 0p`T0  P Ѝ0  Bh|!0C0 0iP0000q> 00P$8 菋R@-@ @P@V!@-L@P 8P (P`N^d ʼnR@- R P P P]U\0P/R@- R P P PfAh0P[ӉM-[kPc딀@TЍHH0D0p0l  dd0@DT`TpT >]P Z@щ@O|щщ 0 Br0 S 000Cs P 2#0//@-@.PpW` 0@0FSP0`F0 P Ѝp V5P  Pd 02#0P` V`PV  0S 0P0S0PP0;S0 V 0< "?bcPd 06#`VQ0@- A8`FV: 0(p, 嗃8Pr';0pp@ 0 `0p垃 X!33 00  0`#t0 `d #3=n&c H@,0 &U8`EЍ= ף ףpA҉.A-`0BSpP@X ajP 0 DRU(0^p0A/xحRs@-`?d@P|Ѝp : P5/D0080@sgP$ 5щщ҉RA-`Pp@P@`U` pa`}aUT gaӉs@-PBU`:@-Q@sQpQ-PR`  pPE`000aP@ T 0pS@P PxXa03/@P0@nЍp@@8 ƉƉ@-R2ՄMP`@VP d$P#P @H<a8 P,@Ѝ`@PD@Pd  *@ R[  @ P pP@N <0/@ P p@h P X@P P @@8pP. @P ! 3P!3 P ^P`L5/`dp`8 Q ̉"͉P͉Y͉͉H͉G,͉a,͉N,͉W,͉͉͉͉͉<Ή͉͉̉DΉR @-` ` /@-  Ѝ@-  Ѝ@-[  Ѝ@-  Ѝ@-O  Ѝ@-}  Ѝ@-  Ѝ@-=  Ѝp@-RMlVЍp@00 0oPP `:;P 0 ?>Չ'։@-9  Ѝ@-  Ѝ@-  Ѝ0QS -lQ  Q0 S 00S0\0S /䓀M-Pd@Pp dpT% `P (_` qTM _V__``PT MT00`CAᘀ嘠pDVMV t1`T\DpDTL0DV  4`[[[[[DO#[[-Ɋ[@-@0@ @TijjM-RHM@<pT P^@Pa`pGPW 0-S V',LP X& %cS qS`0SPpGLP X I ||IHЍ~PX  l W  2/P *V>  B`&P``V   @P/W|mKPZ  sW003? j  02/P*D D  P ̃ 9M@l0S ^. PWN @ځP  ŅP  @PW3 忁PW@d 0  R$ ŻQ  X0000 pG<R.00;P>QF W Q@!   0 0?R 0      0 BR\     Q [R0(100[ ; ]R  R R@!   D0]Q0 0 :塄P[! S :  W 00P 0  @ W 0gS0W0W0sS  @P ;n[ s[W4ᒁp F~0@nS_P0 RS PnR U I: 0&~@P 00sS06`PT @TQ0vSET Wp  @pTPPT  PWT!(2/W PPpG`TPTw0 hPTaS sS;Qpl@C@lS WP W@ @ gPPT0  0PP OeUPHQ ?AW ~X P& 6Q A.@TP }0@SAH$,D@DXAT tP |P17~0 3PXAXAQ xTlAX\+ PPPW pP˃P0hSSW00gS@dP @ T 1,1P0t 5O2/0\10L 10<1,0$1T0 1zU 0 1sT0$1l}g" APW00p 3@PW  p  0nGO (PH00pS}P1/rXC0 `}@P0000 0aS   p@ 0PDdSt e P Ҁ PoP À P@G@PWP>@ :PPEJF El P7W 'YGX 0l0,00S0W@dR։jZ։{։։։щ։׉w׉z׉׉׉؉׉ ؉:؉OQ؉:X؉r؉<($؉Ob։y։;؉؉؉؉؉؉؉؉н؉ىDى*ىAىWىnىىىىىىىډ ډDډ%ډ^ډ|ډډډ/R//@-o Ѝ@- Ѝ@-T Ѝ@-) Ѝ@- Ѝ7@-@P 0S 0S Ѝ0M-RM`ЍR@`p lo@DTQ P `PP*T0 0 T PPṣ 0S Z@ P @@dP'T0 0 T P  p@0 X P  P0P0PP&T| cPvPpd@l PH0T 8`[,X SP'T0 0 TL 3PFPnq娡 0Sv@c PU @Y@t&P%T#  Pp  00A[ $ZZPZ  ZP)pTpPTP㸠 Pp  0   gPpTpT$ۉp'ۉ9ۉGۉMۉSۉtۉxۉۉۉ]ۉۉۉۉۉۉ܉!܉N@-P` TMp@P#h 0R Q  R V    Y000@000P0 P  TЍ? 4-`M-R MRPp@P`  PwP U @  `xP @{@P ,kPYUP0F@ P  ЍMd0S T  oD@0X000x0`S P YU # P  000U 0S 0 00M 0F@0TU 0sS cS iS` 0☈@P t(d@ ЍtS` z``4@@p kV@  tV$  pw @V V@ p@OoByT hw@w ވ4f݉i݉݉݉݉݉݉ى݉&މRA-@PD`B paP 0 A//&(00S@-aX0/ᔕ#@-`P@P VpĎTT ЍP,tᑎPP l@߉߉߉@-P#P \ Ѝ7@-@PP0  Ѝ0@ Ѝ0A- `P@P$V` `PpXVpp`V  R 09P#@PU WoЍf|R@- tP0Hh @t@H4 r@P (TЍ0 ߉߉߉@-@ HtD0 H`\ zL@ PЍax0 00  zkkOkR@-4d}P0@  ,@0,@D, 0RЍ @4 P Rs@-@`P9@P  V P  00@PyЍpGORs@-@!`P @P  V 嫍 P 88W@ⵍ PMЍpGO0 .R0@/R 0S/RM- pЍp1嬱P1@`a@PP`?ov20S  s R2 <0T3s T!EUP ZPT0P0` RT  T0 0R  0= PZPX0 ڋpP  44p꜕m:|::W‰:u:GO|zM-`0BSЍM5_ P @ SPp7?ow20SP PU  P'wpP [ JQ  0000@Ћ P zH4P0 000彋 PЍm:OӉM-P1 M0R01`1@1P Ѝp  `P@W   ?ot20S   儌 R  PZ p1p#0  PP 0WU0`0 W UZp0 h0`d0@`0d0000 A^R08U,ꬕ8(GO;ARA- Ѝ@+'`qPP p@R?ou20S  P0 媊P  GOA-`0BS@Ѝ@P5Pp?ow20S@ ׋@T  XP0ES 0`⻊ P P@ `m:ORE-@ Ѝ`@PPp?ow20S@ 吋@T  @  E` p`0FSZ  PP0  P[PpGO`nRDA-MPpR@NP`?ov20S@ 9@T  Ѝ -P`1`#WO &@DP@P0Spd"Q.Rኸ F0U0C0P!V`1@@D0 t@Ḻ\ P HR0 ]PKލ<(xk..ȉp@-@PyP01@oU@ @ldd@PvRP R@Tu0|p w0Pp<( 8 M-,P`DPE @U U@PPPX MP _+RPP ZPR PpP  x:p@\6\p0@X D*P <RyP 7-RPЍ `P  xp@g5`5%@5 5% 5 # 555 5 *0 05% QP P`!Qpb Q_ p 0J00 0S+ QS w0 pGp`0SppCQG QpC Q0? {{w[ ?s0 Sw 4 pB_ Aqwpq' `x0 0Q0p" DZ`pG=0S1 ` 4@R0  ?R@3/00WʕQ V30?0p 0PQp P) 0cp0#000p 00N00*x3 00p/xd30S0 <303/SZ@0 <R0100SZ cr r000#20S0C000CSpI~SpD !Sp? pŸ Aq Sp5 `@P ?P@0S@p& $Sp A- S# p  NS p  1S p S p  "0 0 00~0p0000 00Y0000 0 0p0o00#0p0Y0 0p0 0pBZ1`00`FdpPP PpWV d0 ᪸ mt 0@@op}(Z`8 .Е4蕋䕋6 ̕앋ȕǕؕm /ȉ RM-,`0尰尠@0Pp 0Z@P p X P pg0 c0PPp@Ѝ @(R@-$@ >YR@-0 B0 0 1W ЍM-@0PM00405$04R(0( $R$*HP$ PU ( yPU  4 qPU 0 iPPЍ @$P00S S  T(P@PW0d0$p(0T0C#1L0 `VtZ,5@0(5H00808 L0R:0<0<0H d!0808 L0R~:`<0@ !U<`< L0R:L00L00@00808 L0R:0@00d808 L0R:0`d@08`8 L0R:t 0$ 0@p0(000C1 010 010000U 0 R`00V0@0S0OPp W000l0`,0 V \ 0ROP 0@0,`S  (EOP@`k80@ !800o801D0D @0R 8@ D0,qOP@80080g<0H !8`8 L0R:<0@ !<00<0b801D0D @0R 8 <0R 84@ D0IOP@w80080U80@ !@00@0800IT801D0D @0R 8@ D0)OP@W@00H080H !@00@0800804T@00H0801D0D H0R 8H D0OP@580a@00@080080  !!050 0R  00# p\ p^   P``@>UUUU(lRA-`0BS,pPW@ PtapZ``T``T HT.`F C@ ᆳIR>p@-`XPP9@P U0U0U00U0 R  BU0 R  BU0 R  B0S  /pM-p@P `XPP+ U10@xU`Ed`\*LPW @P< -RW `e } R@`ЍUW@UW@`UW@x`W X`UP@,`U,$u::::A:R }/R v/A-p0BS,WPP(0 @ X` 0P:U``r U @` UP`*R M-@W`P\Pp P P,L Ͳ/M-R@ M6PW@PD0DS !kp0`e0 `PpJ[ @ T0 S `E` 0 @ |`@ h ЍT T0 0 w0SPRp@|0pu7@-P@"0p -Rp Ѝ0p@-P @Q(0 Up@ M-RXMD@L7P 0`=087< 060,7070$70807090703 7p0<0nP0ӅU= 7 6U 9 8U Uw0 070S0 t<,P dJ XЍp09<0iS4U`@6@`vTZ;00:0@ ,:P@ :0$ 0;U:P@:P:ş,P   0$ | @t@rS6@' wSa6@De08PSS*!0 3>09P0  PuP 90R`S`S* @t@08pS!*l4< =  6 X4 T4 8 H4 9 @4 #84 44 t`  @8P 9P  PuP9 3R*@t@mS16@sc08PS#*0 4@0N9P4 0# 0 4R9P yv@sPuP90S*@t@ <DP80 S090 S$0Z06(00 Sz:@R@`0  9P  C0(0`@$0t R(0S050s@b 0$R  Q 3R㰀  0CX 0AS 0p0W:1`S 0PW% 0q"X 0"R@Q!T3 t Qp!  `pR >04T3,1(XT2R,0,,0S SXR  D<PuU8,8<40,(8$!ga%))O #|qVpHH '}- 61M;Ncs@-P`@ QЍp 0-R  R  00 R RM-P`Mp0`50(050,0408040<04000404040074@`FP00xS7P 80@(0,00S ( RwV $0SrV0PI`Ѝ0rV0pH wV'W Hpp00W= .,P, J @`00< 8@ 0KrP4 0kPpGW 0GSW6@P , (YPlV270<080z7P 80@,0(0T, (?P80 0S4p0SZ0 000;/P~P 0S 0 ( 0 ;/Pn 0PU 0S  0嚬P` 0PUP$p$p0SO80 P0S-pZ0 ,;/0S   LP Pi.0 $0 U \{ X 0SP/Ts P6(0rV$0,0080 0<0000040 0 wV t0$ `L0 H0 @0 80 00 (0 0 9TPLHD@X\/CJNp@-@`T)Pt?.0P d 0xQR@P :p0Aq ^1#!0,IPdppM-p`@ (QPP 0@DSV l0Rd0SP00DH 0 M/D(حx)Rp@-@ l`@RPPT@pt@P44 @ቇ@P@x)#=N7@-pPp@M`JP*?`?`P0 48 P0   5b 00 4;0A0 Rߍ Q 00C\ @-5M-@0%Ml8Wd50TSQL.X Dr00R40TR8",$ !˂(A,>tŸPP4 P( Q  2RG "@2Q" Gh"1 x20t"SYfPhP`g`O`G"<G 42V " h0?R GV G ! G!G 1Ua` {G  `|帠Ugp `Wvpp WX! h R& @]GV0@PP4a %ލQX _00r00R40TR8",wQ /G ,G@l0S S SaT%Q [\\#\K\Z\d\v\\lj[\\O[[\&]O[\\?\\[ ]][!]R1]6\W]k]B]]p@-`P@PH,@p讉PPU0 0Pe#R@-@0oRv0x)M-@M , `v40P0 0SlF@@Ѝ0S@p,@<PQ0@P CPP Z 1 0P  Z1 = PP @0T}F0S xFx#lqF\#0 D3DD8c8P 0@S @01$0S 3" @0A$0T 2"  uZP w@PW}3Fz Z0  P /P 8)Po   { ()PXDPT0 1B{0SN0 0 00@B0CA00 ᮫0S PG @0@(L P A  @0!$R$B0Z 0 @Z P0 S$@0$ Q@ $ AP P@0∁$ X!$ HpP@2 Pp@+ Pp@#lE6SXx)O^d ʼn*bQ[v))Q É BA-PRWll m\mP1@`PU&  EbpP8!1@i0S4@@P`pcP@P` 5@ 0f/ $_px)W7 @-L@6P Ea0P 0S (T Ex)R,A-@`p@PP 0 l&ᡇPX  bP40T, , T/x),\W7}R1A-@jpf` b딀@PP 0 pfP\ᭈ0 aP40T, , T/x)Z\W7p@-Pt0`@P 0SP@pV !ᒁP@ꇁx)|R)A-@ pP |@x`P 0 XU0 \aP80T0 0 }T/x)W7@-L@0S1P00,0DFP x)@- 0 @sMЍ|)M-`p@〠PWЍl@ ; R@50 0/0 S*@Pv;m;DOA-P`@tp@D0SЍX.8 $@@Dt;=p@-Pតۍ@P  t pUM-`@V @ R@Vp pネ@PHU V X0` !@018P: 8P <eP8 !@woA-MSWP@aqTUލ0SW80S 00000S ,LoPTT{y00CSBuTv\vdvvlvtv|vjgdQ _ \LQ WHT4Q.8 F<P@xtplhd`.7 K͉u=1L9`DP\lA-`0BSpP@X ]KP 0 DRU(0^p0A/|)حR'A-@P$  t"0SP8d`\p U0* 0%P  00P`/@-S o Ѝ ;M-@`M@  `'T@-PP  u@Tp" Tp  `@ 0P  0P |@᳌`Ѝ@ `$0XS@` c C431620 0 (_,0 P(p0040& 0S("ᣍP"K0)0 "; (0@T`0, (0 0, Pp@@ bPp (0@T`0, (0 , @Gn@-S Io Ѝ @-S  Ѝ ~M-PhM HpjU`@P  t H0800P$00  ?o2(0N0J80S0B0P0<0$0ESp Z0 E pZ,4 0,400, P 0000$0S`PP `Z`P 0vP PU0AP`P` 0|0 tpX$0S,[@h80SW0 (R$4(0<X!$  0,0(040\  00 pE00S00H00XL0 0 0,pT `d0 0 ჌0P004@PD`@0D 3$0S0 ppGpW$`( ,0 040 00 , ,0(040\00 00S00H00p 0-P  0<P p(0S! H00 06880S4 (\ 0 $0S B(\808 <0S`L H00 0A\QdTPXPXP@0 S@`D0`Xd0pD0db\ ,040 0$0 -X$0  t  `(0S 'Bᡊ0hЍ0000[p!&2YOGm:7[A-B`p_P< 0 S:$@@TP@@::M-@M0P8W,>a,|͉<aD>G,>N,>jD錉GDA> ;A-p`P@d QGP 0 DS U40Q 0A/-ح@-M P(dP  0h`@dp,@D 0, 0RЍH wT,00H 00,@,@D LOSR/@-@q<0P P  .{:PW 0P@0-S W0f @PT U0#02SЍ@z @P 0KW Pu:U:M-RPMPpb0Es0Sy@&#A$S].@%tFPPP@W HW`@ A@D HLP "@PW@`@PЍ0.\ B8$0 i P0 080BP0!$0  0S8DX8P0 H0D L58,᪣Pj (<rUW@R8 bP80PM8:@1G10lS& W@sU& p1G0*S DD00Sr0E?opGW20SrUq 8 Rb P$ 4NpGW@ PR8 bPW 8PWv00sSqq@C^RPrU8<900nSaSZb0C SVp@L@@@@@@@@`<wSGWE0 ,GE,4,0Up0 UppT@@ V05#* T1#Z %; @D0T0P  Q0#02ST`0D WD W0  ,u@W 0,P+ T+ 0S+0 ~ %@S;@`㈱0 ģ 8 ἣ0 008 4PpD4 @ 0姣 ֢ D ៣ 4 ΢D 0`@Tec@R ` pw # 3 ` @pw hh `   40p<D u:OU+OeA-P`H@B pBP 0S 0 A/30@-@0M 00 0xx0@@ WaXPPЍ0 00 000@0@0aIP3&M-hMPᑬ&p`6@hЍ 0 ⊬@P  X P0 ጬ@P 0 l P pW[@@P0   pm=m`mmRs@- 0PЍpPh@PW@?aP`0ST hT0}0T0P0S*a`Ef݉‰D iR@- R @WL `P <Z(00S RM`|ӉӉӉ0@-Ph0M00 ST00   0@ 0#PᑱP00Ѝ0Q ݉RA-@PD`B prAP 0 A//040@-RP4M R@@ pP ,@P@4Ѝ0l0d 0↵ P Hⲵ@⭵T+B H(VOe:M-PHM0@0!0,^@P @;P`(P0 2/p ,}P pW*` ,sPlw@00,d ,eP ,_PQ,R@HЍH(]>h4R@-@tP  P0  p@ P (`Ѝ[@ B V 7@-P V ^@P0S P  L? Ѝ0^P @aP 0 *fOf@-@ _P }^ P@ P0ЍWP  eeeRp@-`@RPjPPp@|P l00sp@Pp0V<0u8k00Sm 800Si !J!00P00H00< @00PH @! LDR 0U PS `QO $ $1/PIP P P!V8(0@ 1 000P00H08bP @<0+S@pp <0`T 0S W 1S C 0c`$ Q ]QPHP@`VZ0x4 3?2c@00;0P0'8 "6@ <c@, 0(0;0p,$0(0S00[0S 8 6[ &$ @JC  Pzß L0,5@@T@A(0Ci@D T, @!dP G{0, , d`$,!4 O04 FyP㰲 0  uP$00$0p`!qPh1T0   ល0!ZP  P P 0H @DH@@ 1 P _0H @+@H@ 1T |x`Q ؤ1/P 0 @@@ HT4b,gPV HP P@PN5^RP M@PH XQPU \Q 0T 05/@P30@1/^hZbp'ԊsQ`}MbDVɉ#Rp@-P@ XPH7>Pp , P p@f 0꧅IlRqM-RpP`EӐM|U@  0 DPP0 D00$0 0D00 Q P  ЍijP P) 4űP ᕲ <Ͽ@ A   @0 Q P៳P  P XT4<Ͽ  ଜ00@/ᠥ䥉/F8 R@-0 B0 0 ; ЍA-` @*R)@PTlTd㛿p6@PHm  00q VM-(PUp0@  000 U `C Ѝ 嵿PJV 000C S\5`U U   B  K ,י0@D00M-&ML2 0` #KPd2 ?P   08 @ D2 0( H  1CР@!v@28" 0CP2 P0 B#K@HPD2S^ H0S 0T2 0X2 پL2 R4 :<t0p\ ?K 0S `;rK40X\ Cpwp:W@42P0X20P`"T2 B@KU0P@2 d2S D2H0 Kh2 Ph2H\"S 0 F00000L?K AK3`PHKjjj@-PPRM,M `p@ᨽP$uR܍,ЍTI@P d P |a (R<@00 00:/(2P,( I(QjhcccRA-`ЍP@= P;PT00T0ST @x'`4ЍAP00 ݽP ~`T P d`P x4` 0x0p @!+SH`޽.5P  }ች`P 44`/S$S%0C Sܸȸ^S |S dnk$GVE-`0|RDM00pSh20@ \b QQP@R@?@@ ,2(:Q@0.S0@SW 1W   Q 00As0 S 70As0S W0As0S\<@DЍ2s0 00@ 1@1!p 0p SP 0 00 0000 填PP00 0@P Pကp 00BU lXP괖@B1DRp}ObE-RDMDЍE_:`@PPP`FP@VV`pPDЍVp<`4 8P0  2P0  ,P 0 `0000 0P0000 `0$%P | $P\|$H $E@$@TwB HzuV@-M Pp@ `P 0 00 P00ЍA-RP &  0 0A 0;@`P4(<npj?P}?4&_:V$C<*$ ЍMb//RM-p@`BP0ಟ0S P0ȻP0"" 0[@oЍ C R񟗄,@P`t(\ѻOoBWOoBX{ @@@0pp»@P@咻去劻O养P@@ 7 @2@DOoB * @%@T@  @T@@  @ T@@Ө  @T  @T@@0Y@S S S0pg `V Qg MXZT@@L@- 0 @a9Ѝ4$00S@-5/ĖܣR@- ڃX @WP8 $00SĖӉs@-UPPP0D`@,@D0, 0RЍp0 ,@,@D&A-`0BSpP@X :8P 0 DRU(0^p0A/4حp@-P@PpU 80Ǻ&p$pPp Ė;@-qP40坺&p$P Ė`@-[P40w&p$P Ė$RA-@`P@@P -Vp  @L@ 0&p@,c@ЍP  ZĖs@-@RP@ R @`0 FN@P@ 8Ѝpȉ P0 PƁ ǁƁƁǁǁǁƁǁǁǁT/P SL/D/@/</8/4/0/ /$/Om-;KS`d}Pp@-P@ P P p@U U T T Tp@ڿPE׿UȁHȁPȁXȁ`ȁhȁ̿ʿTx PTp Td`\XTP k{c!1S/A-@Q!g 0 #4p叿ኹP(H`% 0 儿1S& !|y10 S0#!!pC/0 !B ! #4XeЍ^PZP!'U0MZOeE-@MPD`C, _Qp, SQ@P, P PB,9HQxPC , ]QV)X 0 Ct" W | 0 0`0!00CS4!4!!1,0 Pp(H` 0 `, P PЍQP pP PPD0 O@P PP PP PP ~00 PZA;X1R^nD@-@ M  4 f Ѝ@-@ x TPЍD0 T_PP D0 [O4/Q/@-M?@?@< P剾ݍM-P偾1@!  10010r1S pm`h@1SDЍM_4\ !(X$V#!"!SP$1S K$F`ܰJ%1 S@*0  5+10S S S)0$+10S.h, ` p\9+OrFOUX R։!@-@]v, OPЍD0 PP PP OP NP O7@-P z}RP0@ Ѝ0D0,@0,@D, 0RN0S OP D0~OxN0S)@-HPe$0(6ṔR/p@-\P M@tP <30S0厽Ѝp dP傽 ZPU !-t20S{  GP0, =PUý@lRp@P\v H #PnUӳ嫽P\`P 7 埽 9PP0SSESF0C SӁӁӁӁӁӁӁӁӁӁӁӁӁӁf0Cs Rpl @U) X0h #0dTuP$  p @@@@ݼ0h 0ռF 家PЍp@e#x |0Ѝp@+ĉs{)9Z=@ρl a)B^(6@- ЍM-`@3p M4@WW@ WP `\P PI F+ P` r 2RPPg Ѝ00Sd 000S0W0S <S0S (MCP FJU%*0 IWHQ; Q\ [  ,v P  P  [WP 0S ڻPP 0 oP4 0P000p@T*??}TP1X#0 =p@Dջ 0⤥P `O8 ɉ'V$$yɉ;ɉ$VɉNL$%^I%&'& ȉ@-P@P x`xp@0S PP],@ Ѝ P gPPip@-PP(M@(Ѝp`P Z@Pu0P}SᣵPP l@ e @ŵ>0P  B f4Oo0B@d0,m M-@"MM1!R@BB"ݍЍP00 X/0S />0008@50p @@ T h Ẵ `  R p 7/P `xh x M-(M@` 0@,P$pPPPPPVC 0P0 (Ѝ00#PP'@ % ,P ᰶPƺ|1P00t+DִP д0@ ;R  000`Vvxo-P PPpPc PkoPp P00墴Pf DE 2+DPZ P0$09P /0 $00 T< L+P P0 00 $00 ;  0P0*fpP p7`XxPH0 0*H  0;S~P00>$P ** *- 屳*y ⊭ ⇭ϳP 0S h HP**00iiiiiiji]‰ĉ\ĉ7jiM-@0BSM K`<0pS X ŹK6PP0 帹t决Pd对B@+P{VP'<壹0K圀K唀 0 K0KP pL pI PE匹p` 0[QB@?*=*T{MPBp@[WD$?@?@@@0K `M 嘀 塀K00K KcG@P?@ p 4[ KdB@*РQp PРGDp0K [00B@))P90!0 1RC| x@ ` V p$ @ K4/@P KP(PP{PvKPq7p W`ƲP@徲P#K`?@PTVK ]l۸Z:S{LމiމpމԊމމމމɉމ߉߉xh x߉.߉A߉U߉w߉h߉r߉4-///@-0@S( 3/P嬸c@-P @ p}0A-p y@P吸z@aPPEh h倸 xPPPx @s 0x@PiZbno@oHoOop@-@gfCPP Q@@0 7DT HpDppteHo@-`p M@a?f`C0S` XXP L' ЍЀ|00 0`OPe݈f@-@PMpAj`P f P t0PppЍ\\P PJ00 0@P:[lj+:݈܊?:A-jPPַz@e@P 0PȷjpPx@|Q`PPo0 CU (嬷@娷:[lj+:5teHo@-`p M@a3P|xB0S`卷 ЍЀ LL'PD00 0`P݈)@-0A8 ////M-R M+ P+@U  U   CP` pP `VP|0 ЍqP `P pW@4aP 0 0S 3/0P0 \Q  08 0 Sq AqRt 0xQ$S Hܶ0C Z R жJ ɶ!@Q 0庠0S 0 @ R  (0 SR S:嬶0S  ⢒P @p` 0PH嘶` ⎒P@pXZP  偶wt 0 w|`T4L@X@@T Q  S 0St* 3/P'`Ήe:Q 6tΉΉΉΉω Љ/ωiωωωωX7xщ6ЉlЉЉ#щGkЉOщA-pQ` -R Pl @0d00`FV fSp 0S 0A ,PPP ;P@-PRA-@PD`B pX-P 0 A//900@-PP,M 0 0  0P  (0դ@T \ܵ@,Ѝ0 <PPP0 @P$&ȵ@Pcn RA-@P0 -R0aS@DP p`lV@ TP /<壵@P瘵p`ՉՉM- M0 ` 0 P HX= @ -RF S4{ [ZXpG BPB յX@eUPQ T\ @Dp 㶆0PY $ ЍdR bR cR rR tRSN0 SI0 R@S@0P`U@ 0 R0S @T@ X`&0 0 0@PPx0xU`&0PC0 0U`&000(hԉ\Չ=ՉԉԉԉP_ՉՉ@- L\@-T ^  h@T aT fT @R, \^ *ӉR-0,M00< 0  00 (0靣o,Ѝ/PE-`,MVP0-S =ᆮ@PX(T!V0000Sp (唤0,Ѝ`F0S fS9opV@%pPf0   BQ PWCh0P0000p0 (0;%0S(0 =꓁ ;PɁぉR-0@-@0AMMAލЍ00PP0 l  `FP0L Q  i0 P 0/kӉ߉R V/0/ ;@-P000 00 Q, 0S  ;Ѝ߉M-@ p P@M` BR'-Q. 2U  >W`F@A P `t@0 P0`1`尳@ЍsQ bQ cQ tQZA pZ= pQ @Z4 V@ЍM+ @P  f pX0@O0 0`P P@ 0⼣`PX U  EÄ $ PӉ.ԉȉ2ԉ! @/@-,@ʇL@@-*H"P ,*mb*P l**@22?C/ /@- @x$||0t!t | l| d| \ | T| L| D|!0P008!@ P Rp@-@Pp@J ZP \CP p爉0/p@-@Pp0$S`0P  0P@?S D0 <-pPU PpɚRp@-`P|P@pTpP @  0PU  p@ 0PS p@ M-!00 p;=`P @00@T0@  éP2 @T9!PP6 P .W0Sp@W0S00 @p @ 0ZP@勩P 0S 尯@꓀ M-@P` ᔩpPX ᙩ@8 ` ႩPTЍU G  @'`pj  :dP+ GPP8 PP40S ] Z P X 0 : > PX:  U!0P0000-S =S0 +S00+P [X:   0pS ``@Ṩ P`@২`lp*A-PP@M% @T" p P㬀@ 0S Y`ከᖨ0@0 0`)@tD0@Ѝ0@0 0P@OM-0@8MS `Pp0(0$00 0009 R Q R Q 0R RS 7 p8Ѝ00CS (0P00 S0000000VPPU 0 PPUP0S@@T 00C0? 0 SR 0SN0S Z00ZL 000(0R,0J$0$0P$0=0(0 0$ 00P0Uj(0$ 0 `P  0 B/oS" Rf?o 2QQa R00S~0 0 0 S SW0SD `o^P0S$0 0S  SP 0PC0`a 00l,0 U`F(照瑧 癧,00 000P 0  0S 8$S 0  PU p 0 S0S0000000Sp3p 00S 0pS `Pa,0_pP,0ooXb`V; P깧=`wP?0`g00S 2P0P2 00S 0S `Ppp`G01S 00C0p1,00140`P40 RV 0pP0` 0S0S0000,0Hp0,0[)0 %1pwI0!pCpp0 j04p,0VP` P度0S <崦 ᱦ40p0S 婦0,00[ `;ڦP  ,06 00PA&x0p 00Sp 0S?o2 0R00W 0 W0 0 ` /eDp0ЍLp@-080/ 0 @8  B8 8 . 8 8 H /H0A8C0H0//@-G@-0  80,5CL0P~ 00   p R @-pll0 2/~p l /l嚉@-Re@-   @F*@-g>P@軕////////////@-Q @-H L B H H L P~/l R l  2/  t tH  B H H tp /H0P>  0\@0U7?>3?001qpP373?p0 @M-@ pP0 `0S* {|@ `X P6o4O`@`@4OA-PR`p@ u>T0 K9P003?0M-HMPp`0m:@P(0$ $ 0BS(0S &8 彧HЍ!8i|L:0P0 $08 0S:000, ,0HS00S 0 (00 40$8`P 4@T08 0@4OZ*!80{ 08gP 0@$(0@pp0  1Gq0[4p 08Qp@0 pG`! 8|zIM- P`p$L9@PZ 0  M< 0 P8P@A-`pP7p  =P@: 0  i7@-P5@P:\T@P@ Ѝ00 Y<@P: M-Q M@ Ѝp`x!P@P67 X 0 7 SR;0F 0;P:Ħ @I=P7 0p <pP6o` 0<P@:h埦H 0p;pP6o`l:勦@}̉R#]͉s@-P4@PX:w A@P`P i0p ;`P@:\_@ЍpHV400 ;@P@,:}͉̉%47@-@PP : 0 Ѝ0@2 Ѝ0ډE-SpLM0 00%@LЍP`4@P9  @P000 c;P0H9  @\  ! \ 0 D 0>;@P9( @{/@- 0 ЍM-(M@7P\`tql76PU<QN0 6 P 募P- {P/G}P!  P-  R& [0 0 0@00 0t 8`N6P 匦p P 4R X(Ѝ 0ʼn#@-`PM% P5@pT 0 5 SVZ: A<Ͽ2/ @V0@@N@@D4?P0Ѝ@0 @0:P 2/ =;0E0BM-P@` M℁ T Ѝ 0t6pP 0SI`7@V 0  `0FSX P5 0 0 CR R! R100H0`0a 0X3?*@0 R7P崤zI@-02/ 0 0:Ѝs@-P`6P@G6Pt8H哤Ѝp PPf8 儤@_{p@- @P7Pp@Q8 op7@-@QRP R Rp]h0X 9@ Ѝ0DP800J$0F@4p@-@T9pP2`P8h. v1Q H%03?S ,1$00p#NlOp@-PP<`@ 4 @p֝P @T4 0000 /@-?@P gx@@p@-@P ,0S 00S PP 8ԣp,0 @00 @ R@pk3P 0 0 00Q0/M-|`|@Tp⫣Pd4pX   堣 0S 0嚣P U@ ᓣ=3D OE3@-@yP 0 偣v4p@-@P@P GPpP p0/A-`ppPU`\@40S 0S "P@@ TPO3 0P/A-P`@P0 ,p7/Ps@-@P`P `0 0`6/Ѝpp@-PPPL`@T @<0Qp0p@@L4Z4O`4A-`P 0pP Ѝ?@T  0P0!50Q20 0@- 0P Ӣ Ѝ P3#47@-@PP  Ѝ0 0~P/0S   0 pP 0   0eP d埢`坢 0YP <^0 0 d  444447@-@PP  0:P 02P lj /0S   , Ѝ0   0 P0   0PX 0P 8 0 0  3433330!!" -1,*+10 1|/1 R/|0S|/0@-MPU: G? ) )0 !) @P 9SPU9S Ѝ0@-h00Čd00$r  Ѝ@-MGP?P`0 pPP@<ġߍ $彡@  kv@@- @R010h01 S|00# S" S0 圡0R00@Sh|  P㜜@S0h000Z{E-@`pPXM0h d0080s0 00 QPPUЍ@-r` qP  p@P0 00P0 00P0S0S0d R0 R  S00SP Ѝ蓀Sp@-ɀ@[PPp9PESU)0  Pp/7|/@-w0@h`K?M000 0 ```PP o t07t0l07l0Ѝp@- `MG@?@q 0`PPP  Ѝp张@-@00q P40Ѝp@-0PGAMTʄ墠 `V &1S00hqČ}?00r 00 0 qЍpQRA-P  pS00S M0(?@R`?@ 0 P"0S08090 P0pG@ ݍ0@S?00T00 QS1:   M- M@b`PJ\pP?@?CPP 0 lpP !B? ` ЍP p`Qf Rpat a `pE?0 SQ  R7 0Rc R' Q4 Rd0 S! aV P1Ui`aF 0 1Gt0F+%10&10pv 0F#&! &! A 8帟S(-v * 0 %Z姟%J!  0Ot0 K?0 $ "$ Q S 0ZO n /t D`0VP0hd000 000! N`P )[`=l`p`h(p sHP s sQ 0 Q 0 Q 0 ;a{ 1Xv0A-pM0P`o@P Ѝ[@PXid0p00wp  000p@P@V ЍA5@P /A-@p`,Y/0S00$90zP $Ξ000/P@@-d0h00Čqr 00 #0 Ѝd0@-M\*)@h00Čr 0 0Ѝ@-d0h00Čqr 00 #0 tЍ/@-0zPp@-0hMČd0 0@0 q 0 0PW`P, P 1S 0 $ 0< <0#40ЍpM-M??`p P@PI@ j@>TPp㿀? i@P, > P@pWȰ@| {< S   S   S  , 0Ě@P gt܍:M-P.M, .@P `?` P9Pp W p 0P r 040#40 Or  Kr0 01S 0 0  S 000 90 t1S P0<0`0@S{ pSs S45n 0h d000 00` P&00?~, `P0,980pY ` pp 9VqYP Wp1RdWd` 9Vb`Ts 9VbH0S00,3@T 0 0C#0 0S /0Ps:_0?` PU!0Pe:0 0 0[`Sh:@01S27p`P 8`1SV0hv`d000 000 0`P.ލ` C`}P PP0  p0` 0Რ0 000ė 0P:   00 0@ 0{  7  1S .p  %00SP ^0  h   q   R $嘜V00D< @-N-@9 R  /@-@M0h}?00 00  0 !0\P09hz 0h0b8n 0h0W cЍIp@-(MP@ p410hP}?0 0P 00 0!0PXB 0h0<`* 0h0!(Ѝp`M- 0@Ph!!0R30MD 0G@A@0`04 0G@ApWM   2 0 0 W00}?0,00 0$ `$ 9S< 1 00 9,0Z`09 00S0 0h}?00 000 !0`PI 0h0I0Ѝ,0Z [0K ,0Z 0pW60s@-00@0%0 0$0` o_0S 㓖PU0S dxP 0S 0SS P`Ѝp1S S }M-@Pp MG`?`; 0Sip 1#4L01M01SPB [ 09,03/ݍ 0S/ o00020000@00僠 0S[09 B0S$R W "M  L @ 0SSS S X M D L @ $  pPp@-\@P `So00020000@00 00003/`p@M-pRMM `@Q*,y+㵖婖0A `S(< UzP& 0X80%40000  `o 0* 00 00 0 0" 0/ 0 lP2/P    00S0 pGmtЍ Z`@M-pRMM `@)i,+YM0A `S(< UzP& 0X80%40000  `n 0( 00 00 0 0" 0/ 0 lP2/P    @00S0 pGЍ Z`@@-}? h00Č 00 0ЍM-<"0@ᣁ 0RMX'0 pwh0tp`1?`000003 00 0 Pn}?0 00q0 PCX0O?є `0gd0h 00`aS ` X}/  P 9 X  Pp} 00 0 op' 9 wPpP P0R0 0CS 0S Q03ލ6(USBCUSBSs@-x$PP`PU<XЍp(@P{P$gu 0 /$P@-(>$@$:P`$A-XD`&!1PSp="10CS9@8 mpP"1 0#1S 0%PS&!1W!,000 !R  TP 0S 0S 0S 0S 0AS !1Ѝ+! R*   +! R*!  .!% 0  Q %0S0%00 h0 T0$9,P0 S47:03I\_@U$YV$UM-`P BMBǠ?㈠0 0 00 m000僰20$000003/pP XT偘pB0S L0:S M0L Br 0S Bߍ~Z1 320 S0 0ŵ m E m  Zm0 〱$0U0^0  l0 20 0 0 00 3/P0Gp0?p0 p l0  0l% 僰"   0 2/P 00S- 000 02/  3?|    d0!QS030#!2p0 }@U  E̪M-M(P, \' `PJ 0h_@}?00?@ 0@000 pP0  ⏗0 000<000, x0 6$@P<'0 0 pP 000L$@P 㗓Ѝ/@PpW@,彈@P {/P@g$0P/\/M-pᜑP @,WPP@P` Ѝ,E@P 00 P@  `P 0P 0H@ 0 0P0  PP01@ 0R0 T PT T0aA U!T#PA-`P! p @PTX P @PP@T @ᴐP U0 @PQPM-MU (0@S 0`S#0S0AG x0S 3/p 0PS0S9  8P, 0W 壖P Rc Q0P2/P 0 PCZoUP 00ptyۍ3/P 0W P 0 PC80U0P0S 3iOM-PP: `p @ Z @P {P V P@PZ p P [ 0 @p$0 $  0 (00(0A-P,p`d@P 0 U  0 p` (0 3P@P 0 0$0A-@PP 0` pCP 0`SP  Tj0Q R R  / /np R  / P Pn Re BQppqqqOP[P1      /1@Qdqdqdqdqppdqdqppppppppq\qHqLqprpq / [Q0P ~P1AQqprrppqr 2Q0@Q~P    P  / /A-QPp` @ Q$ BQA BT@@@DT D0p P 000@T0p  000lM-`0PS 0Q@ S㤠pA 00C0 00C00XdW00C00 S0000P_ RM-0p0P8M ,@0S(0 (0((0(0S 00W y000妎`$VA`$T00S _B 1# }P6 p$ P3=0@g00S!S 60&0S00S0&000 6 8Ѝ;P00 0XP *\ P0@SwLw{hwx(w0zvy0zw0z0zx8xx0z0z0z0zPx0z0zPx0SQ 0AK00  0傎 0   ZJKmJZe0Za* \ZY J QQ*JZ 0  0K 0   [*:Z6*$ AՓ00CZ0:* Q 0J0$*8œ`&JzZQ $嵓n00CS0 P0S  Cr #   R30RSX# S D00S000R ,#Z [Q tP  ࢟K&"f00CS0 Z:0 0S  0  P 00 0C 00;0P0 P 0 4@$<:p` V Vzzz{zzzz|zp{zzp{V8 VD V- 3 RO VD00\$0 P @@$0<0$000$0` 00 000D00 $00C$0$0S0@ 0 0$ 0@S0 S 0$ @$00$00`0z@L<XDlO2_ R6  M-M@Ppᢌ0$ PUPUiPDh\QS`@'V \K`PE/\V \ [@N \`S S# \Q'V00S0'`$VQ`PE( 0 {V(V000 UP `@PE@ p}V)V  0HCQ S0;0CP$ @0pp0PE0S U00ۍ0M-`Pdpdd01S1AT<0S 3/P0@PA-P`@88p1S1P00S 3/@A-P`@88p1S1P40S 3/@A-P@4p4`1S1P80S 3/@A-p@P`ᕋP |吋P h劋P 0 U 09P塑MMMJ M-P`p@㈠刀1S1[0 D#g0@?o20F?o4 2R0S  2/@H?o2A-`P@<0 $0@vAލЍ@Ѝ/0Y/  fx R/0 +gv0Y/  @-@@PQx R/0 +Wv0Y/  / R/0 3UvP/0 Vvp@-@8PP@03/0p0pP/0 5v@-@xP(0S 3/@-@jP,0S@/P/-0@-AMMB>0P$$0咐@AލЍ0@ Ѝ/P00S /0S @-P P0s@-P P`@pQ0 S `V J hiPЍp @^P  ,XP  Roꩦ 0 /0/ 0 /@-@P0p@-P@0P@P" U Y0Pp UA U p|P| H|< |4|,| $0x8xЂLLj-M  P xЍ 0 0/M- | | | x | p|0h! ԡp\ѡTΡ `P@r pnpjw. Vt`U T [hTP PO|\@G\TU@TV 9000t\M\\0\聂MMp@-P`P@P `d000S$00S:Ppp cp@-`0PPN@@DN@JD T00Pdp 0@SH00@8p0$ PEPP00C0pX<P<!PQ/p@-@ Ÿ 0@P`U@T 0C   010^p81p@T 0C Q  Q DP00  p Q p R*    A 1 0p R"182:Q[ TQ"nUQwTQ~"|^ @ A! 0^ R: X<T< `<  @%  /P 0SM-U`~V*  BP1 R00 0 0 0   8`4?0 S&380S[0 TS&6n0US7w0T%S~0&9|0 !BP   B\0C0P3 N\00 0  0\ 0 00\000 ^*!B L  C\ :00. Ap Pp000 0BP HR434#@0@sJ@N@@Upp ["Z000q G2p00cp@0CN@N@@5p "@00Zp0z X 0  0 H000X0  iof ^$.#18 2:R[ TR.&n UR'w TER~ .)| @AqW B!Œ p@ i@W   R p0  fLX00 0 00  0 "X 000 0 0 I0CPK O0  ;0000h0@@@l d00S0X S00   BR0000X<`< P<A-0`p@r?o2?P& P # @ pGo Rrp#W  B$RR R00 $R0 0 0 00000oaX<M-@QpTM50  0SP` VD3 ^pQ+ A 0p0 00 [ 0 0 0 HQ0 00000bp vPRPJk ^ 7 Rdp   F$R'R R @ $R   @  @ H  00 00ua1[- 0 0  0 0  F$RR0R00 0@ 0$R0 000@00 0@000000`wU [vpP7 0 G00Sf  F$R!R0 0R00 00 0$R0 0  0000 0   `<000F cX<A-pQ+0 AxP`A+P `!`3X!PP@PQ @FPP FT*x@Q@E pF0fpppG0GS0p@G00C  0   00@@W@000CS000000H@ * /0 00C 0a0@ Q*@-r   /᳅0/A-Hp`P0@P 00p充`P400 0 8R8 <0@-@80< S0 8@<@ /A- @(T 3 ؀8@DT. 8` # P0SP#0 0 004 03/(0, 0 (0,   P$0 r$*@Qp0@0V8@F080ЍY/P 8@P /8DP 8@T@-0@-RM_ 00C@PT0P@ 0R @03/P Ѝ0  Q 0@U 2/P hxh A-p`P @P p `P0@@0 /P0@-0>/Pʰ0@-02/@-@ [@-@00@-@00@-@ %@-@ RV@- Vp@-h@PMPp@-@ RL@- Lp@-\@ePFPpM-P`@4p؃P@T\`@M-HMh0lSS@@TPVR p@P ,މ@P0 S@HЍ@ 0`P@-0fS\  ESP  L SD  89S 0a0( Ѝ xS{lTrTdTuTgT0@-P@|M PL0S@T@|Ѝ0A-p@P0<0S `J0S  SPC0 0A/%M-p@P0<0S `+0S  SPC0 0M/%M-p@P0<0S ` 0S  SPC0 0M/%@-@sPPg@A-MP`dP&@p圀0 tP@ 0my 0xP x 0@S VP #@TЍ PPM-`@PP* 0<0S% 'PP ppp0 00 P0 ;/T`0 00 @Ѝ%@A-@P`pP 0<0S M 0 A/%1US)p@-1PS&0s/ R R0PS @S@QPp D6xPp (RxP dp/p[_H-0?0?0@0M?P?P0 @g P K`Pd0S1Sd`h0M-p`ᾡM@0 V?0?0@0M?0?0k~K $0  : P $0  [~!UPR Q!  P2No\^) Q  \^% <0 0800 080 /,w0 0C?o20R0L0 0P}0u0Q \  \^ `PUP \UPP0 Q80 RPP0(00  Q1!0  0#1Z>0?PQ%QIQQaQQQ'R{vRKR-|M0 |Ѝ@-M0 @p\<|ЍP8|PH`4p00 pP-|0 pS&TIT0H @-<00S @.0 $R00$0H-@PD$?@?@@@M?`?@0 P?VP1 U: Qo?0QP 0R@K@-@P   MP ?vPЍA-@0 $0X 04 '`8! ̃" $ %Qt$&(!#l RR( U$! %(" $0S$S8&0&,<#% p P'01 00542 83 <4 0$6H0(7,S IS#0 $0(0,048<SR+  TP$dQ ,K8'O ,KuP 0 d0hROQ0P`U dR0hS0lT04V 8W < 00K1Sdh0`Fc됈!@P [I0H`J0K0 BV %Q P0U4R 8S  p@-pPP0@,`,`F0, 0R Ѝ0S ,0@,`C P 0P PPA-`p@\@ PP PQPVPR:PU: W @@\H 000B!G 000 A@M-P q ,0R(0,: R) R @   AQ*v   RP ЍMh @PЍ0  0PNG @@   @ AM-`p儰@PTv 0 :800C0@PP0S 0S U@0 A@p@-@@` 0PS0S 0 `P00p@@-@ G000@p@-PPp0 04@0<@D< 40Rp<@0Q < 00S //7@-P@ P000<00S 3/P Ѝ0 RR  !0@-@0TM0PL$ q PTЍ0认0@-TMP@0"( (_ 0P0TЍ0认礉L0p@-@0 QP % Pp p@껤L0P 0S 0<00S //%/p@-@P 0S 0<`0S Pd0p@/pp%p0P 0S 0<00S //%/M-PLHMP@`@Q@@T HЍ0! pPСбW/L~ P 10CpP   0L~ PZG(@0SNQ L0 NPE PV(1Q1(0 ;p@P x 0-/P PV 0U  sU|&00? Q t UPꮤǤޤ@-l0P 0S 0<00S //%// /@-h p@- @P$L  &0P0p螤@-@S@-K@ p0 娉$0p@-P= @`P  $Lr  Lm $p艤L0S/p@-`P4@<@D<0SpPp<@  ?p@-?@@PP  EQCpT@-@P@  xp@-@P @  mp@-@P@  bp~M-0X00R`pP PP{P@P Pu 404080,0,000(0p0,0 l$ (ЍZ T D@[$ [ P FfP [ 00   `p P \\l W 00 0S P@  pp~--A-pQP kP@TU p5lЍmUP 0 m0P0U0S``OP@8ĉp@-`Q@LD0  7P pP 0@04PP 0S,0C0Ѝ0 0,0  S,0C0/7@-@PUP Ѝ0P E-0`Q@0 p@PP  Ѝ @d@P[dWP ,P,PE,0 S@p@-P`@Kd0 p@@-0@D  l R lV0 , B,QH P, L0q7@-0 Ѝ0@PP 0,0C,Q HQ0 ,0L07@-@Q0 Ѝ0PP0,0C, ^ LT0 ,0B07@-@Q0 Ѝ0PP0,0C, ^ LQ0 ,0Bp@-@0P0L P p@ps@-`PiP0@,@D Ѝp RP@,@A ,RQp@-P@PPp/0@-@0  Ѝ@0@-@0 = Ѝ@0@-@0 Y Ѝ@0@-@0 h Ѝ@0@-@0 v Ѝ@0@-@0 O Ѝ@@-@000x Ѝ@@-@Ѝ@@-00 Ѝ0@-0@P0S@Y@-@P0S@-P0S@ET P/d000CdQ/0L 0, 0,00 0S 000S/@-@3/P 00, 0 0,000 00 0S //0 ,0 ,0/@- 0@00S P 00 0S @/3/P @-0@S 000S  00$0S 3/P @/ 000S //@-b@0SЍoP@@-4P 0,0C ,0A,S Ѝ@-0 Lt0 ЍQ00P0S! 0p@-`P@ R60P P @` 0 0pP Rp/ pQ00P0S @-0 S@T @T00/Q  P R  0P / P/@-^ ^@ 0 @@p@-@PF D0C@A 00S8<PP6PP2D0 k4D0 x/D0 d$PP0S @0< 0 ^ `P T0 D!DPLL P4  2 `0 !00] 2$0P 0S0 S0 ҅S(S0 fPPT 0 x]` 0d ]P( ( XP 0 `0TnUyU|OOTTUUUs@-`PR$0@N 0R0B1 S 3 #81S41 B2s2 Bs00BQ0CUC0 @P V80 ,0, ,,]Ѝp@PTE@{nUyU]U@-@@00_ 4p@-@P40 T   p@-@'0_0p@-@P0 ĠU      p@-@  0p@-P `@ $L H ,]@p==@-@/TT 00@DTDP00S0S0p@-SP @ S STpT@`Pp@pT0@/@-P^s@-@`PuT0@DT@DTSSSS0U0000 BЍp 0@0000S0U4S$ s00  p@-@P`{PpP p@^p7@-@P./TT0 0 0 P@D0 Ѝ00@DT00S0 PP@-Pp50` @P s\ Ѝ0 0 wPP00 @a\@4000 R@00000 0@-@ ^Q1\  0L10S*0b0@-0P<`p0@SM0S%3/&p Ѝ0B@p@0 0 03/s@-@00PL07@H`TЍp P0 R05)@#7M-(M@p`tP0<0S% 0( fP0<T(Ѝ 0 zP0 0 0000 00$003/PP 0]P  T 000200X  B 0B"3/M-`MP@`0<0S%p 0' @`0<Up`Ѝ0 "P$0 $ `0 0T C0 3/pP@p@Up@P p@  00 00/ 0 3/ Tp p@-@PD0<00S  p@/%pA-(M` @pP0 ZKUPP @  0S@P @4@P0  0 0R$@P0 (Ѝ 0##p@-@00P`Pp0p@ A-0@pW*!  0r P`F/ ' Ѝ \A 00_0_@0 (0V  XP@ _  pP  _ `FvZ 0@ R @p`R0FS  RWG 0 _ _(  p 0_0_( p} p@-P @L0P0pp@-@00P4P 0p@4 p#M-`L@T3#0pQPQQQP PPPP 0Q~Q{QxQuQ 00 0(P@ Ѝ##@-@80 < ^  0@/%@-@'0 < ^  0@/%A-Pp@`@P@T@M-Pp+00<0S%@ `@P  03/@T@M-Pp 00<0S%@ `@P  03/@T@@-@000 Ѝs@-P@`: <0  R  % r  0 Ѝp8?p@-P@ `<LP $06 0S0pp8?@-@0S s@-P0`@0@0 b0S ЍpA-P`p@ V P@Dt0@- M000Q@ 0 00 800"01 0 8 P000 Ѝ@-@ MQ   & @P}Q Ѝ7@-@Q&m\m\mhmtmtmtmtm0 00tgoPK P Ѝ00010 I1  0 P@-@:P p@ UV9 P0/L8 0@- M0006@8 00 dP00 ЍQRp@-j@PTA}O@Q M kQ@4($0  @0PP/`P&p0 0P  , R dQPP:m0 Ѝp0@-/@Pc&p|pP   < S HUE ЍT`DP@@TUm@990S 0-$M00  0P$Ѝ/M-`0MpHVP `@P  P Q U`0ЍtP  [ P1 P!0U 3 #0Q0!t    P0 PU  P 4iU Ut [(p h550-4M1000,00  004Ѝ0@-0 PRMߍ0?@?@P 0R I 0R 0R 0R OP @p@-Q`P M 00AS@0 @PPU ?P?PP@ 0R@ ݍpE-04#4?7SM?P?P@pP0S 3P p ,)0Sp"2Q0/$+Ġ56;s" 25 5Q0Յj0ą0 CR0k0 `f 0S iQ  g 800008000 p0Pxt0PpQ ?007pݠ嚃7#96ሉ0 ^Q( 0$(0 023")&90 ?Q- 0 npP P8 0044;$-0 0\005L0S%203#0000500S``V ?4;$*0 c500h00S2x0pߍ?0I@@0 %0Q0  S0 M-`Ppqi0 0 0 @P pWUtb@ M-R'M + 4P0#Sf0000S{@'ލ@T po`W?`- mQp00mQ pS@0S040 0 0 0001 0lQ 0  SppS 0 0;s00[0S 0 .@P 0$(0 Z \}S 0    qPZ 0&w0 US@q 0Sn 0 0 OPK00050 123x Ks0r >PD[173t Hs0r 1P-Xp0 038s0!PX{0pwp0W0 0P  0S 0 S0 @ 0 @P @ ?36e66667=7l77R0 0 Q !Q1 B/E- P$MU@ `7 {7010P0+P <7P p ,0>>,0NPP $Ѝ;P}MAPCPPp0Pl00Q0 PPZ0 P00 10S10 00 0P0Sh10sXX70 000 P%)00000 0 R0 0 1 0P0SpW/ dM00S?00 6Q(B PnpPMpUlP00SMPd@MP00mV"R^Pn556@-@002,0P $ Rz1P00W:M-@bM@ P PbߍL0SG P0PSG030800 4<0wPP @T&036 8<00480XPP0 S@0#86ı 03080648<0FPP@0DPHL QD0HPLP /SAQ( (PP 00PS{L`PP00SpLPdL1000S?00640 ( 01p0l00USR+ UR8| 8?8.8 P0`N%n&3.5"1 0 0 *++,,-<Qtt0P|0\ 40s  # 84<08 036 848<0PPZ0ကi0.PPR PPK R7056Pp (8TX0PP93000` 00?` XPT`!PP'03/< 0S71 S7 700(0 2(07@R7(,0g>7V5PW0 0GEC|A?1.?\Qo`X?`X 060p0@0000$ lt$`,0(01PP03? (02/0(0 03`0 Q0 U U U70B/00&(!B 1 PJoB?0㪢አB 1PURE_oPRP%0Q0S1p l0q7086 8⌠0P 08@0x00Q_Pt0p00?Pl ⌠lP\P0E< 2/S Q6 S$P$1q0 P%  ?70U  ohUXP1 10S<t0|000 0t t4 l4000TP1QR 3 #1200 10th10605W OX0_  s  S$ S( T #rzq8888899 9-9:9I9X9g9v99999nUyU8D00 @-G/A-@P0P0c 000S ;?PPP ?P:>?o2PppWH DDP@ ,TVp lb0S P0S>P>P0Ѝ 0R P 8D P<l@pPP\ ڋP@@X Y>00@00(pD0@P  t P}@P  tDPy 0R  0 P 8DP.P R R 0RgP8HaD<bP.<O<<=<P=<5=~=-\ //-|/x/-t/- 0d/- 0h/0@-@ R *P PT:@ 00@p/0//p@-P0 0 0 @X03/P 0 rs 0S 0 0 0S 0 p- 0/- 0/- 0/0/ 0/ 0/@-@ 01/P000@-@ (P`$0 `1/Jp00 00C0Ѝp0 00C0E-@ 0R`M 0:Ѝ R   P: R. 0l1/P up000 Jp000 (PQppU 0 e E0UQ3R(`Q  a 0A68PE0 0S0 \P60\6A-@0Mp 00-S" 0 0 !0@S CP0(S`PP)P<P4B C0 P *BЍ0@S`00  <P0;00000,Q rq00 P  U  FZ<`F00Q;Q 8B!   tB;|;;z;<6<p@-PP@p@<`G6@P  7M-`MPp86@TP 8nB *( @Ѝ00 000 000000 0 008000`0SH5`0d0S<5d0h0S05h0\0S$5\0l0S5l0p0S 5p00S50x0S4x00S400S40|0S4|0t0S4t00S400S400S400S400S400S|400PSl40h4X0!sr 0sr.Fp$0S,p0+#[Q6 $0Sp& c C83172 ""0 0 0   R  S*: 0. \AQA5pZ055.sr p0 0S S3:0S 0   R * R  8 AP\00% p 0 00TQf*Sg\pW p\:^"1\A0 . 00$ R,0KZP 0;0CA0   00$ R,05qZP 04;0*AD0D0H0H0L0L040400S`p V0*. 0gP00000`p0\0C0Q44ʅظ|\̶4X<H@d\䷃ 4hT7{ 00C R/0S0A /M-`pHM @ (0C000 R;R 0P 0 PW0 ;R00 0 0p (P(\p@ HЍ {Pqp Q   P P $*{@Y Qqp000 000D00 3H<w<p@-@`PUp@ PM-`@嘠ppG0S 0R PP 82@0@pC0 P0 0800߰M-Pp` 0U p@0 0蠀  0  0PA-0PS|L(MPd(ЍP@P 4P @qT UP6  Gp`/ 0S, PP; 0P 0 : 00!0D0 $00`$ p  |@‰pnUyUM-`@M 0:"|",0__S _͌ 0 S0 "̠?pP 0 Q_0:s 0 R040_ 000C0_0Mj @@@@RS(01<_ /SR/@-R BSȌȌ00C_SR@7@-P4 1 @_T@T 0 S    ‚2#R Q (R= R R+ @ Ѝ0$! R !5R$! R,  $! R  $! R x x$! R D DT0 00@!00@00 @DenUyUAA=AmAA= _0S0 R _0:H$0 R _0:&/M-p`P@0X0002`?`?`p.02`< 1_ 0 1=0_'S8S ` S!8_0 R@>501=0_S8_0C8BM-P` 1S 1S ?@PP5Ѝ$A0S 0  57@ 10:,_ _0:, 0_0 *5_ *5_ *5_ *5_ *5_ *5_ *5_  *_ *@_ *_ *_ *4_ *7_ *7_ *<_ *<_ *_ *_ *4_@ 0:|$_0l&:$$1`D R 8 _0: 0: _ _0: 6<&_0S { _0 p5 W, _0p6 W *(P uC/000  (P U0 H%HHP40 11000  xP U 0 $0@00S 0u ? ? Sk0 0C001R=_ 4 !_ ! _R %1_ 0SA? S!,58_0C?p000S0_$! R 0 330 0000_0'_0_0 ,!_0t_0C  #23$! R 0 234P 1 0_S0S  h0000 0C h2@"@? ? SE0 0C072_? 02'<_ 01;_  < 1_ $!0S+0S S1010SC 0: ,_ _0: ,0:,_ _0:,$$41  @3 1 S0Q0Q 0: <_$DQ3= 0Q:Q@0 dQ 0_ <01010:,_ _0:,-BHB8ZZ nUyUVBqB}B0~B~B{ 0 /t>00S 0 /D t> 0 /t>p@-@~`0S PpDh0dD\0Pt H <0 0 "pppp a, G, @-~PDP@+ DP( D:,P  30p0|rDP 2\0`jDP 2@0P 000Kc( & $ PcZc, 0 p@-`P`@0\0 R 0H00@ \?C"0C" B 0%p .A< D 4 @ H @-`@|:PP  ,Pc;PP 0 `0`@@0APP ЍS;P%P0 S :P 00P0pj? x0x x@0 DN@U D00 S Ѝ@;:P Ѝ@:0D,  <  $ & ( 7@-(@PUP Ѝ08 :$ @-0 00@P=& $ p@-dP0S pP`0S::@P00 00@@Ppp< D 4 A-T`0S0P0+@T@ Tp|Z@DP8 7@-@0S=0 Ѝ0@= xx ,Pl=h0P>`0 >0H 0DD0 0? Ѝ0 4 0D, x & ( $ A-0`?o2P0S 0Qp@ TxP\dUP!d00@ TLD"0 S1:d,E< , 000$ ( D @ H -TMP  L*00<0 (040000040,0@0(0<0ܧPTЍĉT@x/A-PP`p]@PU 1@P |0 000 $ 40 0C8`0DpHPS00 ( , 0 0S 3/P dd0  " 80@ V00W0S`A|YY{YZZA-@,0P`p8/P Ƞ0 ,8/P0p00M-`(MpPU"0@! 0T4PUVZ  v0S00F(r\B$0B"0B!000Cc u0S00E(rPB$0B"0B!00 C 0P.R0tQD8sPC4C2C1A 0P P 2s 00  p AP (ЍD/p@-40@SP 3/ 4+p@w00S //00S //P -,^ 0 8//A-P 0S 840S. `, 0@/p @ /00&V/m@P 垞@ IQ/ @P *` Up@-@ 40S> ,0`00 0  _  1   /  00p z Pu0  d   0`kk0 V d  ? 0@ X 0@0P40?  d00@-@[P@@-P 0@T 00 84/Ѝ@- @.0P;<@ s0p@-40@S 0<0@00S = dS"<< p@R< s0(`,0 `(`Pp> 0@00< ; ;@0 0P+  s0PPp Pp  Pp, <0 < <P s0PPpU p@P Pp  Ppp@- PPp?M>M @ @ @ @   Pp  @ @ E F,00,0(00(0hpp@-L@@ p9 P;P  za@  `V,Kp l@P)Ys@-@P` 0SS   08 c. P$`ЍpMYE-`QPLpP  $@P  DH. 00 -@P 00  Ѝ*YZZp@-P`@q0 v0 9p@ s0 QRp@-,PU 0p@/P@0 ^ p@ p QRA-`0pW A/P2`@0 0S0 A0 A-p @`Pw0 ~ 1y u0tA-p @Pw0` e P v0[A- P; SP5@0 jsk d(9 Sd0  S 0?F@0PXRm``FQ.8( i@Q2 @-@qP@@-@0 dP@@-@\PA< @M-PMP$ @P  1pP w0Ѝ0#1000CX `2/06o v 3? s2/ [  0 P 0帰S 0Pv`0 0 P@02p@-$0@ 0CS  $0 CR S Sp0  0 0 0 s0$0S  090 s0s$0 S$ 0s0 f |P 090s0Y 09 0 s0KKeTp@-@0 : 0 50 00 +< &(B@-@0  Yp0  00  S;  0 0 0 00  \1 0 8 8 0 @1 P  88 s0@-@0  00 s00  70 "=0  p0 000 @@-@@-@0 x1 s0 n2  i`0 d $0 Sp0XZt 9 s0Jp@-@Ic P0 900 4u0 /0 * kp@-@0 p0 0 2 0   @%@-@9 0  0 0 0 < 9 A-0P ESt@Cdp `ḁ@dt@05 As07@-@0 K1 D1 (< F1 32  M1  <  Y1 0 $0S'P0 0 P0 P0 vd%$0S  ?09 0e$0 0CS0 \ ?$ 0 BQ00 R 0 R0 H0 CC]L Ѝ0L00L0/0 @ <   0000//A-PpU 0MLPU$  *`P 0 zP ` \*Ѝ VdV 9VV'00V00S I*㕛@P   X@` X PD 000 04kJ=g䧊@-R⿾ 0,0C,Q ЍH0P,0LM-`0MH0@sR(⦾P(嶿HP RP 孺00`H0 00LP0Ѝ` 0WLLd, pP 3 000,  $P,B00噜P   1001 10100S0S P|@ R $ <$ @ p0^,0$ ZP0 00p$ 0$ QP) [" 0cL^0:00LS: 0$ [s0$00 /00 PP,0 0C,0SP " U 0 Y XL0S p@-Pʸ @L[p/p@- P@R㟿ppRPp p@R㓿@-@P /RP@ p@-@᝸`PD0  )H0p‰P P//7@-@PᶺP }P 0S00 Ѝ0⬺7@-@PPP t Ѝ0-<^  R*/%A-p@P`yp0 AA-P`p@P ƺRP@ 0 Ѝ000/R R/0p/0p/p@-<@P^ %p R: pp@/A-P`p@P ~RP@ N0 Ѝ@-0@ P00Ѝ@-0@ P00Ѝ@-p @P`P   r Ѝ@ Ѝ@-Mp `HP@?T@  0R R #4PU0@ЍE-PʸHp`̹܀P0S0@WpLP@P  ЍP ⸹U v0S Wp10H0S >   > 3U@-0@ ZP00ЍM-H@pMH<00P 00S T 0SL 0 00pP/0SS $0 pX$0`3 00 0 0 ,0`,0#4,0t0( 0p 4040 080,0D0$0 , 00`00s #8< @00L(0P`ᠢV`" B2 S"D0 #Q#000lH X5P.'Pw!pPr EP0 4P00#s00z i`QPP0q 4Q)q 8Q#q <Q q @QD!0 P0 0`0㙷P {E pЍ@0P@0_< l0X 0 q0`p  P !őPG P     Z l Z00 0P傱%>?=>O>Y>c>>>>>?;?d??,AM-PS@놱0 0`0 pCPPp P  Ѝ<00_s047_< 0<0:*_,_<0:*<0::_88_< *:D H00Cs 0P H0D 00C 0DPH0d h00Cs 0P h0d 00C@w 0d00h0w_0< *8_< 0_< 0_< *8_< 0_< p$0 (_<0_< 0_ < R 0_< *8_< *8_$< d*8 0 \l0E U03 0#X1UT10C2uR0CuQ0CUP0CS 0 0_< 0_ PE<0%XX P_<0:X_<0_<0 H0D 00C 0 $0DH00Cs 00 $00$0dh00Cs $ 000 0$00$010<00S  dP<0::_ 00_<0_<00 R0C0 4 20_<A 00PsPU??.@a@n@A-p@P`H0WQ%Wtp 0D8 D#SR 00<0::_0QRȠ |084 0 Ƞ 84ˌ_<0V:ȃ V V0< c=<0p_Q0 S 0 0< c=<0p<0:E-PL`PMЍ[@p嬀`TV  0SP pQ P 0D<P  ျP6@YY0<0S /M-`@PpPMt0 0 LZPp PЍ WgP!RQ:0C00Z@- 0P0<0L0S% 3/ Ѝ@- 0P0<0P0S% 3/ Ѝ@-@L,MP" P0P  0 R   lL ]`P%,ЍP0p#100U V1P@0ჰ0P T0 H H<kP   WR0<0403/ZZ*ZnUyU0<00S /%/p@-P0<00S @3/ p%p-04'\ Q 4# 0 0d S0\X X   ," R 0 $0 A Ѝ;GkO,0@-M0 @P4*P   Q ~Ѝ0A Pp@-P@OPpp@-P˫@PX < `L < PL< @L< 0L< L۶L$L% Lζ Lݷ&LPP020ĵ ӷ 24 ⷶP 040 0=s  0C?o=r20S,00,00=s  0C?o=r20S,00,0ppccdd6dMdadsddddd@-@_PL忶P(LP( Ѝ(`P`0P D/o"S R :p(U(oPc@-@᦭0P 0S @/%@-@᙭0P 0S @/%A-Pይ@P* 0S'  Up$0S @ `V `03/@P 0S VPPU P 0A44c%@0 `p@-0 Q@P<` 03/ p pp@-0L(L/@-@Ც0     00E-$MPs@pᔬpP$ЍRP L坴 L嘴 L哴 P  p0S6_`儀   xLzP6_ ``W000pp00&   F FF 00 p_/@-=@ @ @-@.T   0 0r _ /p@-@P    T pg p@-@T1 TBTS000#R00S 0 yp@-@P` u U$ p@p@-@Ω0P2pp@-@Pt@    upp@s@-@v`៩PP RPᠫp IP ]Ѝp PD 0s0_  _ 00 0s0_  p_/ `0 r _@ __  __| _w__ / A-0PsR 1000  0PZ 0$ 00P -  0 <  R ^ 0/ R Q  Q* PA$  R$ R$ $ R $0S p@-P@ 0_;:;:_00S Ф 0_40_ @T0 @0_0p@-黤0_ _  _p@-`Pᬤ@0@S UP!16_ ! 10E-P- P03 0#(1R$10C2r"0Cr!0CR0C0C#@0b P P03 0#(1R$10C2r"0Cr!0CR0C0CS0p0"2 000<_0p M-p P`R@0000 00UV00   _00 _0 S  0_W0VPEU0000`}@p@-P@ᩦ`E00p/p@-@ 0`PzP0QPp@/@-20S0@-@$M)L0SP ኢP ᜢ p$Ѝ0 LꞤ0<00S @-@3/%/@- R  /00@-hPMU 0T0S $ @P 0Su P 0S h0u ⩪P %0P ]P ;P Ѝ0ĉ@-鷤0_@0_ _00_Q00;0000/0_s/A-@ᣤp`ᒤPዦP V<0 806_0  ,000 @x} @-@x}@-0_@m@-u Ѝ/M-p`,3P03SЍ036 v @(_Q `   垇PP @ ,, , -P _P __ _0_00__ 0__0_;^ _ 3Pn@~ @ 0?R0/M-`3Q p 6(0_0S @% 0 J@` $03 00 @0   _08080_8_P T8@T  &>A-@ &MPj 0#SA  _0 00p0(37 0_`?`00 P Q2S P|| &ލR,j Db 6[ . V"'{iM-@0PM00P 00HS $@ $@$@0 HS00 @@(D'020OS50%0t@*0T <$<03?$0T1#40 0S*bPЍ$0""#(#<000+00. @ 500/ 0400( 4pP0S5  aa00`00 <0 >  '0㒋+<3  0p  _ 08 8 _c08 _ W % pW 0 @D00 0t@0C 0$0 0$0ꑈ@-@岢0(Q QR %Q QG D@HQ Q) *Q Ѝ@C  1PЍ0S0030 {8 0t 1Px 01  c 8   1o`Ѝ@O焉/0p@-@ P(0_0S  @Tppp@-@0_0_00__ _PU pmp_M-X9@ 3030PM3P_0PH0_!  __T?WXXSP_ _ _$# p_$#H`  (s##V: _ _ 0_3_$S$`_U*R,3 R$3 R30# (# 0000U400q0 0Q(Q4! 20"L020"  "  "  "  "  x"  l"   `"  X PŸH@@B@ 8rp0( b`$U L 0@,(@`<84pHPЍ &"   F"P _  ) _  _  _ _  _P H`S0 _R _0  _ L (_PL  Q( _ R`F n0 __0  _R _ _( _ R,# ,#M^ڊeRꃉOXc]iʍmrv|Q. σ@- 0@vP00Ѝs@-`PP 000`0@ԠPP hP 3S010#R 0Ѝp@-@`pM   X0 $`p P }7 R 0 R0 `pPЍ6   9  S <<0  /7'//%/%/0<00S /%/@-s Ѝ@-@4]u@-P`@J0 09 H PYЍpp@-P<@4ppA-Pp0000 0 P=@P`V 0S`S Bdê|0p P 0v`4s0VI@ЍTVY@0`F 0 v`` 0P@ ꧢp@-` P r PD@Q ZpPpJppNMD@DTmpp蠆@-@XM   } 3 P0SIXЍ0@- 0k Ѝ@-PR'M  q  `0Tp p0P4040 T @P pWЍ#S  I@UT0S Uꧢ@-k00@-P @IFM-P !@!00`S00ᶡ @ e @y0p00<0S 0S 3/ @0 00s0_ V t 0 @P:m+1z S_ 0嶡 < R  R 02/0PuP 0 j1Sp&P_0( 0QQpЍ0S 02_ 01SPp&_0( 0QQp꠆L 8J0 p@-@P11 (  ! !"@000pA-P`@@DT 0q0C0~~~@DM-M00P@40`Ḟឝ 1$00p B02s000,1(0 @ p40 0@0 0ApD00%0w0$0tpxp|p0p 00n 0U 00:*u0P0 P`0F @ 0DP0@F@0 V;*18 0&0 C0C &00 Z8 < 80j~0忁P80<  Ѝ0PU 00 0000Z2@00W 0 h00lp0 00d 0C70`@X00\0 0 @pP+ 40S (U$0 S, 0 0 b0 B 3Z^\ 00A@ J 0@  03  R    00T,F@- Ѝ@- ЍA-P `pt~@P @ 2P " (P}}@ 010P0( 01 0qa000 0A00<0S 0S 3/}?A-P@p`U=000_0S<0E-PDMpE`@ @p>000*e RP@@E  z"0(  PPDЍM-J`1pD@媀PP  ` 0 P B} x 10<0 010004 @ 4@000 x20  D E Z}@-DM@`P@ p 000 X p0(`,PtDЍp@-P@U 00T  p7@-KԠPP0@  Ѝ0QP,@0,@D, 0RPM-`MpĜ04p4080000_sP  `Ѝ@U}P    w0 0__0s00S0$003(000:0P(),090,0_00P 0PU  PP |*1 F(0C8, _0 $0 00_( _, 00_0 _4,090,0_0 0 P x겡 0 YP @0 P0 0P3PZh0 0Z` 0V$ SPP  B[T { a H!@ 0 00 <08 帄! B$ $!$  P!@  0  <008 帄!4 B$ᾄ  r P@ 0㸄 0  e@ 0㸄 0  Z`  R 唀4`P 0 HP {&`PT< 0S*{2 0 20D( X @MQ X(   *d0 P#    <00 0 K0 VPDPuP {{cF~FM-(M]@~pP P 0 PP<ⰠRb     ?Ⱐ| l| \w Lr <m ,h   b c R] X S f~`P PA 0  yPPP6A ᤱ0X58 4d4  t/  d*  T%  D  4 (     zz(Ѝ  0X  (   ~0  FFFFF GG6GdGvGGGG[G[H5H`HHOI9IPIjIIIIII JHHxHHHs@-@mPI` <  `0 00`00 _Ѝp@1J@-@,0M  ћЍP $F0<00S /%/0<00S /%/0<00S /%/p@-d P~M0_0h@S `V S ~?1~?0QC 0~?0SC\  0 ^q0R~/1~ߍp_00_0_0Q@-@pP  (C   p@-@`̙P @ pp@-@P㼙   pp@-@ᲙdPᲛP H嬛P 0_?3_ 0pp0<00S /%/0@- \  BR \ @\ c\00  0S @@M-P`Q00L 1 P !pPW4@ 000到Uq&,V8 wPE (?do 0`P HЍUuPPPU ` M-P`00 1 P 0P0ᦗp(D0S|Ѝ0E0F00wT00X00000 0?0xS$ႰP 0P000S 0 S0\XI0͵ L @0 E00F00?P$0 PP) $0 0SI0Sa '000000P0P 0 48<3 04 8$ %00020 000P0Pp 048<s 304 8T*0\m@W@, P@ЍsM-BM0, 0? (1PS0S00(A 0 0S0S?3@0Bs@P (pS 0@ 0`   0 000001l`$00ᣧ70@0000p(00pW7pSp]5 8R$ 0 ,! 0=1R,9  R B/o "601p0 (1pSp606cp0(a0XQ (1?o27<000<40 0S *b/ 8 R 4<D 2@0yP@0D  ^ov3 (pp0hP`@@@080,8 m8 @0Jp'Z`0@(1S  043P# $#   `00@00倠 50 ,00000*00_?0_ 000_ < -0刃#?ScFc / ,,)p00 EsP:(0` @000_@0_ 0 7nP00_ v _ 0 q 0_ 0)1VPc b00_  _ 0 PW 0 R00S 0??0S EP@"0@S0 S& S S @"0 0PS S0$ l   $l Vh90C0 xn0 PBߍ0;!Ϡ\ 0K/M-@M, 0p8hP0_ 0181jS S> S0`1@  04#$R R RB `  0T U PUPTU Y ЍB'0`@`0`s0Sqt"Ap"`0 4 0`@ H_000000000000 000 000413/P 0P0000`       0001S8000R%0 88(000_000_0:00_ s`_*00 $R R R R.0R R 1810000_ 0:0 0 0 8PЍM$P0y]M-$P@p`یVW00P0S@P>0U0  2012412812<10001S20141S24181S281<1S Xp`DAP0_00_ 0 H26PP<l013/U@1Sr00_r@`` N0@0 :pD0@0PPpTpX0_0` `$9ppp 1SoP N 0P !P0 S p !_0 0_1    $  "$   $  "$ 00_00_ 0 00@0_0_ @000_0_XQ(!in3/PP |_ 0 Put<Y$Pm@-0S pD1_'!1P YE-@Pp" @勍P 414! 1a|_ Pv` !8_:_8:_80 000 Ѝ耡2~`06.__0SYP|  _p0 3_$0 R0C0 4 20_0 0_0p0 P/ڄH!0P P:ʠ| 0 0C̠|Π00|\0C0CS!Q1!/>80/A-Pp@`P_ 0S | EP_ @T |m|p@-@0_0_0_0 P= P Lp0_0_0$0Pp p@0L,@-Q @  i,@-Q @  Z.0 /r R@/@-,I_xP@@@-P`@(91|0pm 00()0 !(9 " S !\0\\$X.0#<S  @0V<<", Ѝ7zoM-@᱊`, 幊P, (y[pPB|0SS.0D00p zH0 <Q4Q430 0<0@0S X01!0AQ8800 Mu~z7@-P_4S00 000@ !m0#<S "T0TTP 0#<(9((@P@ Ѝ0OhP~zM-@M,I00`0`d( 40刋zPP ZP$YZP '$Y(0#Q ` \@@Ѝ@(0$S4S(_0 #0 , Q AD 04/ Sr / R!#S R SX SZ gA##S"_90Q Q Q0_3BjS0 SC S030<0!4S S S'0q0S((0@ DT@QT 00909@0!4)0CSG0 h0 44@I@Iq <F? 2_ <  < + R,  R.  R=  ( <  < .`R<  < <  < <  <  =  = >  > >  > >  > >00>00=  = =  @`@;(9 1|0p000%1,0Q0P, 0b @`[#   O0@>3=0 0 _0K 00,0 S@P pfq+*r0 !T@ p0[$000$0p0 SG? 1#P0T00CS( P!00 1TU%0CS񟗽|PZP@ p@Z@/T@3T@#@D0p10-ڡ1 P@PZ Z@p"@0T@3T@#S@D0SwWu@T@3T@#@Dp T@3T@#@D0SZ0q0庡$[ $   L $0P1 d [ [Ht H|!@%L! @$0(  [ $Q   $ $0 000  0[ 00s080 0480000000PZ @T@3T@#@t@pZ@p @m!0P@C @ 00(`040@ЍM9NPl1y%D1NP}J| %|zA-P[@(ia|0pJ |p0S | 0|0 `0800000A=A-P`p&@.0P0PP@p` _80r _00_ 80PC G_!,~$T _ 4404#44 4$404#44 e0_0_ 0=rPP PfT0_PT0_P_0!hQ(!4` PP!:@-鿆@o00_ 0_0T00_T 0_0QP/R/0@- P0@?>@ 3?;;30A-PP`p@ W P0PPLfpf@VfpfAftzQP' @-$0$$ ???8tz?p@-?P@i@P 0000,  pPtzp@-P`f@P!t0ttp`00_;;V000_ @ 000 p~tz@- f@P&!0000e,o 00tzQP6 @-$0$$N X???2'tzM-@DTHRx0S 0 _0_@0x0ex0exe0x0`pxPU$ @ 1`0 P  0) 00S0S 0e0e0S 0e0ee XXe@e-ЍMjA-p`8f@PF!0 V( qPP`FS/0dPU!d0  P`FV W 3030 0 0 0tzA-q|@T PA`eP| A/|pPpac PP   @0 !@@CM-@`P@8c @08_00_ P4PqH0 0__H?0? 00_0_P0_00 00_0`` ` T`PD0\0D0X`00 P(@00XcD0 ?T0__PT00_#88T 0_0T 0_ _` 0 T0_0_P`_0_&h>nmJ QepPF xpEP @0!@)0_s 0P  PgPPdd0x0%PU !0$J 0P 0/V  x0GN@ S_ c~tz0S "@-0/}tz 0R/00_ 0@0/0S0  _ @2 /A-p P`@ 0000 00p@-`P@000000 0 0pM- ()!|Z"t2 P @p @# ` $,  TP ` K`Rv\dd,  ߃X#8 , a,)$ރ 0eX0X00 0`0[x1!00 0  000 0004 ЍM/0fX0X00 0`0[:0 /00f`, $i奃P, [TP,) R, RTP, 劃< R $ $r   (9000[X0X00 00f/0  0@|  tz @A-P$`pQ$C PU $GQ  RPm @ D04B\ɀ)  B R09/0S B"@-(0((\$f000y~.czA-P@p` 0UP0 0 Pv` 0()_aQ  S0@o/ /p@-`@PR`p`p`D 0T0;U p| 00 0 00# 060 DP0?o2000PP 0?; SIZlZZZQP0 R/A?Q//M-Pp`     0p' 0@ @ @D0U0;T M 0?; SZ00S 00 0 00 0 00# 00 DcP0?o2000@A-@H `P(p`P '!t0ttp,H%pGWP0X X 0  0_ Ѝ.cz@-@DD Q 0 S 0 ?  P000 0D Q S [T0__  P0?o20 0?; SA-`P p؀D0 @D 0 0 0S 0S5S# "S 0#<S !|0||x 0 3P U@ ,.0Ѝ~.cz@-P`()@1|01 p000H () 0# R/0S80CV %"0a!(9 " S0#<S +"0Q0000()!w(9 " S0#<S /0 Ѝ@3~.czM-HM`P0@(9w0&?S0&3ppG01|@0&  /oA 0" 000cs0S R08S   6Pc0000 00(P,0 00$0ROA0HdT@0 000040$0oob[0 040` `S 0 0000 0`P#0[800 <0T08 @0k80 D`D0`000K000?00@ETHU,0$  @P 0m9IHЍ 0`0S 0 4PE 0 # R1.d0S80CW #H0HHD W p(| P\.czM-@(Mpu(9g 01|+?S0+3``F1 0P00S 0V   yP(ЍP$0 0000S0A8!=R$ X R88 $(,  $(,  "0  iNX8"0 S0H0P00#0X08 000H$0 m00?8p  0: 0 $00pp pZ0 Ph 0 + S#1[0KV #1% 9S:(9P1|01H00()0h!(9 " S"10000()Q!(9 " S0#<S "0p1XHx 0 S P _ P090m9}.cz`|p@-P/~@Spp@-P$~@M0`4p_4d wpJP @P 8 ЍQ @LXM-`Q5 p0S1 p P0S( 0 @DT#@ 0R >P0=S P@D R !T: HHЍ@ @-@H@F:@-@M <:Ѝٿ$0P  ;0@-0,M@ P(c0T 0  00P (0P,Ѝ0 PP7@-P@P g0S Ѝ0@-@:0  0 0 0 0 00@-MP@P 9Ѝ0s p@-P@Ppp@-P@P  p@ p@-P 0YPTP1S@-@o 0@- P;@-@P p0K#`` 000@xPD0DЍ@yC\   ) Ѝ ;P_Չ@-0+  #0 UЍ;Pp@-QPM`  /㬾0P x)Ѝp@P0/P @@@0PP 000$0$. P @ @-@M`P T@@p0`dP404Ѝ hPԉ$Qi M- MD`[@p 0$SU0{S` SO`P[00@P 01 PP  0U [00 @001 Ѝ000CS 00S0[p@0 t R pH0 Z [0H 000@00p@PLwom Q /@- P 0000C,0PRPhPA-`Pxp@P_@,P(0 2 a03/@P$[,`*tuP`N Vɉ@-,@P `H 0ST ( !<=@3/@P 41 VɉA-`@pPP V@ tl @  $ 0S 3/@P(01(0(01(0t $0`S@;M-Mp`@ 00M  #KP5 (010 P pM 0#K6P \V #]P r\]PP fРKz\P Р  ccjM-PPpP ,`P)0P8 \@P P;:PP 00gPdP  7/PP=\VPPV 4\P\@P 0 0&\$\RP0@-00@M PH 0@P 0S@  \\Ѝ0LP@- 0\ X\8@0Q P D꓀0 /p@-@0P00 $m ipPNp@-@ P ,PP @p p p@-@P ,PP @p p p@-P@0pC00@-| ,M  0 00 (0@0S T 0 ,Ѝ0P P P7@-@P0 m0S  S 0R XR U :P@PEP` Ѝ0A-P0嘀0@00`SpPP tdPPX P Ѝ PqP  yPNM-PRMp@`0QpBd2Q@Uq 000CS"$LT 0 00S /0 0 R& S00S00XS 0GUG UM UA|= C01SyS tSXS0S F0Cs0S!  410, ЍY0C!s023 00 0 S [  .RKR)P0 0x   \@ /P(@@  4 P O  @ ] } 0/A-pPD D00C`Q,@UxP`~P~p@-@0P00 $ p$!d PL0@- (M  0 0 00 (0@l0S T 0 (ЍiP P  0PA-PM⨀`@ PԽ0pS -P00P XP ܍ P 8P P00PvL7@-P ̩@P  Ѝ0yj0@-M M@P@PXWP(冩@P 8W(0v@PW؍ Ѝ02 G D7@-@]PP|Y@ Ѝ0@P 0(M@P 4FY+x@P 0 $   p@-U@P P/#0P   P$ pp///// /80 P D P R//D/P///E-gM` 1pQ弁3/@P W0\ 000 U00S Pl S V m@gߍ///0/0E-`0 0%hPPp@ttV 0SSP0S  03/P40 ,0P ЍpWD@(P$A-`QPx WfP@hp`P`P 03/P @D0 <0`Wf@TDP@(P$@-@S$03/00@-0H@(0/@-$0>03/@@-$0103/@@-$0@$03/@A-PD0@b00`0 0`6/@ЍM-@p0P04p8``p0 ;/@P SR @Ѝ;7@-l0P@,0@3/PU 40PeP Ѝ0$0 0 000($@-@=<0003/@]T0@d@Ѝ@-@P%0403/@FE-PP"0` Ѝ0Sx=`@P P2 S ,p &`p@-$0g803/@ @-$0Z<03/@p@-@0PM@0`3/@P @pR7@-@ P@P @ Ѝ0  PȉM-P0BS8M@8ЍRpX d@P D@WE $#$0 `R 0SW@ WE W>  y1000  0P   ( 8/z00[0S (v OPe `GP /U W  W ż (0005"PX U,0(4000(0?04` !XUTUL(Dc0Wp}HoO]wO ȉp@-@0BSRP PU Ppppy։@-@ P@E-P0BS@$M@ @P @$Ѝ R`MZpPFP0 00p@` VP!pU dT000 ?, !$yT wT1]wOp@-`(M%  P0FS@8 5P @(Ѝp @PV  14-p@-P0BS@` @P@00V w1cpf4-R @- @P <P/R@- @P 7P A/SR @- @P .P/A-hS`@\P\p`VTLSHS0S T,: @DPۉPOM-@0M0PU@2 `1B 00pS !,!$1Q=R<>R", 4@ P$A S$B S(C #<!D014 !S@?<08 K 4P p@4 80ߍX!W14Y!8Z!L@QJMJ$@<<(,@Q@@Z>,dQo1 S?JD B@@B?4 @P(!@02#wv $xy0(,e 0hB@@4 80LbB겇0HdQo1J00! Z, 0 (  $ @ !0! HU 0T}UP804 t' @Y 0J4  @P00ʧ 4 804 TG2@1Q  0ES+0!*Q&#:@  0 B4 O@00 B?$HUZ |@T<0S 0'L"lQh?lPI:&]lll@llllemOlp@-@PP 0p,0@-(0P0,0,M  P" @P\0S H@,Ѝ0400"@P@,%,3A-T0,M(000 0 000 ,0 Pݥ@o,Ѝ,p@-1P(0M00 0 000 `,0 @P4NЍp@T E@D <⼷""<0( 0@12345678@P"( "#@<y <0\@01!wv $xy(,0v uzw x y ${|0(< ,$7M-,1` 08M"(00#0 0000$00`X,0\L @P(#0S @8Ѝ 0(h@P|(,(P,pPU pQ0P p00#$P pu @P$`0@,<a@-@P00,000S @-H //,M-PM@PppP񟗘<=`=\>d?R1! 1 PЍ< 0U0 p$(0 `0SpQ @&APE<0!)P`q 0S *  0ET R 0A`P (PV R0`d0h0l`VX VZ@PBV0PE0@0TU:0S `F0`FP0pH[0*cR@PE:C@P`C ?p ,i| @-@Q) { z0w4| a8} "0}8- 04 2/h/Dep@-@P@`P Up@D @-@P@NR@-0 00@0$0(0,0Č0Ȍ0̌0\4@8@<@-: ^0(: 0R&#: 0 Č 0Ȍ 0̌0$0(0 , 0 0 0 0 P48<:\03#@- 0 $ 0( 0R 4 8 "( ̃ 0S$S80,<00 0 0$0(0,0 4 8< Ѝp@-@0P`@a @MDb c0HLR P0H!e0C2TLQ`bTe@#`@Ѝp0S 0e H ZP T  0!@80 ,3<08 <"4R$ S$ 8S(#<4040  0P,0 Q0Q00! 0tP>M-@pa0`@dPDb0UHc0PL! `o`ᛦ eUPP` @UP`o`eBPP` @UPE-@@RdpMSa `04b 8c <WTI*2e0P0 T$0X(`0\4 8 ̎ ,<PP  uPЍ80 @0pGdP @100 5$203(40, 46 87d <@!P`@-p@0Pa0`@Db0Hc0L<0S P0U M"T0TTPePE`UZ@ 0 @ Ѝ~8-zKM-`@@a0`PPMTb0Xc0\00V", OPЍd0S 100 5$203(40,4687<NpP@100`4Pd20h30l50T60X70\ 0\NU0e (W9U0Ep 0ePP @e Be`0 4 8 ̃048<0R*(0e @00    $0(,0P e@ LN:0S  (P @100 5$203(40, 467 8<qNf@0P $0(,48<0R dQNFW 048< P0e0CS  p 0Sy0 eP0 (~_0 <ZH D,!$L0QHR0e ,< 80,#$S4%0R4&0R8'0"<0(0,08 ZU0004 P!Q"Q#! $4lP0S ,0 @ ,wv04xy8 CA-@pP `˦W,~@~T~h~ Av AV A@ AT0A-0CMPp` q0* (@?@2!@#P 004 8C0 @D ||2RP[X:\PCݍHp P>  dP=Q ]Q XQ S%R'%R"&R Q5":Q0S P15:P0Sxp0t 0h; ' R*LHP Q 00F p PP 00 0.X0  0( (Q*0 0| Q+x`Qa l*"k_BHRfS_M圉 4_ٝ&Em̞꞉Ihp@-@P`@00(M 0C U0 P @080000"9(Ѝp 깦@-P ЍM-@`(M0P@U "  0  P$K 0P " 0A(Ѝ PQ @ U$` P5$05 00!%pAW 0@PEbM-@M0`0 @ 0P,00 $( 40(0, 0 T#*0S800 0d0 040080< 0 0 P  04oA @Ѝ40pX# R  0 0  00 A a08`$ D 2,`/"P`80< QV 40(! #v0@Pn```A-!1`Pp0 @pq An  ֤!ҤV41V81U4aQ&l1U8%\a1Q@-@P 7@~@@-@@@ @H@@@p@-`B@P BBB B0HS 0S 0PSPP@p($P8@- 0@S 0S 0S@@-@8(@}0 $0(0 04 8 <.  @-XT / R R", S$0 S(#< 0Řp@-@0$LiPopX@-@P&  t$8  @QPURS TVW SRЍ $"80;80~<yM-TPMRЪ@ :U   0P`@p,@P @ 0PP00("`@ P P HH 0 4 PS 0U+ S!P `P! 40`墣! \X`坣U "PI>U񟗗p\``U00 R`P @`Q PUR S T $VW (,P 5 55RPS``P5P 0@ Q0P U$R0(S0,T04VW8<[Z "80U080 ;p80@0 dQ XP80080ЍV0m 0 X 7L 02X00 =@01 052 3 4 $670(< "t=s@ 0d X@ a`04bc 8,0=(=bRb<yhbbbbbA-Pp @`n?0000 0 PP&0 $0(0p48 <  ,ČpȌp̌P  p80PЍPA-pP@@P1 0 $0 (0,048< Č Ȍ ̌ q| @PPk >@Ѝy=`P> @0 3P I=>@ @02#wv $xy0(,e 1n p 04 8 <& 0 $0(0P48 <  ,ČPȌP̌PL>@ p80 01@-P0 `$0(0,048<B @( B@$ B @ sr"|0 $p0 h @P~OD3 p@ ~< nP /0$$D N Ѝ|X||zA-PH@M 0I0HpL`tJ0P xK0U|M0SdN0hO0lQ0$R0(T0,4V8Wp`<PD  pB80? 0 00@P1 0!D D`@p`q0 0H1 00 D @ p !D<00{0$00 @%0&0'0(0)0*0+0,0P pЍ@;D00< 8@0, $<P%pPN 00C 0B ES l@8HP <P 0@-M(B@ Ѝ0/E-M@`P8P 01500 䳟0S 00#@0030 \X @"R@ H S 2@030 CX0W 2@2 삟`0 R  0PE `050rX;@3 [2h R T0 P2@ 3 0S0 @ $2@ 2  0 1R$  0Pȱ0S $00!@00s30 ՓX @0150paX-@^3 [ 81@41 } 0R0 r 0hP 0 1500 Hꬰ0S /0 @00$30 ᆓXg @^)^R^]^^^$_RZ____$`Q@-@P /0x 00 l0 h@P /0T 00 H0 D@P/00 00 $0 RRQp@-HPH@P Q _{00P l/00p@M-0M80 0PS4  P;0[Sq  ~/0 MH0 @ P<@2@ T3 000[$`0[S# S``408 SR00X00S'  5P;80`40@0KS`S`` P/0`0j V V  V0S$ P 00V V V( $.02[p0S$0K` 00,@K  0 @0Pu2[St np    M-0M@`0 40 00M0,0 (@ P ᔷP0/S S00@q /ϷP0 ,0(`S PC 0/R ,0K( KPKp ,0(PS<p!00S0w0S P  @ 8 1p8 W  ;R*,>0V0/SP0`_o,0K( KP<.U @X 0S(00 0,04 0$0K 0 0pP$0 0.@-@00X0 PЍ0KP TPTP0@-`P0Q xp 0_0P @0S 00@ Ѝ P_p@-@ T1:P@1@+ゑT' RP` S?#RL0S0 0 5 0`0? 01P-|ARx![P @p-00pp@-@PH0DP @<0 (ED0` f461 F525V(p@-`pP@|0 D\ Ѝp@-@o[D`0 Up@, 0S/P/ 0s00꓀- 1 ^ !(0S00 00 0$000$0 00$000000000H P/@-@  7HT,0t P @-@\ T R@G -H@T@P@T/,0 sR A-P `QpPB`@ P,0S P00/QM-@0P S S9?QBH2Q*0!1`@0S p0 RpC弰P3 lP`0S% S S0  PQ* Sq`ADqp`@D00@0M-M`Q!@02*?P% ??F1HР?p?p!RРT'K0  0 P Р!01 `@DQW p P!`@D p!? ? F !1GР?P?P P Р РA- 10S@p@?@?`T/PP  P@+@ 1 S 00@@$@0׏0@ S P@P@@d<P 0  $P0@0,S`\`e`E-dM `@ pP) PD00 34 0304S(0@0(0(08!S0(000+P,0开ᑃ(,0 T-0UQ1 SкpdЍQ(ƺ Pム 0H0L0 2010 H $0000?@?.P @$000$0 000p M-M?`pP@% ?0?0F011HР??!RРT'K +0  0 P 0 Р!`P@DQF P1`P@D !?0?0F011HР?p?pŎ  PР @-@\1  \  P(& L\! ep@-P@ ᑎ000Sp@p0 0@2007400>002@-0@G00 0@-PM `⟎@PЍ0.SpE @T}5TP EM-pP``A@.TT T  ᮳P a0DS@@PU_@%zM-@p`0P R U8 ᚳ@X\R/R   \Q/Q  QP 0U@0@@00P S@ .S0S .S0S j @UP 000 S .S @y։M-0PS`G S SA0pAH0!p@0S  0 S C0P  Pp000S$ S S!\0v * \7 \ :00R A@p@H0a0@`S000R" 600000s00r0R$ 40000000R 020A-P@T 0 S2 S0>T*`PA _@p@-P`@P@ OpM-PMQ Q, !@P〰00x0,|00000000%U U 0 S2U2#*0 S0 1 1S?U?SPЍU:?U0 o P,S0@0D H* P PZ$* 80 S S ?PP> S @0 P0D  ?PP?pP2 PR P  R2 R?0S V` Pt P6 P Z* 0S @0?D 80op80 @ D  Q )* 0 RP0  R R /PPn .Rk p8 0P P_ /pPY ",@ DP03`1:,P0` P$   ( $ W(  $p5(05$0!0S0(0 00 1 { ,v R   0 0## 00?400`pp* 0 pS40`0 `S00e0 0p1P p$  1Ps0 S0`0A p0p 00 00X400$0HL``5HH0? 00t0 0 0  1 PF0Xp 0`0 0` d 1P5 ۋ  1P*p0 0p00@ 0D`0 $0(0@`0D`P006* R2 R?0UJ* P@ 0+P 0\Hx<0t3 坋`3 !P0X40`0p 00 0<00 Rʜ  P R2 R?0SO0 S_ SRS_ Y?00S00000 D`@Z`P `@$0 S &810aV1pps'0H00L00HH0Q0p10W 0y H0ï p S  :0!p P0 00  0 S_ SRS_  0 @RP 0& p !P 0   R p p0Upp00 S2 S?>S p`0 P R" R/.R 0piiH-0?0?0@0M`?@x ?@届 P 0P0K H_PP 46YP  RSP ,K[_A-0S ` pQ 0Q@%  Q"  0BUP!m IP0100 S 0 S  1 S:00P 00 S2 S?>P@-0@SP 020C00SЍ0C00 00M-0P<1@P(@Ѝ0 00$ (0Q %  R@ @ p @p,pWO*0SS00  ,0D #0 s0Ps0/o"X R,0<1K 0410p  0 G0 .0`0 Ή 0 s00p0` ,1S,! S0,1<1S< `0P `VQ ` VQ  Q ` ` [o > 0  ጉE@Pc M-@PK0`SpP \S/S ΅PP0S /S\S0S  ERሮP0$  $0000000SR EP <卮Zp1 p! < P <1 S  P0 0 0Sxop@-@PKoP <P0Spp<1S P E-`pMB 30s0Qsp @P Ṉ0D Q0  S 0S Q0   C0R06 0 R R 00 S 0 0 00S0PuPP 0@0 p0U(00PSuP0 P 0 p @    刈0PES @DuP ;0SP ߍ7@-P P@P=0020C0 Ѝ0M-PQ0M @0Ѝ p.ᶭ0.S P   @P0 S_0 S000 0 0e OP@V  PK ` XP  S h0`S0  Q . 00 0 <P3 P# `V V V(R03: 0$Cr"Hr!HRH)0h0# H0 #0@$A ҇s@q[jejlONM-M@O`Pp0S`Ѝ R RW 0  0pS 0 SB00 00pY0S0PS 0 S0!01 P  LP k R" R/ R/^P0020C0P `@-@pM0S =|圲0t嘲/ 0C@P L厲@pЍ : & @+@倲,gp@-\`0M@&@P iPP P##!#o0Ѝp@A-p@0Mm&PP @ M`P@ xP00 # =@P  i@P0@H""0Ѝ@M-PM@@pP:&0P0 0 0S 0P 0L C0P 0C0 $ PA @H Z3ᴃ0UP` U P?P@0Z%0U0PS0Z000 00c U  00?@?0%P0 0 0 "" PЍ  P@ X徱$ Q QT*0P  0P0 妱 b" PU  S00 L T"0 00 00 0yP@$0 S2 S?>T*0S 0 P0 0 0  0U @[0  P0 P$ R" R/.P* 0   PU 0 0*P@u$0 S2 S?>Tl*0@!4A-p`@d6%PP @ L ▅b@P =@PP !!p@-@` PP# -w⛪1   1d 1@ ! 000 0!`pp@-@!@!/0@-lMP (z@P000 00夰lЍ0M-@ZMP80 `ᐡ唱,ު0P 0 ( $(pᠪ@P hP 噰@S!8Q!O!Zߍ@$@P  8P` 1$  P  xvhP$ 0 00vu  R0F 001 01080P8P0 PP`0+, P(PXp ᳄0 S011 0,  0ބ, P @1Ib0@-M0B@RЍ0E-@lM0 ⁄3P  P@   lЍ  CpῩP庩@PxP@h#@P PP0 H2  `P  $˯PpWP0 0: 80  3@#pP8m k P 0@??#P8T 0PT0P 8H F U 僯PP0  Rah=PpPq$0S (0 0  R D!P_PP Z`@@` `V:3PPPPNy։Oh@1bM-@ZM0 8ⴃf0P0P@`* $ $p&PP h0PP P@`@.#`P 8@P ` 2  7@P  8ZߍhPP \hP@0S*( 7@PP|T)@P U0 S㴁0 (ẁ 倃t$@??"PP @h␨P h⋨P@( ^@P  ' <Z 0 U+ R 0< R㴃3ǿ(00 0 p P8@P 剮< 0 R#(#s0< 1 R! 81#((0!80 0p P@P84P Hg@`&@\P@1 xo IbM-MPP ??@ ML\ʂ\:Kx<Sj? A?0 $0   0 :P 44)$0 $ BR 0( т( `p@DT 0 c  ?0?0@0M?? 0 9 ᶂР20 9Zdh0a@ 0 `  09P$  !|Lb}/0@-M@l0< 0000PP 5/@T Ѝ0 P 7P 0S0A@-0`P 0 0<0 `@0 4/@>T RT TA@P0 0 3/@P 0 Ѝp0@-P`0S 0<0 P@0 4/@>T RT T AЍp@0 P 0p@-0 P@P $0 <0T03/@vp0A-p`PmW `@P`WsЍo0<0@ 04/@RT0 RS 'P P0 {@ B‘0 @P0'/M-`pVP# *0&S3<0S Q@P 00000 02PP  `"PP0S 3/PP &QD`Dp~xPA@-@`p*<Pp 0 0p07/PU Ѝ@-@`p<Pp 0 0p07/PU ЍA-M`P@VP@@ A pW pv@&h8p@ P&AЍ@1pP  =0   0 0|&0@p8P &A4P 9Ds>;`"P[=@P A0@-@< <!P40( (w!P&ԆՆM-pM8娰 @@0W:a / P pt `P0P 9PP 6@0 `n&VЍxAA-HM0`x" 9)p *pPA  4#@P @ īHЍ40x @P0SR0SO0 00@T>Q: 0 00P @0 @P,0000 0dl[,@PJ3@PG<P冫0S <DPP P&A  D%  #@:A< fU  FP 00SqP00` @%TJA PqUu ,8r]lA`Cxe|AK5xsM-0 0 00`p 0>|PP@P 0S 0 00+@P  0S  %@PЍ|ht *PPd:A E⨀Z @P nlA@a oP0 0 /Q Q0/40M $0 000oЍ/R8<,0M@000oЍ/R8M-pPpp@T 0DS` 0 0``00 3/0 S4`RR0S/0S/@-p 00CQP 0 0 @T*   @0LRA-`pVQ  WPPU Q$%@P&Q   ~00 0 0 @0 @@Rp@-@Pj ~p@wp@-@Pa ኤp@np@-P`XUQ@@V@T A v{[p@-D+ R@-;Q ! , 0 0?0M-@'`P 4 aЍp̠P U0S  000 0 0 000[$0S0 P pp0~00 P 0 pprR@-6$ p@-@P # ps@-`@P0 00G$ Ѝpp@-@P b# pp@-@P`0 " pp@-@PQ#pR0/<00S/M0Ѝ/<<0S/A- 0@S p`PUPU P  幣PP P  季P<0S  P P: A3<@S <S 0P  W V036 V @ "@P@ |(0 00"P0P `p0 00 Ѝ`s@-@`Po2T 2T 0 0000 qЍp !s@-`@PU0 0000 ]ЍpA-pP`吀@T_A0S 0S (, U0:80S S080 @0040 (0, ЍpM-@ Mp$QT`` A/ ЍPP h %0 00@ T` RV0:A00  P   C X #3V#P   "PW  ` AM-`R@p P: U 000 Q  R4 >Q^ PR0   0Z .\ DP2 0 0 0@0P 0U000s0S 0 Z  R   VQ 0Q QQ0&E-@M`p04PeQT ?oU20SU U U U   @P :TAZЍU A U 0UP PT0  PS@M-M %pPP `V @P W` @P 0SЍ R0 SV@ @P` &Q W ` 0 S/ Z 0S e @000 00bPU:Z* 0VS 0 `6/Q&0 W Q UPQ `00 ;/Q Q@ QAM-p`P@ TU`V  0S 0P0 ⮛P @ PP@&aV  0S  (  ⑛P ZT :a@D[ CQ`T ^ QR !@0A-`PpP'  @P"  0S  S>A ЍAL\^@@0 AЍp@-P@ PP  0R 0 PPqpE-pP AM `䀟P@T  P  Q  00SRAVЍ 0+@TP`0`F     A-@- ЍЍ/-@-  ЍЍ/@-@P ` PQ  NPP` 0`F    0 kV   0R 0 Ѝp-@- ЍЍ/-@-L X ЍЍ/0@-P1LM0@ 09PPE LЍ00 R000S 8j50 0 Q0 P @ 00$osPP 000p0   T0\@ 00 0(03/<0 x@04/@|B800@-PMt@P 0000 gQ0S S Ѝ0 80S 803/Q *|B0@- 00? ЍxA-Pp0 0|/@T ` 03/@T 03/@0  ЍAM-MPw`0P A0 0 00x.@fT [:ATU 0S@kЍVp0F'p0Z&:W [  X p W# P    0 0Pp Z: R Q  tPp0 ) 0 Q @pAA-@Pp `@P   @P  0tA-@p000 0P q`V0S S a DЍ00SU0$`P2 S 1 rt厚 0S 0SpWX00 0  P 0 s0$`P|B@p@-`@ PL L0DD0D@$ @ 0(0, 004 <@m$mmptRxR Sp@-PM@0 `0 `0ToP  1l 0P  L0OPPPЍp P dlAx] 5@-@5P@- 0  HS@- P 0 Xp@-PӘaK*N P pɘT*p@-@Thlٝ0@HSA-pp@P`X A 0L Q 0S , ⺝@@ PAHS`S@-(0 R  奝HS@-@D0T@ 8 T21!0$珝劝HS@@-@@ 0S $04#0S @lHS`S@-@- 0 bZHS@-@-@T A S@A-`PDAzUV`` A 7pP&A p7\  0 PE("P@kЍ P0 ` P P0 `00 Q0%0"0%0 `%S3#SQ0C0 ;s0 S:P 00 0S0C 0HS`Sp@-P@$TUT 0 Q/pQ Q0P 0 PP SA-@Pp`UT VW@@ P&A 0,0p 0  ASp@-@P`\00Sp 0<  RV00U 0 00pHS`S!0P /@  Q  R    /QRP  /LA-u ;P@ ~PPj P@` p9T/T0@DF&_ @P;T UP@-TS0S H3 Ѝ@- PL 5PH0CS?0S S0 0 CR 1"!! s0#0 P # OP [P% P10 FP_ OP0@t E@pP 010000$r`0Vm0S Ѝ 10@S񟗺 XX YVY$YVVVVVVVVVVXXXXVXVXaHP0P10@S񟗘XXXXXXXXXVVVVVVVXXXXVXVX~P~&@p'@@@24P2P00@S@h~P d@!  0W0S S  0S  S03/`|XRLSp@-@PUT@@ A @`L0SA    p0@0<@pXLR@-@p@-@PyTU A +Q oA|p 0SS S SCQ !Q^`0 @00@ 0@0<@C QXLR@->@M@- P X P0S 8Ѝp@ @P0[S `@PP0;ST @ RS 00C S!2#1T `PΚ1UOVÄ ń0 @R  U R  R  U V   `P0   ЍpHS`S0@-M 0`0P 00`P(@pP)  @P!00@0 @P0P000x x@Pp 2 0@PTЍDgSBR SBxB\A[HZ+Op@-P@U/ 0S, `,@P% P (PP%@ P PhP zP EPP@P 000ES S @ @S@KS@ fSP@pM-`PxM@ CP, R0u%%% p ,#     \( S$0 ,̠S(#<p   0@xЍ   * \ S0,̠S#< p  00S00(0d0S S  )1n*@ )0+n h^n )0PP P 垙as@-@QP" 0S +@P P6 (P P hP zP EP@KFLd )n@Ѝp@(00 00%0P`0 m n0%@0D 000ES6 SL @S(`0000000 0 0@0#<  0KSL fS@(00000000 0@0D00D 00D00Dz@(00KP0 0S0000000H0@0Da@(0000 00000 #400 00 0 @0D00DpF0000000@0 ᑌ m@[0@*zP0)$90000 00 00@CzP/0S 0 40S//P/0S0S/@-0S0SPS0SSS0S/S/P/0S @-P/P 0S @-0 4P/M-M`p P@ T9 0S 'P @ P  0R0 0P  0W 0 U: ᢒP Z001105U ᓒPЍRAp@-0@ P`Pp0p@ P0/ R RC/ $0p@-PU `f@P@p lM-R``0 PP QM@pE`P  lX@  ,xl@ sl oly 0 QA-@APp`0dPP  Tl Pl `0PPP ?l0 $9l0 yR p@-`@PP@$D`P@p/A-`Q PAgV@pPPP l0@0@ k kyA-PQ00P@`P p`P  k00SUpP/0S@o/0 4p@-P@xU 0S*z`P xdU0  0 kpyp@-0PS*``@P  pA-`p0@@T:PЍFPP  k0`S 000T40@00*j00S `0 ,gk T0P?/P\0y@-+@P  8Sk0000000 0'Gkzy@-點뺞5@P  4kyM-p`P $@P. 00000000W40W80V4 0V8 0U4 0U80Z40Z80X40X8*,p`'|&l P0%\(< ( p `P0jy0A-00p`@PP@&|@PP@0SX,P 000000@A-P0M` 00R0V0S Ѝp@ڏPڞ0   ~UT"ƏP P[p序P<000 P P P&{Q/Q0  $R Q :\\/0//p@-` @PUpP0S 0S  Pp@0 4PE@7@-Po/@P @/ Ѝ00@- @^M-@PQ0M Q A QPssvQ^  HR. RN RA0 $0(00,00 4 8 < 0 0  0 0 0 4 8 < *  0`4 CR PCpDdHLⴆ`@0U ` 0t4 8 ,P000ЍR 04 8 <$ (,"(ϔ0BS,tTtvv8uvvvvvHuvvttuvvuvvvvv|vvvvvv 0d400 ᤔ0 4$0 (ei 50 0 $ 0 ( 04,8<倔 `R00  Rv `R00! lP0 |$0tSa 0`p P XW`$ 4Q0` 0  4$?S 0  4$ h *`P#唃s0%00PU `0p\t0G~SP@#0GP  R  0,P0BS񟗛wwxy h  h)0S ТaS0  `,(0p h0 $0(00 ,“,0`0 $0(00,00 4 8 < 0 0  0 0 0 4 8 < lx d厓 0`4 CRPC⃓pDdHL⤀`@0U{ u`0A\`P僓~0 $ B0h0 OP2oYeiBw\/[k&O1\8klj[=DdV@-@MM|T /`P,p<+R0S0S 00@xۍЍp0 4@`@-@MTT  @]܍@-@W @?p@-@P`8 @Dp@-@-@;p@-@P#@0pp@-@Pu@%pp@-@P @pp@-@P@p@-@@@-@T @s@-@!`P P  0`P堒Ѝp@-d0M@P0  hP 8$P$ ,(p僒Ѝl/x|̉ M-(MP"@`T 1#`P!@ܠܰT(Ѝ 0 "P00"@00 0pp K~P 0 #P0 !@@-pM@`/PfY0W AfߍVT 0ES 0P   012/Q1 QA2 ڌP H u@@P SKBqp@-@PTU00 A X >A P 0r@pp@-P`P@TA$ pp@-P@ 6f0000 00000000pyM-(MP0`p 0HLPf0V0  ,b@\TW@@ hℋ@jVPHX\0W@0h| T  h /00@ P,/@ \QP* @a؋@P% `qы@P& qʋP+@PC \p@`P<W- ᥩPAP`@(Ѝ@p* ኋ0`.S  `0@[ S/R` oZ 0 P@UP  0  @ꙩ`0 P0告yP.{~Op@-P@4P@h@P@@`|pp@-@@P P phPpA-`@pP ,PAh`/ʊP`QW90 W003:P H0/oL#2>0#"0R >AЍP+pP&A p+ZP A?@P  0RPALARQ00P0S,p@-P0@SM X0> 0PS @`P Ѝp0000$hⓨP H0L0 H0 L /p@-@PkT Q  PPP Pnpp@-@P`U @ap@-@JT A X0@>AT@-@=`嫨JA-pPM@`/UW00V0Sp00S0T0Si ZP,hp/Pp)0) S5R:PP Jd !PP0P@S0 00@)PЍ 'P!@0Q PQ0)S*0* d* 0 0 0 !!2  <PQ0Sā00Q QLA\ACRQ@-00P0S $(`,P00C 0@ \^600 ` P@P:Ѝp @-M8P@`pU A  @PP @Ѝ@-P@`h @pЍp@-@P@`@f$p0p 7/pLWQb@P&Q U0$p, 7/P;U00 ЍLAQPM- q(M P0`SP@`R @>P`0ShPP`dqAd[`gP `8 00()ppV`1q3d5+:U-  d?c`p ! H L8\(80 SH00H0 PP P(H0L 0 H0L p`)R q pPH0 L Q$00@P000$h⳦PH0`L0H00 S L05*(Ѝp@-@PT Q  dPPP Ppp@-@P` Q@ps@-PP0@S` 0`0`0H`LPЍpur `P`Pp@-@`P^ 0@jpM-M@1PP a03/PIU ЍU@T 0S0S`pT0S0S : 03/$P0TUPE6P  b'` 03/P U@ 03/00@- 0@  Ѝp@-@P@ppL-`P @}  `P@p\( 0Q0/Q/S0 4/p@-P@U< 0 pQ0 Q00pS@-@T :@-:p@-P@0S pPU/oP"U&pp@-P@TU p:pA-p`@PtW5 o0SP.V/o"Q(:A#1 Rn V蒆  ^ S@A   ASM-p5X _o0RSPU = QЍ``#@@D0 Sb`.`[Q0 0a0p@@DSM-Pp`U 00S0V0S  W〠@ @D0 S: )P 0 $0S* @YaSp@-@P`Pp 0 PPRp@-@P`Pp 0 0 PP0 P P>A-P` p @T 0 ``-M-` 0@4 8 <000S@0 SS 0C S H8(8888L8S @ AЍPP  `0 P Pp 0PT 0X 0\PX(PP\ PD ,0- .40CP ; p 0 0 0 X0 P 0PS p50S S]PpPP0S S 0 0&  !R 0\&A [ A&AK &A PP PP 0 40 X$0 $Pt $( pP  Z&AV  J` 40 pp 0 呲+Sp@-`P} @PP;PppA-@`PpT P:W R U RP  PPUM-`Pp yV P: 0UWX@y   E`F!_p&`P 0QE0ac@ T  P 0U0UapPL&M-`p@$2V YP=:TW00X0SP 0 0 F!]_`%P 0AD`P U  HP @@ @0t`S@*P&A-@`pT PP : [_@PU  P 0S:0aFQU i%0@S*M-P`pU P:W @@T@V@T  h@Z0T@;pP @Vp  RP@XPPA-Pp@T` 0 pp0V: `@-@ 0 000@@-@ST zP^:YA-P`p@VUL Q(Px0P 00 00000 0@ 0$03&QyPPp@ (SA-`@V 7P:AT A0PpT0X0\PUO@0 SS 0C S ̠ ؠ S pP Q@- @0  Q 0# 0AS 0光M-@ᴀ崠P尰U`0VP  Pp m(  Bd gT T:(00T*8D[Q $V T`R|BO?QM:\ <0 Q:P5PR/ /M-@ M `PPX# T' ЍQ 0S( 0  R 2Q?00 0r5 2800 @P & P( BV`1(0 0(0000! 0N/ ]X.0T00C??_[0,00 @(`00Sj 1Q40 0/5 2800 @P (0 0(0000_ PR R(] 0X]H(pG@P SP PR"&p RPDXdt ,( @    P P Pxl/ 0"&*?;(!00p   GR:T+H2V7@-@P  P 00A Ѝ0|B0S / A-P0 @4 `8 <000C0 04000C0@A;U0 000000@@- P  0$  0 >0t ЍPC/M-`@pᇜP'T  V R QЍ1p1@1P0S&Ŕ`V&0pW-0S ` R^P8@ 8@ t1@DDPUMdd1(0`1,0RR0P 0S 03/` &,*  Ơ ^`PpD0P#\ 3 "R D`\ #3V3 "Z`` 0R  00@-wVP`P P0S@-dQM@TR@PM@PJ8a@0!,,` @@P=p  @p 0SP! 0!0!00p@P(h@P% @P"@P@P @Po@P@;|P@D|0 040`0v@P (奂@ЍSDlAoBo\oJ@-`@PvV3 : 0 ] Ѝp@-P@`PT n P .P &d P _0` 0 0S0Ѝp Q QF|Ph$p@-@`PH 0D\ P@P00p@~h@-@f@DP@rp@-`PY`FPE@@dp@T@@@-@B@DP@N@-@s@-P 0 S R0@ ?P [P *P9PTЍpP@ ]PP -PPD_oR TTP ]P P` P]0P0P``VP%0s0STp@-P@@p@-@pP`00 0 00RPT000 Ѝ@-@P`pT A 00 0 00B@ Ѝp@-@P` R@pA-`P@pVU00T0S A0 @00@-P!M0 0 0000 00!0 P@P3 0@0!0@P) 0@00! 00@P 0@0 d00! 0\0@P  0@0!0$4@Ѝ0 |lAooooo}A-dP`p@ P  X{P 0㓄$@T PKA-0P `pQP@ @P 0 QP z00@Ѝp@-`P@@0 0T*0 0 R  0@RQp@0@-M 0@P|P)U\ 0 P 00< @P00$ $@Ѝ0UbEfiVapĆT`@-\@M0sP 0 00< 6 P UЍSEǿ^0M-(M 0 PP& 0@p0 `0X30H $0T 00T $GQ:P" P  (Ѝ$p 0H 000 0 0QP0 00 000 00@ 0@D <0  DVQ 0@P0 @0UbEfiVap@-(M @Pt@P`P 00 0@`PP"UV A(ЍpM-0 M0 D Ѝ@ $$1RP P B` QV0@U#* pPX`` 0S%   OP !` 0 \PP d P  yP 000`PbUbEfiVaDU~@-M6@P]&ЍP0)00 h 0しP!RDESR tPVDbM-pP M A Ѝ0QS @@ 0[0R0SA0S 0S  0S  O@ P0@X[00 0 U` 06 DQ Q"ASQ S V O>@00#1V R 0 R@   0O@wOTR0S:AP 000@0 0 0O@[OTwVXPp@- @P0 S P0SP 0`/ O/0 pA A 0000400800L0M| @-PP@@-b~0 NU@0Q0 #0@-4000( (0@P A~Ѝ͆@-m~@-hyM- MP@pD`@P&v uWU (PM  PH0 00iP?Qp0\0CX0L010 t`0@  l1p lP"V,0S) bR818$001V(0(1,0$100 0D00E0@0 L P @ 'H0 @ & p0\p0CX00ጕPVP p | xP ЍF0H0 @L0 rL   ` @pCAtΆ ц$҆`Ά`CSA-PPp> 0S6A/0S2A+ ` R  B- >#0"P :4@A@AGpuPP 0 7PCWA 0 # AA-PPpB ` 0S"A20S6A.0S2A* Q A- ƃ>#0." P :U4@A@Ap+PP 0 "PWAQ 0  A@-@ P 0P P P Ѝ@@- @P Ѝ i @bT  P0`CM-@ MP ЍW 0&S& R  Q0h|{0P S  ,|PP p#P4@쀟<@D<0S  BP p ` SP00Sh0`0 0`8P`OP p<@<@D1A[@-@ PaP PP Ѝ P 0&R> 0S p@-P Ѝ////////// Q00 Q0S/p@-\`@TpPL0 0@0t0@@cR,00P 00Q000pA-@T @00SLPpW@0@`00pS  D00D000< A׆x>@-A-P`p@UV00W0STA00S@000CSNA #P00^0@00000000 A@-@-@-p@-PU A @0@T RA0D@0<@@0 pp@-@`PWT A @00SNA SA VD000D0@0U @ pM-`0P60VS00U0S AO@00SNAJ SAG D0SL 8q8  @ DT=  Ot@,0Z S  O(0S  O00S@@ !PA3 5:0O0 @!0 s 00bR000CS 0L0D000< D06ЍA Ot@AM-@`P p$( ?o2 V0U0S6@ QA.[ XZ00 Q0S'W  mO iO0? 0S4 0@00SNA SA Dp WO̓(0@@D00D0 Ap@-PU A @00SNA SA@㎃ 0D@0<@@0 pp@-PU A @00SNA @v0@@0@pp@-PU A @000CSNA @_L0@PX@0@Ap 0D@0<@@0 @-@oT A @0 RNA RA s @[l//p@-x@`0PS -N U -N<0Pp-Np RPpM-(@P (0cP,s,S P ?? P @ ,00S @T 2P  "@P@3| @P{d/.@PuPH2`@ 0@2$082@(002,0,200(240$280 2<02@02D02H02L0 2P0`0X03 DN0Ud002/>F12121313131 3131313131 31$33>(31Q -N0pQ h!P0@P TYy 0DQT 0,!40@P 0@P Ѝ@@0S 0@T 0&A(y0CA@C0نh݆݆Tކ܆نن؆4؆ ؆نۆچֆֆކֆֆֆֆֆֆֆކֆ׆XO7@-0  0`P PA@P H@ 0 O@P  Ѝ0 xTUA-P@`p UU AЍ0UW 0S0SV AA0o`P PPx3:A@P + X0 R *0!A 03/0 3/@00,CC07@-;@P Ѝ0VPPXtx: 03/00 0 00C,CIA\B7@-4@P P$0$ 0  0P&P Ѝ0,CIA\B@- @P d:xЍ LL 0<@ 0@ @P $xV,A0000 0C0000000800Z04 T100 1H0 0,004800@<00@00 PD00$40 0S004 $0SH *0@S*1R1RH0000000800L 80L 80 p QpR[0 $0L H0X0,000P /M-@`pPD,01H R 0S0, 0 P%L0S VX0+ S\ Rc^]0L 4_X 8`<3? 000$0 ST:H0S 0S0, 0Ѝ X  0\ 0`F00S0(0S20(0S P0S 06'#0R'0D0@0<080040P0XXOV 00S F   P \GX`0000, 0 0P Z P3P0 PC `FPg 00X  V00S X\0  0P00 0[P Z 00P 0 B 0B0`HX@-@03/00p@-`6W 0,S0@S T0S 03/oTPppR/pp@- 0@4 8 < S:3 0PU 㐋<0qS%3[9C[?C##10㉋qp98@- P@`P P ЍpM-@0[0xM0#00pP`0 Pp0000 0 0P0 R,  nxЍH@-4M p0C@` P$0iF 0 S!0 AS\  |t0r(0l0,00 S3:S0 (000000 p$0@ 004Ѝ`X l0R3?  2/R 2/R /4R$ R s/// /PP P($// /08!QF@-@04OTB 2/R>T<:1P9Q7 2/PQ3\.  2/R3#RT\# 2/PQ3P 03? 030#Q030"S\ $<Ͽ 3#Q3 "/  03?0#3@-@(>T>^($ 2/Q/0A-0 P`P 0p070G@S`TTTT p @P 0S DP @@@ P  02/3? R@S@@-0Q Ѝ P@-0Q Ѝ P0s@-Q`P0P@@ P P PU000ЍpU 00CS0@@T@Ut@0@- 0P0S Ѝ0@-@0 P0SSЍA-@Pp]j`PEPT@ jP @p@-`R @PPp 2/V:jpp03?*03?0CQ//7@-P@ P P@T @ Ѝ0P @p@-@`PPPUp0U3?`03?0pp@-@P`I0P. 1S C0S U03?S 03?U0C0 :0tSU0e 0SR !@pjP V@p 0V@00 / A-`pP@P}P 0 3?2/ 0 3?2/ @- @g0P  0  A-`@Pp0P0P07@3?@S@/iP @U xi 0U@0A-`Pp@P0@0#ЍS `P 0U iP 0S  @iP0@S  @0 ZS@p@-P`@5i 0p@@-@[P@@-@bP@M-(`p,P@XP@ PP  1P 0W  piP[@Ѝ @@->^\ 00 ЍP@-Pp`@h 0p Ѝ@- @P 03?S 0 0 03?S ЍA- pP`@P X  1PV00Ѝ03?S P 03?S @-Pp`@h 0p Ѝ7@-\ 0@PP 0S 0 0P 0S0 Ѝ0A-pP@` @Pt V`1U@`@-@P0s T00Ѝs@-P0@`BP0 ]ЍpA-p@sPP.0`/SP  /hP HPP @PT:T 0@/S / FhP@@ 0DPPp@-P@g p@M-p0@P[@Ѝ@P`0G@00 T?0S3  0PE/Q BSS  C`S $P @ 0 S0iB/ 0`P T0S@UPE@ @t@ࣹt @A-pP@`PT Ѝ0SPV0S 0P?0Spp @- 0P Ѝp@-@P Ppp@0 B0Asp@-@`P@P pP P@A-@Pp5g`U  gP  g0P@C@PE@s@-0P@P`P ЍpF7g@TPT:PE-p0l@P` f` T`#*JgP U P @` XgP Ѝ`@-p0 PC@P``U0@ ЍFf000SU 00WU@pGT:U0@-@0( P  joЍp@-P@`Pp P@ ppPpA-0Q0@Ѝ`PP@03?U:P@pP R0S2 P00S@P+8LxxxxU @PJU 0S 0S @U PUp 0 }P@@ @ @0@-@000ZЍ mP p ,0`$0P////hD03?'S<Ͽ Q 0 3?R  12/P//p@-@7PpP5?S $ 2/PU40p p pp@-` <Ͽ1@R  QVP!P3U C R :0R L Bfpppp@-`@"2PPp0@D3?23?0 03?23? 0pp@-P`@Pp$ 0D2/ 2/$ 2/03? 0pA-@P1(p(`e 30 16o7ep$`  12/8e 0 0M-0@0PPD pZe7 p` 1 P`Bp :10 0k `Pp  02/ 2/  ? `pVP0100  0PP W e 03?0C0C3? 0Ѝ$06o 0`0 3?0M-Pآp@PW` 6ob0F@P78:;p ЍA-Pp`@P 7P6o0A %@A-P`p@P'  0P p00 0RP0( 00 0 0  P4O@ p Ѝ@- `P 000@PV   I?ЍpM-0`p@P  0PP 0 0 P  :!?Ѝ00 0 P  @@-P`pb@P 0i P@   0 @ ЍM-@PGP10 P)p'   @PPp5_P`p 0xP40@ > >4 `0Ѝp@-P`@c 0p@p@-@PPpPp @<Ͽ  p@0EM-P@`p&P).03?S$03?0 00 PP P jP4006o3?$0`Ѝ 0(3?Z 07Up0#03W0Sp 0 S 0  c(06o0402`000 @-00P P 0P Ѝ@- P p @- p0@A  S " /QM-@ 7 Q/ > 0010 0 Q 0倂Q`UUUpU0 % `p`&0`&`P*E@(ETp'pEQЍ=0= 0Ao[Q ` pxf^M-PMl0@ 0 P0 0 p0=pT0 D0t0u00pp 0x0000|0000q0 00$0 0(0y0,0000}040080r0<00@0v0`D00zH0~0L00P00T0{0X00\0w0`00d0s0h00 ST00 0. 3  " T " " " (  ,, ,(   " " P  " ", " p ",!L  ! 0"L   "h " P0  "!h  !@ d"   "4 " d "4   "< " 8 "<   "` " 8 @ "!`  !H \"   "  " \ "   "D " $  "D "X " H$  "00#X  0# 0<p0000 S! lp<Ѝ 0pt00rx00w|0(0q000u080y0$0}0@0z0P0v0H0~0\00d0{0T0s0xfM-P`p  M P  < xl0 0 00TC0PS00H00 00 0 0  0  0 0 0 0 0 0 0 0  0     0 AX Ÿ 0 0#0#p 0#0 0 0# 0# 0#0 0 0# 0# 0#0 00#0#0#0 0 0# 0# 0#0 0 0# 0# 0#0 0 0# 0# 0#0 00#0# 0# 0 0 0# 0# 0#0 0 0# 0# 0#0 0 0# 0# 0#0 0 0# 0#0#0 0 0# 0# 0#0 0 0# 0# 0#0 0 0# 0# 0#0 0 0#0#0#0 080SH\ ; Ѝv*-0\0#0M-`pP@04 TЍ 0 @M-0M`p  PP@;T0T0Ѝ u; 0    h;@A-P`5/P0@2S%P!Py5/0@?S?vW5/0@?SC5/0@?M?S@?vpP P 0S P00///@-zpp@-@0PWP 0P0pp-L-Q7 R4 P006@ \03S,P-# PP=#=0µP6P=ౣ=0µ ?0<<@Ɍ 0 00?0<<0? 0 000/7@-P@00SU Ѝ0P @P@PE P/0S P/7@ Q:6@ Q/!Q 00#7;AP0CSQ/Q 0S P  6@ \ 3RPñ @@%6+ 0P 7 000//PQ7@- 0@SPVP?PEU 00S0 Ѝ07@-P@00ST Ѝ0P @7@-P@00SU Ѝ0~P @PEP P@P@@PQ7@- 0@SPaP? PEU 00S0 Ѝ0P00A0@S /0 R/R/SP00a0@S @/0 R/R/S0@AR/\/\/ B@-E6p@-PP `k@P@p 9A-?P?`p Br@\0 7C X@!`$* 57C;C#SS?000S0 S*#?0006C Q1:7C Q?03:#S?0 R/0A R00 0S?00/\/ 00#4s0   0Sp $ R/00#s000 #k-(0LR0 4#00p i@-@  49Ѝ@-@0P 0S@4OЍp@-`P@ 8000@TD0@000pA-@p`P 8 00 0PUT0P@0@ @00 00A- 0RP``p@X @].^0 ]P@ ^@pn@-@P@ A-@P` p8000`0Vd0`0 00d0pPH00 0 0 0 0 0 00C 000nnA-@Pp `T8 0 p Wt0p 0pP%  x0 000000 000 0 0 0 0 00 00 0C 000 TpP {nA-@Pp `8000p0Wt0p0 000bpP,WpPl! \BXG0 0 0 0 0 00C 000nnnnnA-`@Ppu@ 7000p0Wt0p0 000pP pP X  \hd 0 00C 000(nnnnnnA-@P`2 p^70000p0Wt0p0 000000p0000000000000(00)0 0 00C 000nM-` Mq `U0S L`Pp@ @@@70а.0000Q  0 3/WpX t-7P0` 0XPp#700ᶡἁ ]] ЍPdUM-@MPV A8f  @p D H^ L^Čp^Ȍp^̌|,Jp @ pϠᤰO@ p,pp^^^Čp^Ȍp^̌p^t^x^| (z p ᧀ$ $p,,pp p^^ ^Čp^Ȍ p^̌ p^ p^ p^ x'ʈpp?0Ϡ000 (000p^,(0^ 0^Čp^Ȍp^̌p^t^x^| 'ʈ pppϠ4p 4x'#! @Ѝ 0  . .!-"2#0  0pg& "&5:ej! 0O'ֵ='`y5zNay7[ީlycwy7gVgV/'p@-@P`PMP  4\0\ 00T0 0 0D D0 A@80 0P  @$05PЍpֵ'`O'=y5zNaM-QM` @000H0Pp(4H00H0ЍSP ( c4) (0,4* ğ8+ <- . / !"0 0 p?0t$.20 0014p4283<5t6x7|.0p0p?0.20809x?|.0p0p?0.20@0AEp4B8C 0 pg& "0#ej5:0! =O'y7wcy7gVgV/'s@-`P@PЍp0 .RVDPUD`*^PUD47@-@Q PP ^0S@U@T Ѝ00  P 0sC@p/ 0@-?0S]00/  S. \  00S000\\00\ P0R000^ @ ^\0^0 00S00R /@-0@- R< R0P\ 0\00 R~ 0P S   ^ O P @ 0  0\ 0S00P  0 R  00@ \ PP  T 0000 ^@@0\  0@@\P@9S  0 0P S   ^  P \  0R0 0I 0P/0P/0P 0S 0S/0 S/0S //A-p@P `TUT@@Ѝ 8/P@P@P`0Q/M-@P`M pT 00P0S`V8P` aT`VS:V`` 7/0PP0S@P`Ѝ `  RVVPP`0[0` aT00 0 `!R 0` 07/0P`0PP`0PI-M-9 0  0P 0#0 0#0 0M (< H  % . n (  % , ǎ @ # @ " @b%@`XH@@ 0.00#0@<@`0H@@, .@n@`H@ @" ,Gǎ@@ #  " @b%@`G@@ 0.00#0$@< @ `G@@, .(@n$@)KDO@D @" ,,@ǎ(@(`HG@@ #  "0` ,Gb%@@ 0.00#04@<,@,pG@@, .8pFn@ @" ,<@ǎ #  " b%0,0 0#0=" !(h # ,LlɁ !  " ,b&0,0 0#$0 =" ! # ,lɁ !  "  b&0,0 0#0=" ! t # ,TlɁ !  ", 4b&0,0 0#0=" ! #.ട n  !  " ༴b& !, 4l΂00. !(400 ".l4n0 0,0#0P$4 !,4$l΃  . !$  # "$ b(0,.,30 0!,3lΎ00" 0# 0: .!#a  ,. x#  # " `ßb. 0!,H3ʂ00. !,3a0 0"0#04   " b- ,l˂ !p00 0#05   " ` b- ,$``l˂ !`@00 0#`0 5   " b- ,@l˂ !,@00 0#@05   "(@ b- ,hl˂ ! @H0 .000050000 0 0 00ЍxjVνp $|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ(00$00 000 0000/#EgܺvT2M-@ 1000%P0"0%0~>`0ҁp @h T 1: ]SI@@D `@?XJ?? MLS@ IS5@Hp@-0P1 `  ? cR@7 cO-8 H-0P00T0 !Sp@X 8-A-XM@ pPT: XЍ`EV`! @M-MP@0P `Č UȌ ̌ $`0(<00@0=|0|800@ 0S 堁q1 a!p`p @`D _, " !P%ϟ( 0#(,$#<4 p`p`H`H`P%!%hh!d威hdDp "h`0# ?00! 00 01q0p0Hp^L,n! P%Ο`&  ( "(",$0p0T00X0T0q`&X0刎P%&88%X0800hn0t00\Ο0x0t0!x0 "0?L0 00$0墿! 01Q0PP0 .PT,!.`p' "'",$(p帡$p,p(p$p0(pP0l00p0l0q.p0],.8 8,Ƞ0800`0! "0?`0?\000!,040 00,0p00pX0\,!.<0#P*"*,$ 84<84 8 p,0#,#8 8P  "ό /@<D<@D@p HL 0# .L`+p(+ld'| tHDLHD H  0# .#ȠȌ.80 000000`&0p'0?`0?0P0\`L0T0LP0T0P0X \0` . !#``Pp%(ld'|tXT\XT0X00000,0 ,88  000 000`&0p'0?`0?0`0\0d0\`0l0p0`P0P0,0%d0h0`.p0 '&<4",$h`d`l`h`d`h`P ! ȠȌ! p "0#0?0p0l0t0l p000p 0 0P(t 0x 0!` 0 ,0 &#,$ x0t0|0x0t0x000000P%0%H!H!88`& " lP/pP P * !p " "\T L P  * (*((( (   P%  /P /   P P"p%,`&( !< @P  p' .'((. (    ! ᠿD H  @$ 0#P  `% (&, $,̠Čt`x`0#@$#$H800@, "0?0d0 /h0`00`0,0&0 0p00.00P'0#<400%\T,0 00`000000*0*h!h! p0P%0#ό0?P崠P !@ `& + \ T+\ `  !`&!&hP%@+P  @,`. p '&\T",$ ``  @$!$! P% "P/ T X P P  %@`$00(&̠Č#<44`8`P . "."(@(0#,?0$0(0`00`&0 0,p0.0P'# %\T0 0`00000*0`, 0*ȠȌ#8 8pP% όTP夠`XP ` !@+  , \ T,̠Č<`@  !+! +P%,P\` @@ "P!`.p'& ,̠Ča`@ "P%"%X(    , ᠿ$ тRQɼg jl>+h;ʄgrn<+kAك:O[y!~6_(   0#P! @  `$ (&, $,̠Č ``0#P%#%X800@, "0?0t0 /x0`00`0,0&0 0p00.00P'0#<400%\Td0 h0`000000*0*h!h! p0P%0#ό0?PL夠PP !@ `& + \ T+l p  !`&!&hP%@+P  @,`. p '&\T",$,`0`  @$!$! P% "P/ 4 8 P P % @`$ 00(&̠Č#<4``P . "."(@(0#,?0D0H0`00`&0 0,p0.0P'# %\T0 0`00000*0`, 0*ȠȌ#8 8pP% ό4P夠`8P ` !@+  , \ T,̠ČD`H  !+! +P%,P @@ "P!`.p'& ,̠Č``@ "P%"%X(    , ᠿd h   0#P! @  `$ (&, $,̠Č\```0#P%#%X800@, "0?0T0 /X0`00`0,0&0 0p00.00P'0#<400%\Tl0 p0`000000*0*h!h! p0P%0#ό0?P P夠 !@ `& + \ T+, 0  !`&!&hP%@+P$(  @,`. p '&\T",$L`P`  @$!$! P% "P/  P P % @`$ 00(&̠Č#<4a`P . "."(@(0#,?0t0x0`00`0&0,0 p.0P'# %\T<0 @0`00000*0`, 0*ȠȌ#8 8pP% όDP夠`HP ` !@+  , \ T,̠Č`  !+! +P%,P$( @@ "P!`.p'& ,̠Č4`8`@ "P%"%X(    , ᠿ    0#P! @  `$ (&, $,̠Č` `0#P%#%X800@, "0?0L0 /P0`00`0,0&0 0p00.00P'0#<400%\Tt0 x0`000000*0*h!h! p0P%0#ό0?Pl夠pP !@ `& + \ T+   !`&!&hP%@+PTX  @,`. p '&\T",$\```  @$!$! P% "P/ , 0 P P % @`$ 00(&̠Č#<4<`@`P . "."(@(0#,?000`00`&0 0,p0.0P'# %\Td0 h0`00000*0`, 0*ȠȌ#8 8pP% ό P夠`P ` !@+  , \ T,̠Č\``  !+! +P%,P,0 @@ "P!`.p'& ,̠ČL`P`@ "P%"%X(    , ᠿ!   0#P! @  `$ (&, $,̠ČT`X`0#P%#%X800@, "0?0<0 /@0`00`0,0&0 0p00.00P'0#<400%\T0 0`000000*0*h!h! p0P%0#ό0?P夠 P !@ `& + \ T+d h  !`&!&hP%+P48  @ @,`. p '&\T",$$`(`  @$!$! P% "P/ t x P P % @`$ 00(&̠Č#<4l`p`P . "."(@(0#,?000`00`&0 0,p0.0P'# %\TD0 H0`00000*0`, 0*ȠȌ#8 8pP% ό\P夠``P ` !@+  , \ T,̠Č$`(  !+! +P%,P @@ "P!`.p'& ,̠Čt`x`@ "P%"%X(    , ᠿl p   0#P! @  `$ (&, $,̠Čd`h`0#P%#%X800@, "0?00 / 0`00`0,0&0 0p00.00P'0#<400%\TL0 P0`000000*0*h!h! p0P%0#ό0?P夠P !@ `& + \ T+4 8  !`&!&hP%+P,0@  @,`. p '&\T",$``  @$!$! P% "P/ D H P P % @`$ 00(&̠Č#<4 ``P . "."(@(0#,?0<0@0`00`&0 0,p0.0P'# %\TT0 X0`00000*0`, 0*ȠȌ#8 8pP% όdP夠`hP ` !@+  , \ T,̠ČT`X  !+! +P%,P48 @@ "P!`.p'& ,̠Čl`p`@ "P%"%X(    , ᠿ\ `   0#P! @  `$ (&, $,̠Č``0#P%#%X800@, "0?00 /0`00`0,0&0 0p00.00P'0#<400%\TD0 H0`000000*0*h!h! p0P%0#ό0?P$夠(P !@ `& + \ T+  !`&!&hP%+Ptx@  @,`. p '&\T",$` `  @$!$! P% "P/ < @ P P % @`$ 00(&̠Č#<4,`0`P . "."(@(0#,?0 00`00`&0 0,p0.0P'# %\TL0 P0`00000*0, 0*ȠȌ#8 8pP% ό,P`夠`0P ` !@+  , \ T,̠Čt`x  !+! +P%,Plp @@ "P!`.p'& ,̠ČD`H`@ "P%"%X(    , ᠿT X   0#P! @  `$ (&, $,̠Č``0#P%#%X800@, "0?01 /0`00`0,0&0 0p00.00P'0#<400%\T<0 @0`000000*0*h!h! p0P%0#ό0?P\夠`P !@ `& + \ T+   !`&!&hP%@+Pdh  @,`. p '&\T",$4`8`  @$!$! P% "P/   P P % @`$ 00(&̠Č#<4` `P . "."(@(0#,?0L0P0`00`&0 0,p0.0P'# %\T$0 (0`00000*0`, 0*ȠȌ#8 8pP% όLP夠`PP ` !@+  , \ T,̠Č `  !+! +P%,P<@ @@ "P!`.p'& ,̠Č` `@ "P%"%X(    , ᠿ4 8   0#P! @  `$ (&, $,̠Č,`0`0#P%#%X800@, "0?00 /0`00`0,0&0 0p00.00P'0#<400%\T$0 (0`000000*0*h!h! p0P%0#ό0?Pt夠xP !@ `& + \ T+T X  !`&!&hP%@+PDH  @,`. p '&\T",$l`p`  @$!$! P% "P/   P P % @`$ 00(&̠Č#<4\```P . "."(@(0#,?0d0h0`00`&0 0,p0.0P'# %\T1 0`00000*0`, 0*ȠȌ#8 8pP% όQ夠`P ` !@+  , \ T,̠Č`  !+! +P%,P  @@ "P!`.p'& ,̠Č``@ "P%"%X(    , ᠿ    0#P! @  `$ (&, $,̠Č$`(`0#P%#%X800@, "0?0,0 /00`00`0,0&0 0p00.00P'0#<400%\T40 80`000000*0*h!h! p0P%0#ό0? 8 ? <3?000<00< 0 000000@00@ 0P00 # 0 @0 "P0Z48y<0= 0 `1#< P0e0#@Zy 0$(P0<=` `A.@`A$Zy @b. ZMc1 yb# b, dQ#P͌b`P%x+Pd   d.\;]l!  0d1 " e1HPlA#ZTXy\@PlA$P0P-ZTXy\PlQDnA#ZČȌy̌@@$80 Z4b!8@y13?01? 7R3?8 bx b0  00000#40000000 0#40 00001 00#4 00 00 01 00#400000100#4000 Ѝ0kA-`M@pPT:`Ѝ`EV`! @6000<0080 0400000,00(00$0 0 0$0/g jgrn<:ORQhك[M-RhM{ 0BX0 0@4> [8= [<3?; [0<0[4: [89 [<37 [80[46 [85 [<3?3 [040[42 [81 [<3?/ [000[4. [8- [<3?+ [ 0,0[4* [8) [<3?' [$0(0[4& [8% [<3?# [(0$0[4" [8! [<3? [,0 0[4 [8 [<3? [000[4 [8 [<3? [400[4 [8 [<3? [800[4 [8 [<3? [<00[4 [8 [<3?@0 0[ [4 [8 [<3? [D00[4 [8 [<3? [ 00[4 [8 [<3?00000 0L000\000`000000P00L 0LT00T$0`d00%c#","d0B48=0 P00#0T0# 0 `0@06a1#a;#\ 00P  "  "Tc qI  d!! \c     " P "  n!! LP`! ``!  $$(`,  ,%e#"," ` p&a!"``a+" `.Ō[Ɍό`E`&gC$L$  `@6b1#@@b;#0 0$@%YČȌG͌1@@$f..  @c.c.( ' ,Šd,, PƠn,n,,q&{ ppe p l   l 0 6#z*p$.p p'``uas'|'` p6 `1#pp`;#004`p%Jekl`p`Ep'bC$L$``pFcA$ ppcK$@@8 mp!`p`Up'nS%\%``pVdQ%ppd[%PPm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPppd[%PP ` pfic&a&p`@p`pyx'(u'```p"` p`p'l!!``pe!ppe!$`$pfic&a& p`Dp`pyx'(u'` ` ha p.`p`%p'`#","``p&a!"ppa+" 0 (`(pfic&a&$p` p`pyx'(u'`$`$ap,`p` p'c..``pb.ppb.@,`,pfic&a&(p `p` pyx'(u'`(`(bp `p `Šp'd,,` `pƠn,ppn,P0`0pfic&a&,p$`$p `yx'(u'`,`, cp#`p`p'e `` p l ppl 4`4pfic&a&0p(`p`(pyx'(u'`0`0cp$`p`5p'a3#<#``p6 `1#pp`;#0 08`8pfic&a&4p,`p`,pyx'(u'`4`4Hdp%`p`Ep'bC$L$``pFcA$ ppcK$@@<`13?01? 7R3?8 bx b<0  00000#40000000 0#40 00001 00#4 00 00 01 00#400000100#400000100#4000#0020 0#40 00'0020$0#40$00 Ѝ0bA-hM@ pPT: hЍ`EV`! @0ᜣM-  B0@8M000#03P00S0000 0@0C(@A (8,<,040LPX T$P@ $AQ@> @@0  P5 202 >@PP@ ` @Q@P>@ P *@@Q`҅ 䎀 @@A>(@CT,`DQ *!B \ L B  b S!0L0 0C 000B 08<8Ѝ0HpAQ \PpQ0C@\0A\ @\@0| R S1a:Q"*PPF\PPPP4PPP4PQP Q!0!*LQ\PpQ0L00000`CL`0TCPpF`P@0D0@0S0``0` 0ST@#4p@@T00@( 0J@   B?)))M-xM,8P@Q@,`Ap^@Xq^[ 㲰 Ჰ0Ux@DQ@DApWQ~pS:RZ>겠zJpW^ [P^XpⲀᲠ ^㲀PU$P. P! ` \# X$ T#  T @!T!1*  @/o" % RP# P2U xЍ^ xpr^pᰂNPP $  * B(   Ap`@Pe:Tf:@D$`@@ @@`A0 p45 @`@```4``0p`VpAFP@@@x@PDU@Dt@TDE QY ,@ Q)(@ P@T$ RP A8PlpP U*PPFUʯuP\P`PVPPUP @PQPaPHEQPP@``R ( \  p0a@A̠\ LP@`Pzp ! 6x8nomP 0S @- @@4 )@@@ S.@@ @ @(@,@0@8@<@l P L ?/R9 <S1R  3Pp@-@p 0 S(0 $0 S0P$0 00%(3/P U0Pe0 E20/U0$0 (3/00P0ES0$P40p@/pp@-@P PU $0S 40S $04(3/( $03/ppM-Rp M Xp@ 0@?TLD@DPU\EPE,Q) R``5V$V  Q u0p``WH@HP0@PW?TLD@DH ЍVmFW=0`F 00RRR0 R  R0  R  R 0   R0 R RR0 RRR@R0R 000 0 000 0@00P0 S}H@yHV}P0pR0RR0 R0 0 R0 R 0 R0 R 0 R0R 0 R0R 0 R0R 0 R@R0 0 @APT0@PWM-P0M> @T; 0S0S508` S 00 0 00 0SV$ 0   ,bP0`0U 0S`0   ,,`P0`0U 0S v  0&$ 0   ,bP0`00; U 0@`S`0 P`000 & @0W1![ R P  A \  B 0  P@0 pG 0C @0@0S(0@0000;d W J 0S  \ @ 0Q02@057[W0   $ [pGE 0 00p0(08`S W J 0S  $\ @(0Q02@057[W0   [pG000  U!RP:P` R 4,0 00 4 06 R$0Wm  pGePWf 0pGePU6o`4`` 0P0 0S  0 00p008`l0L00T0/>0T00 l0p0P060h000`d000h800P6cPE0 h0h R0*TL 0SWq 0pGePP P{Pl6c0EaPC0YWY pGePPR6cPEG50000S% S>l0L0 0T /T0 pl0` $0 e0P0 $0(5pl `P  X X  d S0P04`001 WR9T0L0  R1AW 0pGeP06&aPE\!@ P0*hvW pGePW pGePP6c0E cPC 0 00p08`  0|/M-@ M  0厱 $(0 ( a0 嶰 p1   P 0 Q 0 Q  R 0 0cS0!`AVVV NP0040OHPoQ3 0Z01,P,0000,PS 2 0S0S %0  0$}0 vP ЍP P,00SPPP1,PUPP,0M-@ 5heSx5pM(``4唠04u 04pZ$0Q 05:,(8d 0(48h l0xp@ 8Ls 8To 8\kP, 83$0`0 000 0(00400 xpZP8 (&Pd0J,8h008l048(pG`FVEU  PEpЍPM-M@@00(0h5T04e,04<04400S 05:,(x 0(48 0xp x  x x x``p@@T0U000SD0N0S00PU (00CU 0pG@ u<0T0:%40]k0<0{o0,0 0T00h00(d0``pxpPW0@pS xl x40`0<00,0( 0T00t00 xpP:pW@ x00 G `p`0l08 0HPD H0\00V\!030#X@$L0:(0  CR:0WL00 GD08 T0,0X0HRD<00HR$PЍ40t0<0p0,00T00 l0( `VPxu0@0S05 x, x``pPH0, C404 $0\0R:$ >,0H pC 7$00C$0,0X\080S0$ 8 \X$0S0$  B[xP :,( 0( 4(Z5TS(0`F0CVEP@@T  @u<0T00]k{o5T(0`F0CVT  @@@0PDxQ01P0/P/G/M- M[@  Ѝ`0PP P P#qpW W A00Q00Sp E P [@ SAT@ r^ Ta 0@$WpP00W0Q0S0W0 XR018#W0D0005S W@  0@0S0ś 0S=T 04 0 0 5@Sou (A(GR5055 0C5xt{5xuh5050S ;(0 0q@0Wp 0 @0Wp 0 j<T (0 0 0  0 0 @ R@1#T T@q pt x'r@pt'rWQWZG0 D000 0 S X5S (G4(Hu .5xuh5 Z@hE@xuE襅4#B00Q00SpR018#S:0D0005S (D(u 5xEh5 48[#B 0T0Q0STEM-pS0MG0ЍP`UPPU0U*0SP T\@TPj0嬰$ P,05, 050@1@081"#001 00H0 00#0xpX0 PET$ P5@05, 00 00@00R" 00H0000xp$ P5@05, 0d0H0\0 0T0 0 0R!040 xp@2z2P9z8H6azt5E-M40PS@`p08 ; 00$r0p3p#Z-*0 `xp"J 0  PxpU 0JQ*%R4 8p0ЍEЍE,EЍG 4SR/$40C0A4/A-@pq`់PP @ k`PE@ЍbYP VL L3@0P@HP E +}< Y  04 8 /E-M80`S4 c PpU?@E~PEPSY:T032:@Ѝ 0T4 j 0P/S /o " R0 2c/o "S  1010S@@@  S:0 0@0 0<0A0000xp@ Qq 0G@M-(MHp@W0  0$0K0 0 0xpW3(Ѝ f PU+0P @`Up0 00G00G0L EL  R 05C20: 0R B R0AP@Q QO_oP%0 00U ZG0T0S::@`  $ 0R<o \ʌ >"   Z&0T GR:@` 0 0$S05@"@C0AF0`2@G200@BAL`@0@CAL`@Q  [/t \0K@kiML 04 8 /0p@- ! $` P@b@5  p/00@- P!@ Nb  4. 0@-0 S@  P:@00@ P S@@@\! @@1C0@@M-P08M⃠ 0 0E e3E1>\`0 0V001 0!R0 S-F U   Eq X `DB HpS R3S0 43010W00 wX0 0 R+00 p0 T  P ]8Ѝ r ! pG  R0r  PtS P  ̠ p$#̠(qpS, \ 0 p $ ( , 00W:\ QS 0RX0X?o0#0Es0d0BB+p@-@P 0(0!c^Tj$A AD@QR\sF\PP@@ #VPppp @U P+*\8\^I @T& @P@FT`:@NpT<:p@DpHpL$xp'tp@p\TD@@ W PJ Z  AA+PAAPL,A|, A PpTp AAM-0Pp0kPЍ 0 4?s0% S* @ @P00@0T : @ % S@:@000 P0oPEP 0 @4 T8 T<3 JR*[:S  @PK  0 `)P 0S @-@0⒥P0 0S 00 0Ѝ@-@P 0$0Px 0/DAQ@-A@/0@-$ `P  o4M-PM@p  CᤤP@`#0  0`R/X  RR  P  `Pp Ѝ~A-Pp ᥥh`@TЍ0 Ҥ0/S000SS  a PV`O@p@-@PpPx 0p@դ|̉0@-@0M P 0 0013 P Ѝ013?1 R @-0⸤P ЍM- 08`室@PPЍP pppT:40S8X' 400E?o2Z0S  ʥPPZ 0 嚮p 1W:40UX VP0P#T 03?0AP@- 0SЍ  Br/03E-pB00`EP  0!0q1P:40S mV@  Ѝ@A-@`p?PPЍBP00 0,0 P(0@-MP@`p1P,0 0(00p0ЍM-(Pp@P) ` @0ݣP@ 01Q@R =mPk@@PPЍ /@ @-<l xC$P 0 lx l"Pl@꨸!-RQ/M-@` A, @@R H P 03/P0 [EPET  W DR@ЍPꫪ 0  Pp@-@  P @P opf PpP 0 4 p2M-`pPM U@ @Pdߍ[   !0PP!0P @jA-`pP@TQ k 0P`1@p@-`@PKI 0 00 000p-P 0 /p@-PQ 0S@ 0p 0p@`*TQ `Q 00@*P 0 pA-@PPp  H0 `0SP U00M-@`P* p@0S \0 0 0  0S   P0 000@M- M  pH@ 0XP ;*Q`!`30 0S @0S0ZP 0K ss8 V A*P000U0 00CPPEU 0 0 0sG[ P@0W0C?o20S/ Z  L0:/P 0 L00 0 !P 0"0D0 Ѝ00R 000S 0D 000V:Q P5@ 0W0R0S% 0S  L0Ꝧ_v7@-P RRRRR0^0C?o2 2Z@W00S0SJHGo Ѝ0E-p M\@` P   0 000 u Ѝ0  PiPU00\0SR l@-0@ P R P @@ p r RQ @B/ᓀ  @0S0/@ Q/0S0/ 0\ 0C R /R/- 0^A \S  0 S00\0S / P0/-P^\S0q R0/R/0 0QB/A-@R `pPTPD 0@0p@-P@t@0 SRpUp R0  \C/p@-PP w@P@pe0 R/^^ R A-p@-PU @0P  0pP@-@0SI Q sb0A S/ P/0A-@pw`P sPU@H@ PPE qP/0\/ R/0 0@sh Rh@-/0<# 0" Ѝ @-h R Ѝn hP 003 Ѝ /@-@@@-?!!@-@D0D#30 00#3Ύ 0# !4ׂCp@-`@P@P 0P:pp@-@ `yTP1P!@Tp耖P/0 -ddQ S0#$R0#R>2 -0A?o2 0D00꓀!/M-P@`P6 V p2 0W   N E < :01   0Ѝ %   M- M Pp @t0 d \0T`P`-0 .:5P@@U Ѝyy}B@-M@P, p,`P&`V0 ?S09?00?000Ѝ0@-P@M   Ѝ0 06#8##/b0/b @-rr0 @-r-@- 0@-QRQD0!6!Ơ! 5a0Q001c00000 03a 1001cQ00000M-p PAa Q`*M`4`0# 8!bRR`""f &"e&b0  L!  e&b0  L `#bf! b0`00 L`L  L#GGŧM-`M† Z`P& `p@ 2 S) r0Qp Z-p@D/ -p@D Zj J ` @`r 2 .3.30+p@Dp p@DQ: Z@D @D0000Q@D> W Up5P0S U003050ZPX0PX00E 0S  0 0 R$Z?@DP@D 00# Z Z-p@D % @S50 RZ?@DP@D 0 S50S50 BQ@0 0S ZQ 0  RZT`ЍR 7 B5S50ꖾA-R `(@ ,0P 0pS 3 5W T'ЍV… 0C  S U00E@0  n0P0?S0%*0S 3 5pV 0@D00xRA-``Pp@w0 0 CP PP  LPTDS50 APP0D 0c0@DP@0 S 40 C5R5 M-P0!0!#XM`  0%0S  R V050Z030J50F%S V05p@"-R 0R1 0 B Rp$0 0B P) .R 06 0A P0 ࠓ(*Q0+ 0'@ 0+R R #R *R p@@@@@ 0'"0pBp0Wpg@#00C 0@ \?hP LQZQ zQ tQ xRbR%R( XR* V%03050pS; Z0ƅpDlQlPLc BRňňdňňpˆ@ˆňň 0  S50 BRW0G Wppg`p V0405 0` FRWpGpp`2 S50lQ 0p  UQ IQf MQ? DQ wp @!@ iQZ mQ@@3 aQ p a@00 00 @pR 0cp0mPP 0 0 0@Tp{ ww0 0P :P@$Ÿ0P R P R P@@00 k@@@@4Q0P, $00 , @$0EQ[ P.A lR BR  LR  Q 0$0-$0sR $0$0 P0 @00#0 pXЍ 0 Fp P( V 5n @ ER@@ LQPP 00 @  Pp H lQ ZQ hQ Q tQ    Q| | ꓀"@-@ P8TD -@- 00 ЍЍ/0 -@-   Ѝ Ѝ/@-AMM 0@P nAލЍ-@- ЍЍ/0A-@p@-X`XPX 0L@0#  <00S0k00 p@$>> >0Dt0P/@-\ 00@SD@001S00bk0 0 0 $>t>M-RPM ЍM~0 @4 S0 4SXpW0S  `  0R0 4 S  S) Ѝ( 00000 P@ 0  0  pP ЍM[p0S  00Z`P  90P\P L@;/ 50000>>$  0P/$A-Pc9}5S @R  @ 6 2 A( A$  @S 23/0B80B40 @d PG  L PB^000p00(0pp `PA P; a000p0 @y PԀp<00` C7   0           0B?P0]0000@40@j@=]3A-@`T(QQPQ3 30As RP,S\ۈlۈڈ|ۈڈڈڈڈڈڈڈڈڈڈڈڈۈQۈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈ0ۈ P@  Up 0 p 00?Up@0 ?p㄀ | p0  d\0XPp Pa>>>|W<0(,d:e: s@-`@ \0R0PP0_0 lY0 l,Ѝp@QЍpcSc(M-M8XPPCSPDQPU0@S0S0S 0  0I$30#SЍ PZ 0 72 R0 R 5R@0SP #0S   |2|p20 l@XP P20S+<40S (WF  002  >lЍMR 0 0ЍMh PP 0S apW W WA\T>@%8+X0@000 0`P!"#/$ R$% 4 P0 8 '    0 BPD0C P;cSc>>>(d:e:H>Խ>4,ECMb,(0@- 0 00 M-@ @z P 22P@%+0!@0P`Y! "#/$ R$% ( P# , P 0 P 4 P0e:,܈@-L0D00S8g@,0,}P}#$@L8ו,F@-(⊍P Ѝp@-@]P0<003/ Ppp@-@ ݍ PP $p0Spp@ @-@PD00<00SH}P(0 0 0 0 0 0 0<003/P&p@@  u @-@;P000` PLiP  LcP0<00SHq 0 0 0 0 0 0Hq H< 00 0 0 0 00&  0 0 0 0 0  P 2 . + k Ѝ3/ 0 0 0 0 0  H(( #\ " 9 X s@-`Pf (ȍ@P qU 03.Ѝp ^@-0@S@(ㅎꍎ0Sp@-@P PU  (9,`P (㎎PP@p@-@P@@D0ֈ 0P@-@0S0@-`0 PpP Pp(.P0@ @ Ѝ~U*P p᠈P ,@0,@D, 0R=P 0SH0W @-Pچ@-0P D0 00@-v0PD000@-kP hHA- @ P 0T0P0S `P @M`P@P@|pU D0 0<003/@Pᾇ000@0@ +VP} FCp@- PPp@Pp0Sp0<003/0000p0P D00 @-鐇@o/p@-P`@P P 0 <0p@0/pps@-PP@ P@ `0<0 03/@P0<0 0S `V t Ѝp0<0 0S  3/T@A-Z(I@TЍY`P- PP* `@p尀0D0 T k0 HfV 0Sh_0D0@/0STP ePC c @-؅00@-P 8 &PIFp@-`HMP@P P0<000 JP$   HЍpw p@-PÆ@RD0,008 0 00 4 0 (Pp@RD@-@LP8P $ P@&‰@-A}0@0,@D, 0RЍ,@-<^ /%(-<^ /%(0<00S //p@-PZ@QQp(A-P`pI@ḆP0 A(0@-@LMP PLP 0 P 0$P0L|P Ѝ0D P 喐 AP0 @-@ ( M0Q  - M Ѝc l @-@ ( M0Q   S Ѝc l 2Q@-(0 P$  PЍ @-KP HGk@-x@pP:PT LPT@AP} F@-@`PPTD@ 0S  0 P p>Fp@-@pP@0h`S 0S T@P <P P p@} 0 0 0 0 / 0 /t>/ @-龖0/> @-鲖0/> @-首0/> @-隖0/>@-P  ?>@-T@0S H0H ?00@ ; 0400@b[ p@- @PQ 0S@ m@0 pP P P r000"0o 0@ R \0 d00S <0 P0P 'D0@0 <0< SDt>FF\Dl>p>h>P 00 0/0/P 00 0/0/@-@P<0@$0$ ?0C#30Mb@-P00 3 Q3/30S /@- t3P0MS`3p0S?s 04?s0S0@4?s0 B\\$ S' S"Ѝ@ S@ BRPP 0\4?\s0@ B `PPQ P ЍR`0dov`VV0 @R0S᱕P  1 0SS00   0 p4?S0S 0S(0S0ShЍ@ H1PU 0 $0 4?s004?@s0/0@0r 5/S0qQ`FV:0 $0P4A/?s0r g 04  ?$/r  B < @ s0q4/l>>x>bb>6D00?P ?PP//bp@-0P@?T`OOt@ R dN?T@/Tr0R$ 0 p~ O@TD @0 pb>p@-P @0 `, 04S/r0R$0 pqQ 0ą ą0ĕ ĕp>@- E @ ?0S400 00 ?0S40@0000    ᘔ P Ѝ|>@- @` p0  t@ X 0P s0@?/O0 S4R$@TD0 @ Ѝ>M-耟pW0  Ar PPP`+`M, @R(0 0 0t \(0@P@P0`L0PH0D0@<0 ЍEC0D$@-  ЍQ 0"S B BQR0"SS00/0:@- Pe:P@- PT$$T$, 0@S00  B !  00S 00S  P6p P do\00SPD0`84*`Cy>C>nCCC@-*P tP P\ @;DP @0 P ,5 0 @ꍾ C Ct>'CP 2M- 0 㘢嘲00R2b @0 S @pPЍ00cP P p002TD,\dlqe4P1 `0P" @1p@%|@_t1t! h1  X1 @1 < 0R @ P0 02/0S`0S S S0p R R0N TT p@60?p0h>t> `:$D>Dȉ8 A-|`P@:PNpP ၒV P ,P  0@0De:@- "<0R80R4 r  Ѝv+0P 000C S@-pp/p/ @-0/b @-0/b@-M@ x 0 3?R:{ 0 0H0T 0T00 3?0ݍ0 3?4GFF 0R  P`/S@- 02/R3?0CSQ4@ 0^,^00 /bdO@-M  dT 0 3?R@3 :{@ @P 0  Pݍ4G8GG@-M  D\ 0 3?R:{ 00@(0  @ݍ4G8GG0@-MM P 0 3?R@3:{@ݍЍ0 z@PH00S 7U , 02/@R@ #  4GbFF@-MM P 0 3?R6:7 0 0 0. QR000!1D4O0S0p0|P/S p` 00  ݍЍ 0{4GbFy։@-@0@0S80 S/Rp@-M-` @!0 3?R@3:{@0S Aݍp 0R+S0S(PP(#~]00S`@d4O 0-S000!D14O 0S 0 P[h0 UPS@4O@d@Q4a]Q4Gbb8 `:Dp@-A-M `!403000/@0 00000 0$ P P   * ?(p UPP00C  C1sڍ襆p@-M P403000 00000 0l00S \$D@@D DD1Rڍp4`(@ 2?$000@bFFE-MM P4@030 @0@S@@@ @01 $dDHpL@P00C \C1ڍЍH(` 2?,$0O00 @p0 @bFFM-MM403@!P @R 0 $0p` $#ZL T   :0 ฏH  W` `00CC1ڍЍ"t, ( ZP T   :0 ഏL  W``00C C1bGp00s/d00S/0-MM0 00000 0 0ڍЍF8G-01DM00CS-H  <0 0Q 0$00 0$ $!0 0 0Q000 0 $ $!0 tPDЍh0DЍDЍL0DЍ;<080DЍDЍFbFF0Gbp@-0 Qp " RpB00CSy@t4 |p0p0> |pp0|ppp px10S0|ppp0PA LD[H100p|ppp(9[0p10S 00S00 00 +0 p@G|ppp PV0`Q0`0@Z|pPp}oU\ 0000S0U (0 pFFpDbt>DFDb0GDFF@-D@00S00Z@$Z}0 <@FEE A-1Q 10A+0Plq  d"<0R80R4r @4a00@ 0S 0 R 00# @ Q  0} 00 /x0  ЍAFF>>F>DDFE%E>>dE\:EEO8 ElF>FF@- 0 t>@-[Pw@ 0 +p@ @p`0 P 0P?0S40PPPPⰍT0``H0Pp#40 Ѝ@r@GM-0@S S Ѝ ܿ0 0R 0 Ȱ0S +Pp  P PPP`   Ἷf PH PPP]P@P` ᧿ЍM>@-0 0SQ tl \0 HDQ@#YQ@YHGGGbHD@-@P xYt0?\ XtYT00S80D 0@0<0<0} 00 ЍHD`:]DGHGOGQt>@-D@M l BP 0 0 ލ8 GGE-2b0p CPR񟗔S00@40(S@ 2"0@2"#+@p1@p0 0@S 10S p@D@1!0 xWT l1  Ѝ;0X1@ 0?0D10S 81`0102#(!   BR1!! @ Aா< V  ÷00 <0<0@<0<0@<0;0{@@GHG24 cMb[b8bFH HH>t>HGbG`:|GWfyM-h$ P RXt@Q H$ APRU `E/r  BR" $P!30S30S M#@P3Ot@P0s00UM PDd H#L⌃0@0Vx3 t3 T30S 0S0<#0000E4 P #p00# R*M00 P 2p08"Q <00 P2PV\b prX p^`B0\$"0 00"0r Q ?R0000004001q 1PE 1!!0 @ 10 # 3 0 R S: ጽ\1 X0U*Z?AQ0R WWM~R WW 0 @0 R8l 0 00 /r 0?s00CSHG HGGHGMbGGebbm4 cGGGl%bbGG`:t> !@-\ 000P SDDk@(82W404,00S@HbEcl%GPQ/@-  N@ #M-鼣C0pS000P P p3l PdS Q*D"?08P0c Q00弅 R 0ᰀ02࢟B0  0PIJ "<0R80R4r   |xWtX2H"hd0S X2 R 00# 8 0BV(Q " uVW  1 D1A 1 rV 1 0!0!0!0!0w1 1 E @1 x1@c d1\1@T1T P1 @,@1 ЍMP v 1 1VЍM-V1^'V 0 DGbbcb:>HHG>DGDEi>>dE\:EOG|x`:GGGGGHbl%p % HHHHG>Gbt>GE Q/b:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/Q ; aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P-PA/P-PA/-b@-W @RP6 . @P`pSS1R*2">"R$^BSS1R*0? P_@QP:P`p Pd@ 0b 0 0@P`  8`"(`"$`""`"!` pf01 0 0@-ɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[h荆D<膆`rrrrrrrrrrrrrrssss%s,s3s:sAsHsOsVs]sdsksss{ss ttt|̉؊؊ L6MߺR1=C.)D????????mp}pppvyy(yQxtwGk{GkGkGkGkGkGkGkGkGkGkGkGkGkxGkGkGkGkGkGkGky}O} ׊׊1׊A׊K׊W׊a׊׊@ ɊRɊRɊKSyby  (0@ @  (0@ @     0 @            (@@   0              ( 0@    !"#%')+/3;CSc @  !"#%')+/3;CSc @    "%)/;S      !#'+3Cc 0      @     =}??? =}???= } ?} ?  = TAyONNNNlNLDKJxKP$KVJ\JbdJh@JnItIztI,IHHHHlHHH0H HGGdGGFFPFEEE`E$ED|D @DDChC" C(B.B4TB:B@A+E_gv,X` %K @B`%&/ =XOU@ɂȂDȂl]L[^[Z$_Y}؊׊(", *$.)#-!+%/ y։}@@T![NYd9ir;zzT|0||{{{\{({5<̬t@).'F%6L% nW ?m9ir;nW ?m9ir;aʓ +8AtޑnW ?m9ir; >2RHUNJNy}C7/r1CM &qLFܻՇ stp9DKP/;U'&LHt7&x/iHB.׫VjbZHڣyk!A ,irﲡF'm2A`Bti#L˘wP2*˲:=Egeo@>@mJl$m0VL?ir;1?ir;~b3>O -;6P4ubwF%wt8i9ir;wt8i9ir;QǤ#>LIdcIĞ̟48t<\ $'hUh=OtUR1h2%-'?M(-'?Mf~*@.!Ê"[NYd9ir;(s*K>;Gہ5'?Ms愣J(bx T֊8/H8(H@ @ }}'@B -=Pass#1@Oaq;D-HՊ@x}uu@x}e ڊG؊R؊B~1ي7ي>يGkEي  @ @    @i`ii~(`()h<D\<L&T+TTTl"#px4X "- T"TdXtt4 t t t}t Uu t u uu#u*u6uIuSu\ugu-t3t8tGk;HS@TT`SDRR9!fx)E܊ӽ31KL׊'~&׊׊Z׊׊O)|6|<|ϽB|L|F|P|U| Z|_|d|o|z|||||||||||| #Ɋ| || ||||}} }}}},}4}<}B}||N}J}U}\}c}i}OOuuuuuvuvu(vu7vuFvOOOy{{{}{{lj{{{(ȉ{vȉy{u{{t̉|rȉ| |~|OOuuuuJuOO Vv_v>qv{ |vvvvtvvv vv ww&3w=w%Rw]wOswww wwwwwwwwx#$x4xQx\x oxxxxxxxxxxxy y y%y2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@ !1Aa  0@`@@A@!  @a`10  @BootNextBootOrderPlatformLangCodesPlatformLangOsIndicationsSupportedSecureBootSetupModeAuditModeDeployedModeVendorKeys #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      PKKEKdbdbxdbtdbr<NULL>BootCurrentBestBetterGoodDegradedu-boot*EHCI Host ControllerU-Boot*XHCI Host Controller  * *  +,;=[]    s愣J(bfdt_get_dma_range__of_translate_addressfdt_fixup_memory_banksv7_outer_cache_inval_rangedo_bootvx_fdtdo_gptusb_setup_descriptordev_get_parent_privdevice_removepca953x_read_singlesdhci_setup_cfg__put_mtd_deviceallocate_partitionmvneta_txq_initphy_device_createata_scsiop_inquiry_ehci_create_int_queuexhci_get_endpoint_intervalxhci_setup_addressable_virt_devreset_epbtrfs_decompressbtrfs_next_sibling_tree_blockfree_extent_buffer_finalbtrfs_lookup_pathbtrfs_read_fs_root__btrfs_map_blockbtrfs_find_last_rootfs_devreadefi_free_poolefi_runtime_relocatezstd_decompressdev_get_uclass_privpca953x_write_singlesdhci_transfer_dataadd_mtd_devicemvneta_setup_txqsxhci_address_devicexhci_get_input_control_ctxxhci_ctrl_txleaf_space_usedfree_extent_buffer_internalefi_free_pagesdev_get_privsdhci_send_commandmvneta_rxq_initahci_port_start_xhci_alloc_devicexhci_scratchpad_allocrecord_transfer_resultbtrfs_leaf_free_spacedev_get_uclass_platmvneta_setup_rxqsxhci_update_hub_devicexhci_alloc_container_ctxabort_tdbtrfs_search_slotdev_get_parent_platsdhci_resetxhci_configure_endpointsxhci_mallocxhci_bulk_txfdt_find_or_add_subnodedev_get_platsdhci_initxhci_segment_allocxhci_wait_for_eventdevice_probesdhci_set_clockxhci_ring_allocxhci_queue_commandbtrfs_free_extent_statexhci_ring_freexhci_inval_cachexhci_flush_cache%s: Bad cell count for %s drivers/mtd/mtdcore.cBUG at %s:%d/%s()! BUG!(((((AAAAAABBBBBB## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue #gpio-cells%s: unlock failed, writes may not work aes.192aes.256ahci_scsiInvalid port number %d timeout exit! 1.564bit ncq ilck stag pm clo nz only pmp fbss pio slum part ccc ems sxs apst nvmp boh SATA link %d timeout. Target spinup took %d ms. AHCI %02x%02x.%02x%02x %u slots %u ports %s Gbps 0x%x impl %s mode flags: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s controller reset failed (0x%x) scsi_ahci: SCSI READ CAPACITY10 command failure. No ATA info! Please run SCSI command INQUIRY first! scsi_ahci: SCSI READ CAPACITY16 command failure. No ATA info! Please run SCSI command INQUIRY first! Unsupport SCSI command 0x%02x No Link on this port! %s: No mem for table! Can not start port %d alloc space exhausted memory allocation error while creating partitions for "%s" mtd: partition "%s" is out of reach -- disabled mtd: partition "%s" extends beyond the end of device "%s" -- size truncated to %#llx drivers/mtd/mtdpart.cWARNING at %s:%d/%s()! mtd: partition "%s" doesn't start on an erase block boundary -- force read-only mtd: partition "%s" doesn't end on an erase block -- force read-only DRAM: arch_numberTLB addrirq_spsp start Early malloc usage: %lx / %x rtc-soc%s: io address missing Warning: Changing mpp%u function from %s to gpio... marvell,bad length %d < %d ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again %s: No memory for ataid[port] ATA scsi_ahci: Error: buffer too small. Hit any key to stop autoboot: %2d  0%2d *?[\Resetting CPU ... %-12s= 0x%0*lx %-12s= 0x%.*llx Unknown operator '%s' ERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s ** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") (none) IDE device %d: Device %d: unknown device changed to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u (%d MHz, %d-bit, 2T, 3T, ECCECC not enabled)initcall sequence %p failed at call %p (err=%d) EEPROM regdomain read failed. Regdomain set to %s regdomainbootcmd_rescueomnia_mcu_read failed: %i, reset status unknown! omnia_resetboot_targetsRESET button was pressed, overwriting boot_targets! MVEBU XHCI INIT controller @ 0x%llx ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryno-map## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeconfig with overlays but CONFIG_OF_LIBFDT_OVERLAY not set loadablesThe given image format is not supported (corrupt?) ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... (fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!FDT and ATAGS support not compiled in /memory## WARNING: fixup memory failed! initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... image is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failedkernel-offsetkernaddrrootdisk-offsetrootaddr%s.%sdhcppart_%xwhole.bootdev%.*s.blkHunting with: %s Unknown uclass '%s' in label No bootdevs for '%s' Missing bootstd device %.*s.%s** Booting bootflow '%s' with %s Boot failed (err=%d) Ramdisk image is corrupt or invalid ERROR: RD image overlaps OS image (OS=0x%lx..0x%lx) Could not find a valid device tree ERROR: FDT image overlaps OS image (OS=0x%lx..0x%lx) Loadable(s) is corrupt or invalid Automatic boot of image at addr 0x%08lX ... vbe,Unknown request: %sFailed to process VBE request %s (err=%d) vbe,errorvbe,errnumvbe,requiredCannot handle required request: %s fwupdarea-startarea-sizeversion-offsetversion-sizestate-offsetstate-sizeskip-offsetbootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] parent transid verify failed on %llu wanted %llu found %llu Ignoring transid failure BTRFS: invalid chunk item size, have %u expect [%zu, %zu) BTRFS: invalid num_stripes, have %u expect non-zero BTRFS: invalid chunk item size, have %u expect %lu BTRFS: invalid chunk logical %llu BTRFS: invalid chunk sectorsize %llu BTRFS: invalid chunk length %llu BTRFS: invalid chunk stripe length: %llu BTRFS: invalid chunk type %llu BTRFS: unrecognized chunk type: %llu BTRFS: missing chunk type flag: %llu BTRFS: conflicting chunk type detected: %llu BTRFS: invalid num_stripes: %u BTRFS: Invalid num_stripes:sub_stripes %u:%u for profile %llu couldn't open because of unsupported option features (%llx). invalid number of items %llu leaf is not a leaf %llu leaf free space incorrect %llu %d leaf parent key incorrect %llu bad key ordering %d %d incorrect offsets %u %u bad item end %u wanted %u slot end outside of leaf %llu > %llu Unknown csum type %d 1.2.3%s: Unsupported compression in extent: %i fs/btrfs/root-tree.cleaf free space ret %d, leaf data size %u, used %d nritems %d ID %llu gen %llu path %.*s BTRFS: failed to list subvolume: %d BTRFS: %s: Name too long at "%.*s" BTRFS: %s: Too much symlinks! Cannot lookup path %s BTRFS: Not a directory: %s BTRFS: An error occurred while listing directory %s invalid dir item size No mapping for %llu-%llu Invalid mapping for %llu-%llu, got %llu-%llu no device found for devid %llu, skip it BTRFS: Cannot lookup file %s BTRFS: Not a regular file: %s BTRFS: Failed to get inode size: %s BTRFS: An error occurred while reading file %s BTRFS: Seed device is not yet supported BTRFS: unsupported checksum algorithm %u BTRFS: superblock checksum mismatch BTRFS: tree_root level too big: %d >= %d BTRFS: chunk_root level too big: %d >= %d BTRFS: log_root level too big: %d >= %d BTRFS: tree_root block unaligned: %llu BTRFS: chunk_root block unaligned: %llu BTRFS: log_root block unaligned: %llu BTRFS: nodesize too small: %u < 4096 BTRFS: nodesize unaligned: %u BTRFS: sectorsize too small: %u < 4096 BTRFS: sectorsize unaligned: %u BTRFS: invalid total_bytes 0 BTRFS: invalid bytes_used %llu BTRFS: invalid stripesize %u BTRFS: dev_item UUID does not match fsid: %s != %s BTRFS: suspicious number of devices: %llu BTRFS: number of devices is 0 BTRFS: system chunk array too big %u > %u BTRFS: system chunk array too small %u < %zu BTRFS: superblock checksum matches but it has invalid members fs/btrfs/disk-io.cERROR: nodesize %u too small to read superblock ERROR: invalid number of stripes %u in sys_array at offset %u ERROR: unexpected item type %u in sys_array at offset %u ERROR: sys_array too short to read %u bytes at offset %u BTRFS: Extent for symlink %llu must be INLINE type! BTRFS: Extent for symlink %llu must not be compressed! BTRFS: Symlink %llu extent data too large (%llu)! BTRFS: adding devid %llu gen %llu but found an existing device gen %llu csumBTRFS: could not setup %s tree Couldn't read tree root Cannot lookup ino %llu Ino %llu does not exist fs/btrfs/volumes.cDevice "%s" not supported by U-Boot image Device "%s" is inactive @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?CACHE: Misaligned operation at range [%08lx, %08lx] No device set, use 'wdt dev' first %s: %s: error: gpio %s%d not reserved bootsecure%*s ## Error: Secure boot command not specified ## Error: "%s" returned (code %d) clock-divclock-multclock-frequency#clock-cellsclock-namesassigned-clock-parentsassigned-clocksassigned-clock-ratesxtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d %s - %s Usage: %s - No additional help available. Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** Fit image detected... ** Unknown image type ** Bad FIT image format No closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\y Y yes YES checksum verify failed on %llu found %08X wanted %08X cyclic function %s took too long: %lldus vs %dus max SunMonTueWedThuFriSatbootcmd=run distro_bootcmdbootdelay=3baudrate=115200ethprime=eth2loadaddr=0x800000arch=armcpu=armv7board=turris_omniaboard_name=turris_omniavendor=CZ.NICsoc=mvebumtdids=mtdparts=fdt_high=0x10000000initrd_high=0x10000000kernel_addr_r=0x1000000fdt_addr_r=0x2000000ramdisk_addr_r=0x2200000scriptaddr=0x1800000pxefile_addr_r=0x1900000fdtfile=armada-385-turris-omnia.dtbconsole=ttyS0,115200bootcmd_rescue=i2c dev 2; i2c mw 0x2a.1 0x3 0x1c 1; i2c mw 0x2a.1 0x4 0x1c 1; mw.l 0x01000000 0x00ff000c; i2c write 0x01000000 0x2a.1 0x5 4 -s; setenv bootargs "earlyprintk console=ttyS0,115200 omniarescue=$omnia_reset rescue_mode=$omnia_reset"; sf probe; sf read 0x1000000 0x100000 0x700000; lzmadec 0x1000000 0x1700000; if gpio input gpio@71_4; then bootm 0x1700000#sfp; else bootm 0x1700000; fi; bootz 0x1000000mmc_boot=if mmc dev ${devnum}; then devtype=mmc; run scan_dev_for_boot_part; fiboot_pci_enum=pci enumboot_net_usb_start=usb startusb_boot=usb start; if usb dev ${devnum}; then devtype=usb; run scan_dev_for_boot_part; fisata_boot=if sata dev ${devnum}; then devtype=sata; run scan_dev_for_boot_part; fiscsi_init=if ${scsi_need_init}; then scsi_need_init=false; scsi scan; fiscsi_boot=run boot_pci_enum; run scsi_init; if scsi dev ${devnum}; then devtype=scsi; run scan_dev_for_boot_part; finvme_init=if ${nvme_need_init}; then setenv nvme_need_init false; nvme scan; finvme_boot=run boot_pci_enum; run nvme_init; if nvme dev ${devnum}; then devtype=nvme; run scan_dev_for_boot_part; fiboot_efi_bootmgr=if fdt addr -q ${fdt_addr_r}; then bootefi bootmgr ${fdt_addr_r};else bootefi bootmgr;fiboot_efi_binary=load ${devtype} ${devnum}:${distro_bootpart} ${kernel_addr_r} efi/boot/bootarm.efi; if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r};else bootefi ${kernel_addr_r} ${fdtcontroladdr};fiload_efi_dtb=load ${devtype} ${devnum}:${distro_bootpart} ${fdt_addr_r} ${prefix}${efi_fdtfile}efi_dtb_prefixes=/ /dtb/ /dtb/current/scan_dev_for_efi=setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; for prefix in ${efi_dtb_prefixes}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${efi_fdtfile}; then run load_efi_dtb; fi;done;run boot_efi_bootmgr;if test -e ${devtype} ${devnum}:${distro_bootpart} efi/boot/bootarm.efi; then echo Found EFI removable media binary efi/boot/bootarm.efi; run boot_efi_binary; echo EFI LOAD FAILED: continuing...; fi; setenv efi_fdtfileboot_prefixes=/ /boot/boot_scripts=boot.scr.uimg boot.scrboot_script_dhcp=boot.scr.uimgboot_targets=mmc0 nvme0 scsi0 usb0 pxe dhcp boot_syslinux_conf=extlinux/extlinux.confboot_extlinux=sysboot ${devtype} ${devnum}:${distro_bootpart} any ${scriptaddr} ${prefix}${boot_syslinux_conf}scan_dev_for_extlinux=if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${boot_syslinux_conf}; then echo Found ${prefix}${boot_syslinux_conf}; run boot_extlinux; echo EXTLINUX FAILED: continuing...; fiboot_a_script=load ${devtype} ${devnum}:${distro_bootpart} ${scriptaddr} ${prefix}${script}; source ${scriptaddr}scan_dev_for_scripts=for script in ${boot_scripts}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${script}; then echo Found U-Boot script ${prefix}${script}; run boot_a_script; echo SCRIPT FAILED: continuing...; fi; donescan_dev_for_boot=echo Scanning ${devtype} ${devnum}:${distro_bootpart}...; for prefix in ${boot_prefixes}; do run scan_dev_for_extlinux; run scan_dev_for_scripts; done;run scan_dev_for_efi;scan_dev_for_boot_part=part list ${devtype} ${devnum} -bootable devplist; env exists devplist || setenv devplist 1; for distro_bootpart in ${devplist}; do if fstype ${devtype} ${devnum}:${distro_bootpart} bootfstype; then part uuid ${devtype} ${devnum}:${distro_bootpart} distro_bootpart_uuid ; run scan_dev_for_boot; fi; done; setenv devplistbootcmd_mmc0=devnum=0; run mmc_bootbootcmd_nvme0=devnum=0; run nvme_bootbootcmd_scsi0=devnum=0; run scsi_bootbootcmd_usb0=devnum=0; run usb_bootbootcmd_pxe=run boot_net_usb_start; run boot_pci_enum; dhcp; if pxe get; then pxe boot; fibootcmd_dhcp=devtype=dhcp; run boot_net_usb_start; run boot_pci_enum; if dhcp ${scriptaddr} ${boot_script_dhcp}; then source ${scriptaddr}; fi;setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; setenv efi_old_vci ${bootp_vci};setenv efi_old_arch ${bootp_arch};setenv bootp_vci PXEClient:Arch:00010:UNDI:003000;setenv bootp_arch 0xa;if dhcp ${kernel_addr_r}; then tftpboot ${fdt_addr_r} dtb/${efi_fdtfile};if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r}; else bootefi ${kernel_addr_r} ${fdtcontroladdr};fi;fi;setenv bootp_vci ${efi_old_vci};setenv bootp_arch ${efi_old_arch};setenv efi_fdtfile;setenv efi_old_arch;setenv efi_old_vci;distro_bootcmd=scsi_need_init=; setenv nvme_need_init; for target in ${boot_targets}; do run bootcmd_${target}; doneRemoving MTD device #%d (%s) with use count %d Error when deleting partition "%s" (%d) %s: null device (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available reg-namesunbind() method failed on dev '%s' on error path Failed to unbind dev '%s' on error path device '%s' failed to unbind %s: Device '%s' failed to remove on error path %s: Device '%s' failed child_post_remove()%s: Device '%s' failed to remove, but children are gone U-Boot.armv7Invalid pxeuuid: %s DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d autoload0123456789ABCDEFError: VHV gpio disable failed Disabling MCU watchdog... omnia_mcu_write failed: %i marvell,armada-370-pciemarvell,pcie-portCannot disable PCIe port %d DT node! Cannot find PCIe port %d DT node! EHCI failed: timeout when disabling periodic list error: overflow occurs , Build: %s%x:%xbootefi %lx %lx%s/%sboardver%s/%s%s%s%s.dtbefi/boot/bootarm.efiPXEClient:Arch:%05x:UNDI:003000bootp_vcibootp_archbootfileNetCore: %d devices, %d uclasses, devicetree: %sWarning: Device tree includes old 'u-boot,dm-' tags: please fix by 2023.07! Driver Compatible %-20.20s%-20.20s %s Driver uid uclass Devices %-25.25s %-3.3d %-20.20s %-51.51s%-25.25s Driver Address %-25.25s %p Class Index Probed Driver Name ----------------------------------------------------------- (out of memory) uclass %d: %s %-3i %c %s @ %08lx, seq %dset_dir_flagsget_valueset_valueVirtual root driver already exists! device-namepci_hose_bus_to_phys: invalid physical address PCI: Device '%s' on unprobed bus '%s' PCI Autoconfig: %02x.%02x.%02x: Downstream link non-functional PCI Autoconfig: %02x.%02x.%02x: Retrying with speed restricted to 2.5GT/s... PCI Autoconfig: %02x.%02x.%02x: Succeeded! PCI Autoconfig: %02x.%02x.%02x: Failed! PCI: Failed autoconfig bar %x Virtual root driver does not exist! Some drivers failed to bind bootstdbootstd_drvbootmeth_Some drivers were not found tick-timerencboot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit eth%iaddrethaddrcurrent eth = %s %-12s= (not set) %-12s= %pM IP addr = %s fdt_blobnew_fdtfdt_sizedevicetree = %s Error: Cannot initialize UEFI sub-system, r = %lu bootmgrEFI boot manager: Cannot load any image No UEFI binary known at %s ERROR: Failed to set watchdog timer ## Application failed, r = %lu ## %ls Failed to remove loadfile2 for initrd ## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx Flags not supported: enable CONFIG_BOOTSTD_FULL Trying to execute a command out of order ## Failed to initialize UEFI sub-system: r = %lu ## Failed to install device tree: r = %lu ## Transferring control to EFI (at address %08lx) ... NetBSD## Transferring control to NetBSD stage-2 loader (at address %08lx) ... Plan 9confaddr## Transferring control to Plan 9 (at address %08lx) ... QNXRTEMS! FIT images not supported for '%s' - must reset board to recover! ## Transferring control to RTEMS (at address %08lx) ... filesizeverify## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! Can't get image type! Can't get image compression! Can't get image OS! Can't get image ARCH! Can't get image load address! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Can't get entry point property! Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) Using standard DTB !!! WARNING !!! Using legacy DTB VxWorks/chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated Automatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified host:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... u-boot-with-spl.kwbError: Unknown destination "%s" Error: Unknown source "%s" Burning U-Boot image "%s" from "%s" to "%s" Error: Read not supported on device "%s" Error: Failed to read file %s from %s Error: Invalid A38x image (header version 0x%x unknown)! Error: Bad A38x image header checksum. 0x%x != 0x%x Error: Bad A38x image blocksize. Error: Bad A38x image data checksum. 0x%08x != 0x%08x Image checksum...OK! Error: Image header verification failed Error: image meant to be booted from "%s", not "%s"! Error: cannot read OTP secure bits Error: secure boot is enabled in OTP but image does not have secure boot header! Error: boot source is set to "%s" in OTP but image is for "%s"! Error: Image boot mode verification failed Error: Write not supported on device %s Error: unknown boot device in image header: 0x%x List of available devices |-- %s (%s%s) | |-- %s cyclic_demoRegistering of cyclic_demo failed Registered function "%s" to be executed all %dms function: %s, cpu-time: %lld us, frequency: %lld.%02d times/s data abort unknown Cannot find RTC: err=%d Reset RTC... ## Failed to set date after RTC reset ## Bad date format ## Set date failed: err=%d ## Get date failed Date: %4d-%02d-%02d (%sday) Time: %2d:%02d:%02d Data (writethrough) Cache is %s Can't get the pin-controller: %s! Pin-controller device is not set! dev: %s -s-n## Resetting to default environment edit: ## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Warning: Input data exceeds %d bytes - truncated ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed Environment size: %d/%ld bytes ## Error: "%s" not defined usage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** ControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s New length 0x%X < existing length 0x%X, aborting. No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s boaFailed to update board information in FDT: %s fast interrupt request Unable to update property %s:%s, err=%s Supported filesystems-yReading bank %u: Word 0x%.8x: %.8xreadmReading bank %u len %u to 0x%lx cmpComparing bank %u: Value 0x%.8x:0x%.8x passed senseSensing bank %u: progProgramming bank %u word 0x%.8x to 0x%.8x... Warning: Programming fuses is an irreversible operation! This may brick your system. Use this command only if you are sure of what you are doing! Really perform this fuse programming? Fuse programming aborted Overriding bank %u word 0x%.8x with 0x%.8x... -ipv6## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX -aGPIO device %s probe error %i GPIO: '%s' not found cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %u) value is unknown (ret=%d) Warning: no access to GPIO output value Warning: value of pin is still %d %s: %s dev %d NOT available repairRepairing GPT: Writing GPT: No partition list provided Missing disk guid Partition list incomplete No partition list provided - only basic check Verify GPT: setenvgpt_partition_addrgpt_partition_sizegpt_partition_entrygpt_partition_nameenumerateguidsuccess! Current bus is %d Setting bus to %d Failure changing bus number (%d) Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) CRC32 for %08lx ... %08lx ==> %04x: %02xreadingError %s the chip: %d Valid chip addresses: %02XError: Not supported by the driver Invalid bus %d: err=%d OFFInstruction Cache is %s ## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part ## Copying '%s' subimage from FIT image at %08lx ... Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrInvalid data width specifier | %-*.*s| %-*.*s| %s ParentDriverCan't set block device ** No boot file defined ** Failed to load '%s' %llu bytes read in %lu ms (loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... Uncompressed size: %ld = %#lX PHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x Base Address: 0x%08lx byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Zero length ??? Refusing to do empty test Testing %08lx ... %08lx: Iteration: %6d FAILURE (data line): expected %08lx, actual %08lx FAILURE (data line): Is %08lx, should be %08lx FAILURE: Address bit stuck high @ 0x%.8lx: expected 0x%.8lx, actual 0x%.8lx FAILURE: Address bit stuck low or shorted @ 0x%.8lx: expected 0x%.8lx, actual 0x%.8lx FAILURE (read/write) @ 0x%.8lx: expected 0x%.8lx, actual 0x%.8lx) FAILURE (read/write): @ 0x%.8lx: expected 0x%.8lx, actual 0x%.8lx) FAILURE: 0x%08lx != 0x%08lx (delta=0x%08lx -> bit %ld) at offset 0x%08lx Tested %d iteration(s) with %lu errors. FDXHDX100fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %s** Unable to create a directory "%s" ** It is not an eMMC device boot areas protected #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s SD doesn't support partitioning userenhwrrelgpPartition configuration: User Enhanced Start: User Enhanced Size: No enhanced user data area User partition write reliability: %s GP%i Capacity: No GP%i partition GP%i write reliability: %s Partitioning successful, power-cycle to make effective get mmc type error! MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s no mmc device at slot %x OK, force rescanset dsr %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s No MMC device available Only NAND-based devices can have bad blocks MTD device %s bad blocks list: 0x%08llx .dontskipbadOffset not aligned with a block (0x%x) Size not a multiple of a block (0x%x) Erasing 0x%08llx ... 0x%08llx (%d eraseblock(s)) Failed to get bad block at 0x%08llx Skipping bad block at 0x%08llx ReadingWriting [raw] [oob] [dontskipff]ReadWrite.raw.oob.dontskipffOffset not aligned with a page (0x%x) Size not on a page boundary (0x%x), rounding to 0x%llx Could not map/allocate the user buffer %s %lld byte(s) (%d page(s)) at offset 0x%08llx%s%s%s %s %lld byte(s) at offset 0x%08llx Failure while %s at offset 0x%llx Dump %d data bytes from 0x%08llx: Dump %d OOB bytes from page at 0x%08llx: Dump %lld data bytes from 0x%llx: %s on %s failed with error %d unavailableList of MTD devices: * %s - device: %s - parent: %s - driver: %s - path: %s - type: NOR flash Data flash UBI volume MLC NAND flash Unknown - block size: 0x%x bytes - min I/O: 0x%x bytes - OOB size: %u bytes - OOB available: %u bytes - ECC strength: %u bits - ECC step size: %u bytes - bitflip threshold: %u bits No MTD device found activeeth%d : %s %pM %s not used detaSupported partition tables%c %s: 0x%x-bootableUnknown option %s %s%xI/OMEMPrefetchableNo such bus No such device CardBus doesn't support BARs unknown header type ID Base Size Width Type %d %#018llx %#018llx %d %s %s ping failed; host %s is not alive host %s is alive prefetch abort Invalid pxefile address: %s Config file '%s' found Config file not found The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data resetting ... stop%llu bytes written in %lu ms Reset SCSI fmtgsubCould not set var invalid op sha1 ** Abort software interrupt ## Executing script at %08lx Hex conversion error on %c Invalid bitlen %d generic_%d:%dspi_generic_drvError %d during SPI transaction mallocWrittenFailed to initialize SPI flash at %u:%u (error %d) No SPI flash selected. Please run `sf probe' updateERROR: attempting %s past flash size (%#x) ERROR: flash area is locked Updating, %zu%% %lu B/sSPI flash failed in %s step %zu bytes written, %zu bytes skipped in %ld.%lds, speed %ld B/s SF: %zu bytes @ %#x %s: ERROR %d SF: %zu bytes @ %#x Erased: start sector is not a valid number len is not a valid number unlockpin-controller device not selected %s not found -pext2fatInvalid filesystem: %s Error reading config file time: %lu minutes, %lu.%03lu seconds undefined instruction starting USB... resetting USB... stopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. storarm-openwrt-linux-muslgnueabi-gcc (OpenWrt GCC 12.3.0 r23630-842932a63d) 12.3.0 GNU ld (GNU Binutils) 2.40.0 Can't get the watchdog timer: %s No watchdog timer device set! Expiring watchdog timer not supported. Expiring watchdog timer failed (%d) Resetting watchdog timer not supported. Resetting watchdog timer failed (%d) Starting watchdog timer not supported. Starting watchdog timer failed (%d) Stopping watchdog timer not supported. Stopping watchdog timer failed (%d) 'hUh=OtUR1hPartition %d: invalid GUID %s UNKNOWN(%04x,%04x)%2u %2u-%2u = %5u %sout of memoryefiblk#%defi_blkefi_disk addEvent registration for efi_disk add failed efi_disk delEvent registration for efi_disk del failed BootNext must be 16-bit integer Loading from BootNext failed, falling back to BootOrder Deleting BootNext failed BootOrder not defined ERROR: Failed to register WaitForKey event ERROR: Failed to register console event ERROR: Failed to set console timer ERROR: Out of memory MemoryMapped(0x%x,0x%llx,0x%llx)VenHw(%pUlCtrl(0x%0x)Acpi(PNP%04X,%d)Ata(%d,%d,%d)Scsi(%u,%u)Uart(%lld,%d,%c,USB(0x%x,0x%x)MAC(UsbClass(0x%x,0x%x,0x%x,0x%x,0x%x)Sata(0x%x,0x%x,0x%x)NVMe(0x%x,%s%02xUri(%s(%u)HD(%d,MBR,0x%08x,0x%llx,0x%llx)HD(%d,GPT,%pUl,0x%llx,0x%llx)HD(%d,0x%02x,0,0x%llx,0x%llx)CDROM(%u,0x%llx,0x%llx)VenMedia(%pUl%lsDNEOMS[?25%c[%u;%u;%um[%d;%dH%04XCan't remove invalid handle %p Disk %s not ready Adding disk for %s failed (err=%ld/%#lx) Adding partition for %s failed MemhostfsEFI protocol GUID missing for driver '%s' Failed to add EFI driver %s Failed to install ECPT EFI application exitedbad file path! %s: illegal free 0x%llx, 0x%zx %s: illegal free 0x%p en-USEFI: cannot initialize platform language settings ERROR: Secure state transition failed ERROR: need device tree ERROR: invalid $fdt_addr or $fdtcontroladdr ERROR: invalid device tree ERROR: Failed to reserve space for FDT ERROR: out of memory ERROR: failed to process device tree ERROR: failed to install device tree Can't find initrd specified in Boot#### Not a PE-COFF file Invalid number of sections: %d Invalid optional header magic %x Unknown Relocation off %x type %x Machine type 0x%04x is not supported ERROR: Failed to register network event ERROR: Failed to set network timer ERROR: Failure to add protocol UEFI image [0x%p:0x%p] pc=0x%zx '%pD'Reserved memory mapping failed addr %llx size %llx Booting %pD Loading image failed No EFI system partition Cannot read EFI system partition invalid image type: %u 78ERROR: Failure to install protocols for loaded image Cannot create SMBIOS table kaslr-seedError deleting kaslr-seed Cannot free EFI memory pool Failed to load EFI variables Invalid EFI variables file Failed to set EFI variable %ls ubootefi.varFailed to persist EFI variables ERROR: Failed to register watchdog event EFI: Watchdog timeout EHCI fail timeout STS_ASS reset marvell,armada-3700-ehcimarvell,ac5-ehciEHCI fail to reset USB EHCI %x.%02x EHCI failed to shut down host controller. unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error Timeout poll on interrupt endpoint out of buffer pointers (%zu bytes left) RE is too long (code overflow)mcu_56Error: VHV gpio lookup failed Error: VHV gpio request failed Error: VHV gpio enable failed EHCI failed: timeout when enabling periodic list .callbacks${...}.flags## Warning: Unknown environment variable access method '%c' ## Warning: Unknown environment variable type '%c' ## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" arocsdxbimbootm_lowbootm_mapsizebootm_sizeenv_buf [%u bytes] too small for value of "%s" bad CRCCannot import environment: errno = %d import failedLoading Environment from %s... ## Error: cannot export environment not initialized Failed (%d) Saving Environment to %s... not possible *** Warning - %s, using default environment malloc() failedspi_flash_read() failedErasing SPI flash...Writing to SPI flash... %s%daddr%saddr%pM%s.%dethactethrotateethprimeeth%d: %s [PRIME]eth%dmacskipethmacskip Error: eth device name "%s" has a space! eth_bootdev Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s address not set. Error: %s address %pM illegal value Warning: %s failed to set MAC address ** File not found %s ** Failed to iterate over directory %s < ? > %10u %s ** Can not find directory. ** PXEpxefile_addr_rtftpextlinux/extlinux.conf${Error: FAT sector size mismatch (fs=%hu, dev=%lu) Error: FAT cluster size not set Error: FAT cluster size too big (cs=%u, max=%u) %s: already exists . .. Invalid FAT entry Error reading cluster UError: allocating memory Error: cannot remove root %s: doesn't exist Error: directory is not empty: %d %02X%02X-%02X%02Xfdt_chosen: %s WARNING: could not set bootargs %s. 2023.07.02-OpenWrt-r23630-842932a63du-boot,versionWARNING: could not set u-boot,version %s. Can't generate phandle: %s Can't set phandle %u: %s Can't find node with compatible "%s": %s disabledERROR: - must RESET the board to recover. %s: %s: %s /aliasesetherneteth%daddrlocal-mac-address%s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. Found dma-ranges in root node, shouldn't happen linux,phandlefdt_initrd: %s linux,initrd-startlinux,initrd-endWARNING: could not set linux,initrd-start %s. WARNING: could not set linux,initrd-end %s. dma-rangesfdt_root: %s serial-numberWARNING: could not set serial-number %s. okayfailInvalid fdt status: %x The address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dNo valid device tree binary found at %p No current device Interface: %s No valid FAT fs found Filesystem: %s "%s" FAT: illegal filename (%s) %s: doesn't exist (%d) Error: writing contents Error: flush fat buffer ///./..MMC Device %d not found ## Checking hash(es) for FIT Image at %08lx ... Hash(es) for Image %u (%s): descriptiontimestampUnsupported %s address size data-offsetdata-positiondata-sizealgo## Loading %s from FIT Image at %08lx ... Bad FIT %s image format! (err=%d) Could not find configuration node Using '%s' configuration Could not find subimage node type '%s' Trying '%s' %s subimage Verifying Hash Integrity ... No %s %s %s Image Could not find %s subimage data! Can't get %s subimage load address! Error: %s overwritten Loading %s from 0x%08lx to 0x%08lx Error decompressing %s WARNING: 'compression' nodes for ramdisks are deprecated, please fix your .its file! Subimage data is not a FDT%s Description: %s Created: %s Type: %s %s Compression: %s %s Data Start: %s Data Size: %s Architecture: %s %s OS: %s %s Load Address: %s Load Address: 0x%08lx %s Entry Point: %s %s algo: invalid/unsupported key-name-hint (required)padding%s %s padding: %s %s %s value: unavailable %s Timestamp: hashHashsignatureSignCan't get image data/sizeerror! %s in '%s' image node Corrupted or truncated treeUnsupported hash algorithmCan't get hash value propertyCan't get hash algo propertyBad hash valueBad hash value lenuboot-ignore-skipped + error! %s for '%s' hash node in '%s' image node %sFIT description: %sCreated: Can't find images parent node '%s' (%s) %s Image %u (%s) /configurations%s Default Configuration: '%s' %s Configuration %u (%s) %s Kernel: %s Init Ramdisk: %s %s Firmware: %s %s FDT: %s %s FPGA: %s %s Loadables: ERROR: no/invalid property! ERROR: no/invalid speed given in fixed-link node! full-duplexasym-pauseJump offset is too bigethernet2cznic,turris-omnia-mcuphy-reset-gpiosmarvell,armada-380-ahciCannot disable SATA DT node! Cannot find SATA DT node! Cannot increase FDT size! Error: writing directory entry outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02xBTRFS: dirty eb leak (aborted trans): start %llu len %u missing environment variable: %s ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part ** Unable to create link %s -> %s ** %s/ %s %8lld %s %d file(s), %d dir(s) ** Reading file would overwrite reserved memory ** ** Unable to write file %s ** jedec,spi-norFailed fixing SPI NOR partitions! #address-cells#size-cellsfixed-partitionscompatiblepartition@%llxreglabelread-onlyUnknown ArchitectureUnknown CompressionUnknown OSUnknown Image%d Bytes = %4d-%02d-%02d %2d:%02d:%02d UTC %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done Cannot find ATSHA204A on I2C bus! unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) Error: Invalid FAT entry: 0x%08x %uMTD device %s not found, ret %ld Warning: MTD name "%s" is not unique! mtdidspxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%sBase path too long (%s%s) Retrieving file: %s Could not read count from timer (err %d) Bank %s: %s%d: %s: %d [%c]%s%s%s.%s%dFailed to get partition driver count Error insufficient memory gpt_partition_listMore partitions than allowed! Partition name: %s does not match %s! Partition %s size: %llu does not match %llu! Partition %s start: %llu does not match %llu! Error: Bad gzipped data Error: gunzip out of data in header Expected include path: %.*s Couldn't retrieve %s pxe_label_overrideMissing override pxe label: %s Missing default: %s ### ERROR ### Please RESET the board ### Unknown hash algorithm '%s' HASH_MAX_DIGEST_SIZE exceeded %s for %08lx ... %08lx ==> [0123456789abcdefEnv export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! u-boot,i2c-offset-lengeneric_%xi2c_generic_chip_drvNo I2C bus selected ->i2c_mux_bus_drvi2c-parentu-boot,i2c-transaction-bytesTFTP server died+,<=>:;"/\|?*[]XIP %s %s Loading Uncompressing %s Unimplemented compression type %d ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC FIT image found Bad FIT image format! Bad hash in FIT image! Unknown image format! Bad magic number Bad header crc Bad data crc Bad image type Empty Script /imagesCould not find config %s Could not find script in %s No FIT subimage unit name Can't find '%s' FIT subimage Not a image image Bad Data Hash Could not find script subimage data Wrong image format for "source" command %sImage Name: %.*s %sCreated: %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x ERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconfskip_board_fixupskip board fdt fixup ERROR: board-specific fdt fixup failed: %s ERROR: fdt fixup event failed: %d - must RESET the board to recover. unknown compression methodincorrect header checkunknown header flags setinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkinvalid distance too far backinvalid distance codeinvalid literal/length codebaudrateload-environmentMMC: Net: WDT: Not starting %s WDT: Failed to start %s %s=%sR j068@|9/4CDT{2#=L BN.f($v[Im%rdhԤ\]elpHP^FWث XE,?k:AOgst"57unGq)ʼnobV>Ky xZݨ31Y'_`QJ -zɜ;M* %zd append: %s fdt_addr_rfdtfilemalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT fdt_addrfdtcontroladdr%s: %s fs/btrfs/ctree.clist passed to list_sort() too long for efficiency No match for driver '%s' Device tree error at node '%s' Error binding driver '%s': %d ERROR: Failed to allocate 0x%lx bytes below 0x%lx. lmb_dump_all: %s.cnt = 0x%lx / max = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes %s Uart## Total Size = 0x%08x = %d Bytes probe [[bus:]cs] [hz] [mode] - init flash device on given SPI bus and chip select sf read addr offset|partition len - read `len' bytes starting at `offset' or from start of mtd `partition'to memory at `addr' sf write addr offset|partition len - write `len' bytes from memory at `addr' to flash at `offset' or to start of mtd `partition' sf erase offset|partition [+]len - erase `len' bytes from `offset' or from start of mtd `partition' `+len' round up `len' to block size sf update addr offset|partition len - erase and write `len' bytes from memory at `addr' to flash at `offset' or to start of mtd `partition' sf protect lock/unlock sector len - protect/unprotect 'len' bytes starting at address 'sector'LZO  Waiting for PHY realtime link%s %s: Macronix Quad bit not set prebootNo CLI availablemarvell,reg-initunknown cmd (%d) at %d ## ERROR: unsupported match method: 0x%02x Cannot add window '%04x:%04x', conflicts with another window %x - %s <--> %s %s is not a known ethernet mdio_register: non unique device name '%s' Enter choice: 1000BASE-X PHY AN duplexPHY duplexPHY AN adv duplex read failed, assuming half duplex NULL device name! PHY extended status read failed, assuming no 1000BASE-X MII devices: '%s' Current device: '%s' No such device: %s PHY 1000BT statusPHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc_blkmmc_bootdevMMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Error - failed to obtain block descriptor mmc write failed vmmc-supplyvqmmc-supplyCard did not respond to voltage select! : %d eMMC >= 4.4 required for enhanced user data area Card does not support partitioning Card does not define HC WP group size User data enhanced area not HC WP group size aligned GP%i partition not HC WP group size aligned Card does not support enhanced attribute Total enhanced size exceeds maximum (%u > %u) Card does not support host controlled partition write reliability settings Card already partitioned unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d Man %06x Snr %04x%04x%c%c%c%c%c%c%s - probe failed: %d Unknown modecap-sd-highspeed%s %s: Invalid "bus-width" value %u! cap-mmc-highspeedsd-uhs-sdr12sd-uhs-sdr25sd-uhs-sdr50sd-uhs-sdr104sd-uhs-ddr50mmc-ddr-1_8vmmc-ddr-1_2vmmc-hs200-1_8vmmc-hs200-1_2vmmc-hs400-1_8vmmc-hs400-1_2vmmc-hs400-enhanced-strobenon-removablecd-invertedbroken-cdno-1-8-vStatus Error: 0x%08x Timeout waiting card ready Error enabling VMMC supply : %d No SD/MMC/eMMC card found %s(%d) init failed Error: MMC 0 not found MMC: no card present writing%08lx: %02lx %04lx ? %08x %0lx %04xJanFebMarAprMayJunJulAugSepOctNovDecmtdparts support missing. Offset exceeds device limit '%s' is not a number Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx 0x%08x: %02x Minimum partition size 4kiB, %lldB requested No closing ')' found in partition name Empty partition name No partitions allowed after a fill-up Unexpected character '%c' in mtdparts 0x%08llx@0x%08llxNot enough space to save partitions meta-data Partition size must be a multiple of %d mtdparts"%s" partitions still in use, can't delete them mtdparts=Wrong mtdparts: %s MTD name too long: %s Could not find a valid device for %s Could not parse device %s Failed parsing MTD partitions from mtdparts! Failed parsing MTD %s OF partitions! - 0x%012llx-0x%012llx : "%s" #(-27:"/\|?*reg-offsetreg-shiftreg-io-widthnvme#%dError: malloc prp_pool fail Failed to init PCI (%dE) Error: %s: Out of memory! nvme-blkyesnoBlk device %d: Optional Admin Command Support: Namespace Management/Attachment: %s Firmware Commit/Image download: %s Format NVM: %s Security Send/Receive: %s Blk device %d: Optional NVM Command Support: Reservation: %s Save/Select field in the Set/Get features: %s Write Zeroes: %s Dataset Management: %s Write Uncorrectable: %s Blk device %d: Format NVM Attributes: Support Cryptographic Erase: %s Support erase a particular namespace: %s Support format a particular namespace: %s Blk device %d: LBA Format Support: LBA Foramt %d Support: (current) Metadata Size: %d LBA Data Size: %d Relative Performance: %s Blk device %d: End-to-End DataProtect Capabilities: As last eight bytes: %s As first eight bytes: %s Support Type3: %s Support Type2: %s Support Type1: %s Blk device %d: Metadata capabilities: As part of a separate buffer: %s As part of an extended data LBA: %s 0x%.4xERROR: status = %x, phase = %d, head = %d /configfixed-linkbootph-allbootph-some-rambootph-pre-rambootph-pre-sramu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplu-boot,dm-vplpciVVVV,DDDDphy-modephy-connection-typei2c@11000->i2cmux@70->i2c@0Cannot get I2C bus %s: uclass_get_device_by_name failed: %i Cannot get %s I2C chip: i2c_get_chip failed: %i Memory config from EEPROM read failed! Falling back to default 1 GiB! MCUEEPROMdm_i2c_read failed: %i, cannot read EEPROM bad EEPROM magic number (%08x, should be %08x) bad EEPROM CRC (stored %08x, computed %08x) ## Baudrate %d bps not supported ## Baudrate may not be deleted \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,bootmeths:bootmeths,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,stdinstdoutstderreth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,Failed to allocate memory for fs_info ERROR: Filesystem UUID change in progress BTRFS: cannot read chunk root Couldn't read chunk tree fixedInvalid address/size flushExpected string: %.*s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s Expected string literal: %.*s IFS\$'";&|#;$&|exit not allowed from main input shell. %s:%dblk_partitionCould not find "%s" partition Couldn't find partition %s %s ** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %08x-%02x** First descriptor is NOT a primary desc on %d:%d ** CD001** Wrong ISO Ident: %s on %d:%d ** EL TORITO SPECIFICATION** No valid boot catalog found on %d:%d ** ** Wrong El Torito ident: %s on %d:%d ** ** Can't read Boot Entry at %lX on %d:%d ** ** Checksum Error in booting catalog validation entry on %d:%d ** ** Key 0x55 0xAA error on %d:%d ** ** Partition %d not found on device %d ** ** Partition %d is not bootable on device %d ** Whole Disk## Unknown partition table type %x Partition Map for IDESATAUSBHOSTNVMePV BLOCKVirtIOUNKNOWN device %d -- Partition Type: %s Part Start Sector Num Sectors UUID Type Part Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %pUl guid: %pUl ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s hdusbdmmcsdxx%s%c%du-boot,efi-partition-entries-offset%s %s: Max support %d pins now %s %s: Error reading output register %s %s: Error reading direction register %s@%x_gpio@%x_%s %s: Error writing invert register %s %s: Unsupported now %s %s: %s error udevice *)(NULLpci,no-autoconfigpci_bridge_drvpci_generic_drvpci_%x:%x.%xu-boot,pci-pre-reloc %0*lxBuild before PCI Rev2.0Network controllerDisplay controllerMultimedia deviceMemory controllerBridge deviceSimple comm. controllerBase system peripheralInput deviceDocking stationProcessorSerial bus controllerIntelligent controllerSatellite controllerCryptographic deviceDSPDoes not fit any classMass storage controller class code = 0x%.2x (%s) unknown header Bus '%s' is not a PCI controller Buses %02x-%02x SizePhys startBus start# %-18s %-18s %-18s %s Flags%d %#018llx %#018llx %#018llx mem %s =%*s%#.*lx u-boot,skip-auto-config-until-relocScanning PCI devices on bus %d BusDevFun VendorId DeviceId Device Class Sub-Class _____________________________________________________________ %02x.%02x.%02x 0x%.4lx 0x%.4lx %-23s 0x%.2lx Found PCI device %02x.%02x.%02x: Could not get PHY for %s: addr %d %s:%d is connected to %s. Reconnecting to %s (null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed PHY reset timed out gpio-controllerpinconfiggroupsfunctiongpio-rangespinctrl-namespinctrl-%d%s %s: could not find pctldev WARN urb submitted to disabled ep WARN waiting for error on ep to be cleared WARN halted endpoint, queueing URB anyway. ERROR unknown endpoint state for ep SoC: Unknown-MV78230-MV78260-MV78460-MV88F6720-MV88F6810-MV88F6820-MV88F6828-98DX3236-98DX3336-98DX4251-A0B0?? (%x)Z1A1 at %d MHz fdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%s%llu Hz%s%lu.%ld %cHz%seMMC%s: %d (%s)YesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s card capabilitieshost capabilitiesRd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: HC WP Group Size: User Capacity: WRREL Boot Capacity: RPMB Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state Boot Extd%3d %-10lu %-10lu %08x-%02x %02x%s%s %u Bytes%s %ciB%spxeuuidError parsing config file  @6invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** FAT32 FAT12 FAT16 BTRFS: Couldn't map the block %llu BTRFS: devid %llu is missing BTRFS: read failed on devid %llu physical %llu BTRFS: child eb corrupted: parent bytenr=%llu item=%d parent level=%d child level=%d Superblocktry btrfsck --repair -s ie, 0,1,2MetadataBTRFS: %s checksums match, but it has an invalid chunk, %s warning, device %llu is missing BTRFS: failed to add chunk map start=%llu len=%llu: %d (%m) BTRFS: tree block bytenr %llu is not aligned to sectorsize %u bad tree block %llu, fsid mismatch, want=%s, have=%s bytenr mismatch, want=%llu, have=%llu bad level, %u > %d invalid nr_items: %u Csum didn't match Couldn't map the block %Lu pre-reloc realloc() is not supporteddrivers/usb/host/xhci-ring.cncipncoutportncinport^%s$## Error: variable "%s" not defined ## error: subst buffer overflow: have %d, need %d %s=%s regulator-nameregulator-min-microvoltregulator-max-microvoltregulator-init-microvoltregulator-min-microampregulator-max-microampregulator-always-onregulator-boot-onregulator-ramp-delayregulator-force-boot-offregulator-state-memregulator-off-in-suspendregulator-suspend-microvolt#reset-cellsresets*** ERROR: NFS version not supportedHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command Error - written %#lx blocks Cannot probe SATA device %d (err=%d) No SATA device found! Cannot scan SATA device %d (err=%d) Error: SATA device not found Error: SATA 0 not found Cannot find SATA device %d (err=%d) Cannot remove SATA device '%s' (err=%d) c|w{ko0g+׫vʂ}YGԢr&6?4q1#'u ,nZR;ֳ)/S [j˾9JLXCM3EPfHa5WiَU(ߌ BhA-Tscanning bus for devices... unable to unbind devices (%dE) id%dlun%dscsi_blkscsi_bootdevcd-gpios%s: Aligned buffer alloc failed!!! %s: Reset 0x%x never completed. %s: MMC: %d busy timeout increasing to: %u ms. %s: Timeout for status update! %s: Transfer data timeout %s: Timeout to wait cmd & data inhibit %s: Error while setting tap delay %s: Error while configuring dll %s: Internal clock never stabilised. sdhci-caps-masksdhci-caps%s: Hardware doesn't specify base clock frequency stdout-pathNo serial driver foundError get-and-setting cluster Error: no space left: %llu uuid_disk=name=,start=MiB,size=MiB,uuid=;uuid_diskError: is the partitions string NULL-terminated? Wrong uuid format for partition %d %.*s.%.3s~%dWorking FDT set to %lx fdtaddrError compiling regex: %s %s: No match ## error: pattern buffer overflow: have %d, need %d spi_flash_probe_bus_cs() failedunknownModel: Turris Omnia MCU type: %s MCU version: %s RAM size: %i MiB Serial Number: %s Bus %d: %s (active %d) %02x: %s, offset len %x, flags %x %-10.10s %3d [ %c ] %-20.20s | `-- |-- BTRFS: Can't find root %llu BTRFS: Can't find inode %llu %.3s %.3s %.2d %.2d:%.2d:%.2d %d BTRFS: Can't alloc memory for symlink %llu BTRFS: Failed to read symlink %llu <%s> ?%3u? %4llu,%5llu %10llu %24.24s %.*s -> %s (effective Ops get_pins_count not supported by %s Ops get_pin_name error (%d) by %s Ops get_pin_muxing error (%d) by %s in %s %-*s: %-*s reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: (%0*x) %0*x Unknown07/01/2023skufamilyproductUnknown Productasset-tagmanufacturerFailed to probe SPI Flash Erasing %d bytes (%d blocks) at offset 0 ...Error! Done! Writing %d bytes from 0x%lx to offset 0 ...%s %s: Invalid cs %d (err=%d) spi_flash@%d:%djedec_spi_norSF: Failed to set up slave Invalid bus %d (err=%d) %s %s: Invalid chip select %d:%d (err=%d) !R\248>Ž ; - set max blocks per entry and max cache entries showconfigurebootefiBoots an EFI payload from memorybootzboot Linux zImage image from memorybtrsubvollist subvolumes of a BTRFS filesystem - List subvolumes of a BTRFS filesystem.dcacheenable or disable data cache[on, off, flush] - enable, disable, or flush data (writethrough) cacheicacheenable or disable instruction cache[on, off, flush] - enable, disable, or flush instruction cacheconinfoprint console devices and informationget/set/reset date & time[MMDDhhmm[[CC]YY][.ss]] date reset - without arguments: print date & time - with numeric argument: set the system date & time - with 'reset' argument: reset the RTCSunMonTuesWednesThursFriSaturDriver model low level accesscompatdevresdriversstaticuclasscyclicCyclicecho args to console[-n] [args..] - echo args to console; -n suppresses newlinebootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsfatmkdircreate a directory [] - create a directory in 'dev' on 'interface'fatrmdelete a file [] - delete a file from 'dev' on 'interface'fatwritewrite file into a dos filesystem [ []] - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizeflattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structprotectenable or disable FLASH write protectionon start end - protect FLASH from addr 'start' to addr 'end' protect on start +len - protect FLASH from addr 'start' to end of sect w/addr 'start'+'len'-1 protect on N:SF[-SL] - protect sectors SF-SL in FLASH bank # N protect on bank N - protect FLASH bank # N protect on all - protect all FLASH banks protect off start end - make FLASH from addr 'start' to addr 'end' writable protect off start +len - make FLASH from addr 'start' to end of sect w/addr 'start'+'len'-1 wrtable protect off N:SF[-SL] - make sectors SF-SL writable in FLASH bank # N protect off bank N - make FLASH bank # N writable protect off all - make all FLASH banks writableeraseerase FLASH memorystart end - erase FLASH from addr 'start' to addr 'end' erase start +len - erase FLASH from addr 'start' to the end of sect w/addr 'start'+'len'-1 erase N:SF[-SL] - erase sectors SF-SL in FLASH bank # N erase bank N - erase FLASH bank # N erase all - erase all FLASH banksflinfoprint FLASH memory information - print information for all FLASH memory banks flinfo N - print information for FLASH memory bank # NfstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start.fuseFuse sub-systemread [] - read 1 or 'cnt' fuse words, starting at 'word' fuse cmp - compare 'hexval' to fuse at 'word' fuse readm [] - read 1 or 'cnt' fuse words, starting at 'word' into memory at 'addr' fuse sense [] - sense 1 or 'cnt' fuse words, starting at 'word' fuse prog [-y] [...] - program 1 or several fuse words, starting at 'word' (PERMANENT) fuse override [...] - override 1 or several fuse words, starting at 'word'query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsI2C sub-systemcrc32loopmmmwnmprobeolencompute hash message digestalgorithm address count [[*]hash_dest] - compute message digest [save to env var / *address]itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data mtestsimple RAM read/write test[start [end [pattern [iterations]]]]infinite loop on address range[.b, .w, .l, .q] address number_of_objectsprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]memory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmemory write (fill)[.b, .w, .l, .q] address value [count]memory modify (constant address)[.b, .w, .l, .q] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]MII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enableMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc hwpartition - does hardware partitioning arguments (sizes in 512-byte blocks): USER - <{on|off}> : sets user data area attributes GP - <{gp1|gp2|gp3|gp4}> <{on|off}> : general purpose partition MODE - <{check|set|complete}> : mode, complete set partitioning completed WARNING: Partitioning is a write-once setting once it is set to complete. Power cycling is required to initialize partitions after set to complete. mmc setdsr - set DSR register value wphwpartitionsetdsrmtdMTD utilsNET sub-systemlist - list available devices pingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]boot image via network using DHCP/TFTP protocoltftpputTFTP put command, for uploading files to a serverAddress Size [[hostIPaddr:]filename]tftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocoldisk partition related commandsuuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition table part list [flags] - set environment variable to the list of partitions flags can be -bootable (list only bootable partitions) part start - set environment variable to the start of the partition (in blocks) part can be either partition number or partition name part size - set environment variable to the size of the partition (in blocks) part can be either partition number or partition name part number - set environment variable to the partition number using the partition name part must be specified as partition name part type : - set environment variable to partition type part types - list supported partition table typeslist and access PCI Configuration Spaceprefetchsysmemreadonlysecondary statusprimary bus numberCardBus numbersubordinate bus numberCardBus latency timerCardBus memory base 0CardBus memory limit 0CardBus memory base 1CardBus memory limit 1CardBus IO base 0CardBus IO base high 0CardBus IO limit 0CardBus IO limit high 0CardBus IO base 1CardBus IO base high 1CardBus IO limit 1CardBus IO limit high 1interrupt lineinterrupt pinbridge controlsubvendor IDsubdevice IDPC Card 16bit base addressbase address 1secondary bus numbersecondary latency timerIO baseIO limitprefetch memory baseprefetch memory limitprefetch memory base upperprefetch memory limit upperIO base upper 16 bitsIO limit upper 16 bitsexpansion ROM base addressbase address 2base address 3base address 4base address 5cardBus CIS pointersub system vendor IDsub system IDmin Grantmax Latencysub class codeprogramming interfacecache linelatency timeheader typeBISTbase address 0command register IDrevision IDpinmuxshow pin-controller muxinglist - list UCLASS_PINCTRL devices pinmux dev [pincontroller-name] - select pin-controller device pinmux status [-a | pin-name] - print pin-controller muxing [for all | for pin-name] commands to get and boot from pxe files To use IPv6 add -ipv6 parameterget [-ipv6] - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] [-ipv6] - boot from the pxe file at pxefile_addr_r getdefault-arm-mvebu-turris_omniadefault-arm-mvebudefault-armsataSATA sub systeminit - init SATA sub system sata stop [dev] - disable SATA sub system or device sata info - show available SATA devices sata device [dev] - show or set current device sata part [dev] - print partition table sata read addr blk# cnt sata write addr blk# cntNVM Express sub-systemscan - scan NVMe devices nvme detail - show details of current NVMe device nvme info - show all available NVMe devices nvme device [dev] - show or set current NVMe device nvme part [dev] - print partition table of one or all NVMe devices nvme read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' nvme write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'sfSPI flash sub-systemscsibootboot from SCSI deviceloadAddr dev:partSCSI sub-systemreset - reset SCSI controller scsi info - show available SCSI devices scsi scan - (re-)scan SCSI bus scsi device [dev] - show or set current device scsi part [dev] - print partition table of one or all SCSI devices scsi read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' scsi write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'sha1sumcompute SHA1 message digestaddress count [[*]sum] - compute SHA1 message digest [save to sum]setexprset environment variable as the result of eval expression[.b, .w, .l, .s] name [*]value1 [*]value2 - set environment variable 'name' to the result of the evaluated expression specified by . can be &, |, ^, +, -, *, /, % (for strings only + is supported) size argument is only meaningful if value1 and/or value2 are memory addresses (*) setexpr[.b, .w, .l] name [*]value - load a value into a variable setexpr name gsub r s [t] - For each substring matching the regular expression in the string , substitute the string . The result is assigned to . If is not supplied, use the old value of setexpr name sub r s [t] - Just like gsub(), but replace only the first matching substringsspiSPI utility command[:][.][@] - Send and receive bits - Identifies the SPI bus - Identifies the chip select - Identifies the SPI mode to use - Identifies the SPI bus frequency in Hz - Number of bits to send (base 10) - Hexadecimal string that gets sentsysbootcommand to get and boot from syslinux files[-p] [addr] [filename] - load and parse syslinux menu file 'filename' from ext2, fat or any filesystem on 'dev' on 'interface' to address 'addr'run commands and summarize execution timecommand [args...] truedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-z-eWatchdog sub-systemexpirelzmadeclzma uncompress a memory regionsrcaddr dstaddr [dstsize]1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'fsuuidLook up a filesystem UUID : - print filesystem UUID fsuuid : - set environment variable to filesystem UUID imxtractextract a part of a multi-imagegptGUID Partition Table - GUID partition table restoration and validity check Restore or verify GPT information on a device connected to interface Example usage: gpt repair mmc 0 - repair the GPT on the device gpt write mmc 0 $partitions - write the GPT to device gpt verify mmc 0 $partitions - verify the GPT on device against $partitions gpt setenv mmc 0 $name - setup environment variables for partition $name: gpt_partition_addr, gpt_partition_size, gpt_partition_name, gpt_partition_entry gpt enumerate mmc 0 - store list of partitions to gpt_partition_list environment variable read - read GPT into a data structure for manipulation gpt guid - print disk GUID gpt guid - set environment variable to disk GUID Example usage: gpt guid mmc 0 gpt guid mmc 0 varname bubtBurn a u-boot image to flash[file-name] [destination [source]] -file-name The image file name to burn. Default = u-boot-with-spl.kwb -destination Flash to burn to [spi, nand, mmc, sata]. Default = spi -source The source to load image from [tftp, usb, mmc, sata]. Default = tftp Examples: bubt - Burn flash-image.bin from tftp to active boot device bubt flash-image-new.bin nand - Burn flash-image-new.bin from tftp to NAND flash bubt backup-flash-image.bin mmc usb - Burn backup-flash-image.bin from usb to MMC pexrunrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintexistssaveenvsave environment variables to persistent storageshowvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildoneusb_hubusb-hubusb_mass_storageusb-mass-storagemd5sha256crc16-ccittBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access fileDOSISOnvmxipefiloadervirtiopvblockblkmapfixed_rate_raw_clockfixed_clockfixed-clockfixed_factor_clockfixed-factor-clock/clocks/firmwarerootroot_drivernopsimple_bussimple-bussimple-mfdphy-handlephy-deviceinternalrev-miirev-rmiirgmii-idrgmii-rxidrgmii-txidrtbismiixlgmiimocaqsgmiitrgmii100base-x1000base-x2500base-xrxaui10gbase-r25gbase-rusxgmii10gbase-krqusgmii1000base-kxinputoutputunusedfuncpca953xnxp,pca9505nxp,pca9534nxp,pca9535nxp,pca9536nxp,pca9537nxp,pca9538nxp,pca9539nxp,pca9554nxp,pca9555nxp,pca9556nxp,pca9557nxp,pca9574nxp,pca9575nxp,pca9698nxp,pcal6524maxim,max7310maxim,max7312maxim,max7313maxim,max7315ti,pca6107ti,tca6408ti,tca6416ti,tca6424ti,tca9539onsemi,pca9654exar,xra1202gpio_mvebumarvell,orion-gpioi2c-chipi2c_generici2c_mvtwsimarvell,mv64xxx-i2cmarvell,mv78230-i2callwinner,sun4i-a10-i2callwinner,sun6i-a31-i2ci2c_muxpca954xnxp,pca9543nxp,pca9544nxp,pca9546nxp,pca9547nxp,pca9548nxp,pca9646nxp,pca9847MMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)u-boot,bootdev-mmcmarvell,armada-380-sdhcispi_flashmx25l2005amx25l4005amx25l8005mx25l1606emx25l3205dmx25l6405dmx25u2033emx25u1635emx25u3235fmx25u6435fmx25l12805dmx25u12835fmx25u51245gmx25l12855emx25l25635emx25u25635fmx25v8035fmx25r1635fmx25l25655emx66l51235lmx66u51235fmx25u51245fmx66u1g45gmx66u2g45gmx66l1g45gmx66l2g45gmx25l1633emx25r6435fmx66uw2g345gx0mx66lm1g45gmx25lm51245gmx25lw51245gmx25lm25645gmx66uw2g345gmx66um1g45gmx66uw1g45gmx25uw51245gmx25uw51345gmx25um25645gmx25uw25645gmx25um25345gmx25uw25345gmx25uw12845gmx25uw12345gmx25uw6445gmx25uw6345gs25sl032ps25sl064ps25fl256s0s25fl256s1s25fl512ss25fs512ss25fl512s_256ks25fl512s_64ks25fl512s_512ks70fs01gs_256ks25sl12800s25sl12801s25fl128ss25fl129p0s25fl129p1s25sl008as25sl016as25sl032as25sl064as25fl116ks25fl164ks25fl208ks25fl064ls25fl128ls25fl256ls25hl512ts25hl01gts25hl02gts25hs512ts25hs01gts25hs02gts25fs256tw25p80w25p16w25p32w25x05w25x40w25x16w25q16dww25x32w25q20clw25q20bww25q20eww25q32w25q32dww25q16jvw25q32jvw25q32jwmw25x64w25q64dww25q64jvw25q128fww25q128jvw25q128jww25q256fww25q256jww25q512jvw25q512nwqw25q512nwmw25q512jvqw25q01jvw25q80w25q80blw25q16clw25q32bvw25q64cvw25q128w25q256w25m512jww25m512jvw25h02jvmvmdiomarvell,orion-mdiomarvell,xmdiomvnetamarvell,armada-370-netamarvell,armada-xp-netaGeneric PHYMarvell 88E1680Marvell 88E1310Marvell 88E151xMarvell 88E1240Marvell 88E1149SMarvell 88E1145Marvell 88E1121RMarvell 88E1118RMarvell 88E1118Marvell 88E1111SMarvell 88E1011SFixed PHYpci-genericpci_genericpci-bridgepcie_mvebu_basemarvell,armada-xp-pciemarvell,kirkwood-pciepcie_mvebuarmada-38x-pinctrlmarvell,mv88f6810-pinctrlmarvell,mv88f6820-pinctrlmarvell,mv88f6828-pinctrlaudiodramge0ge1i2c0i2c1pcie0pcie1pcie2pcie3ptprefsata0sata1sata2sata3sd0spi0spi1tdmua0ua1mpp0mpp1mpp2mpp3mpp4mpp5mpp6mpp7mpp8mpp9mpp10mpp11mpp12mpp13mpp14mpp15mpp16mpp17mpp18mpp19mpp20mpp21mpp22mpp23mpp24mpp25mpp26mpp27mpp28mpp29mpp30mpp31mpp32mpp33mpp34mpp35mpp36mpp37mpp38mpp39mpp40mpp41mpp42mpp43mpp44mpp45mpp46mpp47mpp48mpp49mpp50mpp51mpp52mpp53mpp54mpp55mpp56mpp57mpp58mpp59rstoutsdacs0clkreqsckmisorxdtxdmdcdeccerrmosics1prsnttxerrrstbclkevreqsdidtxsdotrigdrxextclkfsynclrclkvttctrlpclkmclkclk_out1clk_out0cs2rb1ad7rxctlcs3burst/lastrb0rxd3ad6rxd2rxd1ad4rxclkad8ad1ad3txctlwe0txd3ale1txd2oetxd1ale0txd0ad5txclkoutreadyad2ad0rxd0bootcstxclkrxerrmdio slavemdc slavewe1ad15ad14ad13ad12ad11ad10ad9crsregulatorns16550_serialns16550ns16550aingenic,jz4780-uartnvidia,tegra20-uartsnps,dw-apb-uartspi_genericmvebu_spimarvell,orion-spimarvell,armada-375-spimarvell,armada-380-spimarvell,armada-xp-spiorion_timermarvell,orion-timermarvell,armada-370-timermarvell,armada-xp-timerahci_pciahci-pcisata_blkahci_mvebumarvell,armada-3700-ahcimarvell,armada-8k-ahcicavium,octeon-7130-ahcimiscatmel,atsha204atmel,atsha204anvme_bootdevu-boot,bootdev-nvmertc-armada38xmarvell,armada-380-rtcu-boot,bootdev-scsiwatchdogorion_wdtmarvell,armada-380-wdtusb_dev_genericu-boot,bootdev-usbehci_mvebumarvell,orion-ehci xhci_mvebumarvell,armada3700-xhcimarvell,armada-380-xhcimarvell,armada-8k-xhciSPIFlashext4btrfsunsupportedDIRCHRBLKFIFSCKSYMEFI block driverFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGSbaseboardchassisseparatefitembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-initu-boot,bootdev-ethnvlan## error: substitution buffer overflow syntax error FATFAT32blksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... TFTP error: '%s' (%d) Not retrying... octetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedfromtftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) TFTP %s server %pI4; our IP address is %pI4Filename '%s'.Save address: 0x%lx Save size: 0x%lx Saving: *Load address: 0x%lx Retry count exceeded %s; starting again Invalid load option for %ls /EFI/BOOT/BOOTARM.EFILoading %ls '%ls' failed Booting: %ls Unloading image failed serial#%08X%08XError: turris_omnia_mcu CMD_GET_STATUS_WORD failed: %d Error: turris_omnia_mcu CMD_GET_FEATURES failed: %d mcu_HUSH_VERSION0.01%s: readonly variable( w usb,device-classusb,interface-classHuman Interface, Subclass: NoneKeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk onlySelf Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dms%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d String: "%s"Error: Cannot find high speed parent of usb-1 device See InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudiounable to get descriptor, error %lX config descriptor too short (expected %i, got %i) usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times cannot reset port %i!? Bus %s: Port not available. probe failed, error %d No working controllers found usb_storage_blkusb_bootdevError: usb_init failed Error: USB storage device not found Error: USB 0 not found scanning bus %s for devices... No USB Device found %d USB Device(s) found generic_bus_%x_dev_%xusb_dev_generic_drvusb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX selecting invalid interface %d%s: invalid max packet size Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) 12 Mb/s+- %s (%s, %dmA) %s %s %s %s Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. ERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x ## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx vbecur-versioncur-vernumU-Boot bootloader-versionVersion: %s Vernum: %x/%xinvalid dir item name len: %u invalid dir item name + data len: %u + %u U-Boot 2023.07.02-OpenWrt-r23630-842932a63d (Nov 14 2023 - 13:38:11 +0000)timeout-sechw_margin_msu-boot,noautostartu-boot,autostartcyclic_register for %s failed every %ldmsWDT: Started %s with%s servicing %s (%ds timeout) smbios_SM__DMI_ޑ`VMﲎA_E#Su=Ll~hQb*F07 /$NX46ܴ[v}R^@yԍgrO톚fx%K]?!pcwB &þ5.UzȺ2DT; k(dt HC91ՋnIجGoJ\8Wsˡ>a |q̐ji:'+"ҩ3-<ɇPY eׄЂ)Z{m, TP}bE@ g[jZAO\4sS? Re^( 6=&i͟t.-Ma{>qh,`FKJk*UDHuc0mL5/9WG+f~)7,%ٮMD_Vi`{r !(3:╜Ӥ|ungXQJC4=&/ 蟖GNU\cjqx+"90 .'<5BKPYfot}18#*ypkb]TOF ,':1XSNEtbi{pmfW\AJ#(5>ǮFMP[ja|w29$/=6+  ensxIB_TƯGLQZk`}v 38%.<7*! doryHC^U -&;0YRODu~chzqlgV]@K")4? 49.#her\QFK󸵢kfq|_REH7:- m`wzYTCN1<+& 2?(%nctyZW@M >3$)boxuV[LAal{vUXOB =0'*gj}pS^ID;6!, 85"/di~sP]JG86$*p~lbHFTZʐ񫥷;5') KEWYs}oaMCQ_u{ig=3!/ vxjdN@R\>0",AO]Sywek1?-# ztfhBL^P 2<. Ɯ 4:(&|r`nDJXV79+%GI[UqcmCould not allocate xHCI USB device data structures Virt dev for slot[%d] already allocated Failed to allocate virtual device Failed to allocate out context for virt dev Failed to allocate in context for virt dev Evaluate ContextConfigure Endpointdrivers/usb/host/xhci.cERROR: %s command returned completion code %d. Resetting EP %d... unable to allocate DCBA Register %x NbrPorts %d Starting the controller USB XHCI %x.%02x Host not halted after %u microseconds. drivers/usb/host/xhci-mem.cnon-bulk pipe (type=%lu)non-control pipe (type=%lu)The request port(%d) exceeds maximum port number unknown value DT_STRING %x unknown value %x unknown feature %x Unknown request Setup ERROR: address device command for slot %d. Device not responding to set address. ERROR: Incompatible devicefor address device command. ERROR: unexpected command completion code 0x%x. Failed to configure xHCI endpoint non-interrupt pipe (type=%lu)vbus-supplyFailed to turn ON the VBUS regulator Unexpected XHCI event TRB, skipping... (%08x %08x %08x %08x) XHCI timeout on event type %d... cannot recover. ERROR : xmalloc failed ERROR : xrealloc failed Unknown errorloadxy_timeout%s: zstd_init_dctx() failed %s: failed to detect compressed size: %d %s: failed to decompress: %d Error: inflateInit2() returned %d Error: inflate() returned %d ğऀ$d઀,|ـxրր[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead For the new multi component uImage format (FIT) addresses must be extended to include component or configuration unit name: addr: - direct component image specification addr# - configuration specification Use iminfo command to get the list of existing component images and configurations. Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OSĉحOOحOOwحOOح OOح@OOحOOحOOحOOHحOO[.128,.192,.256] enc key iv src dst len - Encrypt block of data $len bytes long at address $src using a key at address $key with initialization vector at address $iv. Store the result at address $dst. The $len size must be multiple of 16 bytes. The $key and $iv must be 16 bytes long. aes [.128,.192,.256] dec key iv src dst len - Decrypt block of data $len bytes long at address $src using a key at address $key with initialization vector at address $iv. Store the result at address $dst. The $len size must be multiple of 16 bytes. The $key and $iv must be 16 bytes long.IحOOscan - boot first available bootflow [][:[]|#[]] - Run script starting at addr - A FIT config name or subimage name may be specified with : or # (like bootm). If the image or config name is omitted, the default is used.XOOOO[:] [] - boot EFI payload bootefi bootmgr [fdt address] - load and boot EFI payload based on BootOrder/BootXXXX variables. If specified, the device tree located at gets exposed as EFI configuration table. [addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead حOOحDOOحOOحOO9حOOحxOOcompat Dump list of drivers with compatibility strings dm devres Dump list of device resources for each device dm drivers Dump list of drivers with uclass and instances dm static Dump list of drivers with static platform data dm tree [-s] Dump tree of driver model devices (-s=sort) dm uclass Dump list of instances for each uclassщحpOO حOOcyclic demo - register cyclic demo function cyclic list - list cyclic functions /addr [-c] [-q] [] - Set the [control] fdt location to fdt boardsetup - Do board-specific set up fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.bus [muxtype:muxaddr:muxchannel] - show I2C bus info i2c crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length [-s] - write memory to I2C; the -s option selects bulk write in a single transaction i2c flags chip [flags] - set or get chip flags i2c olen chip [offset_length] - set or get chip offset length i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedN؊ح,$OOح(.OOح"OOح/OO+ح *OOحl(OOح-OOحt(OOح("OOpح ,OOԊ|(OOح|%OO ح$OOsح!OO4ح !OO@fqOOpحpOO pOOԊ0oOOsTnOOGحfOOحmOOXlOO ح8bOODgOODZ`OO ح|tOOpt{OOsԊt{OOs[t{OOssxOOsحwOOs- generic operations on memory technology devices mtd list mtd read[.raw][.oob] [ []] mtd dump[.raw][.oob] [ []] mtd write[.raw][.oob][.dontskipff] [ []] mtd erase[.dontskipbad] [ []] Specific functions: mtd bad With: : NAND partition/chip name (or corresponding DM device name or OF path) : user address from/to which data will be retrieved/stored : offset in in bytes (default: start of the part) * must be block-aligned for erase * must be page-aligned otherwise : length of the operation in bytes (default: the entire device) * must be a multiple of a block for erase * must be a multiple of a page otherwise (special case: default is a page with dump) The .dontskipff option forces writing empty pages, don't use it if unsure. OO[bus|*] [long] - short or long list of PCI devices on bus 'bus' pci enum - Enumerate PCI buses pci header b.d.f - show header of PCI device 'bus.device.function' pci bar b.d.f - show BARs base and size for device b.d.f' pci regions [bus|*] - show PCI regions pci display[.b, .w, .l] b.d.f [address] [# of objects] - display PCI configuration space (CFG) pci next[.b, .w, .l] b.d.f address - modify, read and keep CFG address pci modify[.b, .w, .l] b.d.f address - modify, auto increment CFG address pci write[.b, .w, .l] b.d.f address value - write to CFG address)<Kbx $(Ҹ,上.02&486O8b:z<=>@BD۹)깊K1 F"($=&S(n,028z<=>۹ҺẊ $(",7.0z<=E>O?[ j -⥊̻حOO حܚOO4حOOح`OOuحOOǽt ح ÁOOحOOĉح8ŁOO{حāOOsحāOOLɊح āOOlist - list watchdog devices wdt dev [] - get/set current watchdog device wdt start [flags] - start watchdog timer wdt stop - stop watchdog timer wdt reset - reset watchdog timer wdt expire [flags] - expire watchdog timer immediately addr part [dest] - extract from legacy image at and copy to addr uname [dest] - extract subimage from FIT image at and copy to tftpusbmmcLsataPspinandT\M ۊZi!xӽfӊ܊default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] tOOՊ POOՊxOOՊOOՊOOՊ ح<OOjӊ حlOOeOO) LOOՊ\OOy֊8֊֊ ~֊֊ ֊ 팉  ֊ 4#<#$$%$$#% %l$E촆,%h$D^$%$ T$TT%T##T,#T`І\GPITETh#T#D<D<X<X<`<`<h<h<p<p<x<x<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<======== = =(=(=0=0=8=8=@=@=H=H=P=P=X=X=`=`=h=h=p=p=x=x=================================>>>>>>>> > >(>(>0>0>8>8>@>@>H>H>P>P>X>X>`>`>h>h>p>p>x>x>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>???????? ? ?(?(?0?0?8?8?@?@?H?H?P?P?X?X?`?`?h?h?p?p?x?x?????????????????????????????????@@@@@@@@ @ @(@(@0@0@8@8@@@@@H@H@P@P@֊\d@҇䞂Ȟ֊ \lP֊5НXؔ(MMM A A,؊d̃̃ RCtJSSSST$VTUTAFMQvAU\U`0eA\iA<mqyiAU~zeAF4AyAFtyAyqAFy+AycUAy"UAAFiAFeAAUqhAi<Ae AM<vA\0Az!A%4+AAA/Aq3A7=AAFAKPASXA]bAfMA\~AQ<icQA`e"oA\uAyyA~}+A<iAXeAiQA%e\Aq`UUAFyAUAUUUA}F~UA7AAAKASA]AfAeAmi<AMA\AiAe!!aEaLxЄЄ\ɄDɄ$„ńd<)  @ @  Pt݄݄(߄4܄ *    @  0*d0P %<8$L̅l$%%%L88P99T;$<<$%%%d$l$t$$|$$$$$%%%QQBOOTSERVdp!P)9,/8;l+EF`L&RRRRRRRYQ(ZQS|SSSQRQT4QPPPOHSPP2~SSSSSS1a2b>nIyCsQ4d5e7g8hVBr3c@p;kAqK{T?o<lDtFvUJzSL|PM}GwO9iN~Hx=mEuR6f:j$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,01jkjkZ[LMV'GXY,-4RHIlmUBC_*+-M$D;./ !<=()"# @!Ars3S%E*J8 ]5PQFGVWlm\]dehiRStuvwX: \     nofg YhiJKNO Z>`a|}~?$%pqDE`aTUz{(H)I&'^bcdefg,L"B&F [#CxyT2/Obc+KPQW^_.N7@A6!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z------------ -$-!-"-%---- -- - - - -----------#--'---,0,(,X,,1,,M, ,<,,4,,7,*,Z,,G,,3,,H, ,;, ,:,),Y,',W, ,9,+,[, ,=,.,^,,>,,?,,@,,A,,I,,J,,B,,C,,N,,K,,,\,,D,$,T,%,U,",R,-,],,L,,E,,F,,2,!,Q, ,P,,O,,5,&,V,#,S,,8,,6,   q  prssr)!-%/'+#u( ,$.&*"tpq91=5?7;3w80<4>6:2viameogkc}h`ldnfjb|IAMEKCyH@LDJBxvwYQ]U_W[S{zAa&':e,23m,Q456789:;<=BbSCFGCc      ;<Sno,-./Dd    WEe()FG$%"#JKjkFfGg"# !` !cABHh*+()$%g,h,&'"#$%f&'u,v,&'Ii,-./   *+./h(),-yz{|}yilmJj45HIKk0167i,j,BC2345@ADELl9:=l=>;<<=6789`,a,HI:;?@b,kABMm>?@ABCn,qNnCDGHEFJKDEFGrHI OoNO*+./01PQ  JKLMLMRSPQLMNO,-NO[T"#PpTUVWRSTUc,}PQQqXYVWRrZ[TUXYVWXYZ[\]^_LMd,}>?X\\]SsZ[de`afg^_\]`abchi~,?YaTtdebcpq>f,jklmnofgdefg*+o,Pp,Re~oE()UuDlmvwrspqjkz{rsnohixytuVv^_~|}hibc`aWwtur,s,XxYyvwx23NOZzyz}~k,l,{|$%,@@ddܸ( tPE,vKxf|lx}ح߀lح$Bꁊح`O 9uح݀DO>ح݀DOɂz + ح܀f \حbp$+Jꂊ ح<-ح8DMъRъoъtۉحNuhحpOح`Nح`B4 ȅ|ححXحpPۉ L ح,υ䅊9ՊxAՊ[ՊXՊ حՊ7sy حO`!Iحx0&NحHȊ حȊحح#حiح|o}ꎊъdڊ>حדnح@uFحDNO̊حԁ̊̊ٙ ޙH حۀ~~Ad9U͊ ح߁͊͊ح0+ حހ܀ ۊحl ᜊ"ح%3 حLހ:iy͊حԁ͊,63ح(3"ɞ9Ϟ88)98Z98حDJJiحϕSɊحŁ[Ɋ{Ɋ+حHAwحY쩊؊حPâحLMM4܊ح_RqZkα vұ$*qحB %حMء졊ح4ܱ뱊Bح(FpحhM4ح辊>حD߀D` حxحL׷. حd6ػ حx߻Ԋ ح<ԊԊX}حȼe حހOhIs#S~l~jӊ حlnӊӊXӽح(ؽ轊ejՊՊOح8ح߉ LӊӊXÊH&Ê`Êح2/ŠحŠŠ֊ حt ֊-֊ĉ۫ح_᫊́Ӂ5Ɗح:ƊNƊNJحлNJNJ ح Ɋ&Ɋ)ح2pʲحҲ ,ȊȊȊ ح Ȋ)حЁɊɊɊحЁɊح\߀jO |Á8Ɋ(5,Ix:xxtxOfOW=0VpAmD >PP>}@l }8D< }HDĤT ]ĉ(?TpD0׊?H(?׊?@&@-xC4ڄلO C8b׊?(?ڊ0JQ ,J#6$E#4`Fڊ4xKbccKomUʃ˃UT5̌H\5IȔ=EI̧|@Usb|J\0JClJTrtJAK K(,KDTKgLLdcl_ |LK8~F$LL싄H u(NwHNLN8\NJي0|N`M(TO0ۊ7OkXkjOUROOUTPDTJ?YV,؊d:$:TgTgTT<؊h4ERn0b8Ubgܿzy֊z h ֊@hg8,hPxh `P 7~LE׀ր *4^w ܅$0ʼnLW,G,p}|a,@N,p p#"$ӀxڀGX߂ ׂ׊ς<҂̂׊@ւ(ււTp,OxOZZl0d4 ` A AXqAl`@AlO A ? A. A0AA A4A .0F|8 y}Uĉ`<~&d (,A0x=?? ۊ4|WW\_ڊ6(ۊ7g,gfAx bD`܊EαG8؊IKPPR`,4"<TYVhJ=WXK`XhV8sb'؊d`fgL[[<؊h+ l`e8mxe 7n܊mȃrupuTu)x`촄t@ $ y֊z` UtD@ $֊@}pE} HHhPtx      $(,048 $(,\`dhlptx`dhlp`d $<@DHLD!H!L!P!T!X!\!`!d!h!l!p!t!x!|!!!!("`"""#4#p#& &&&&& &$&(&,&0&4&8&<&@&D&H&L&&(((((((())) ))))) )$)l)$+----/ /$/(/,/0/4/333334 4P4t5588h;;p=T>>>>?????@@@AAA A`ABBB BTCXC\C`CdCDDD DDDDDD0G4G8Gp>t>x>|>>t@x@TAXAB\D`DDEJJJJJJJJJJJJJJKK4L`OTUUU UXY[[8\]_aa b$b8bxb|bbdddddddggggPiTiXi\iLkPkmmmpppppppppppqqq qqqqq q$q(q,q0q4q8q>>>>>>>>>>?$?(???????@@@@@@@@@@@@@@@@@AA AAAAA A$A(ABBBBBBBBBCCC CCCC,CCCCCCCCCCCC8DHDlDpDtDxD|DDDDDDDDDDDDDDDDDDDDDDDDDDDDD$E4E>> >>>>> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>??? ????? ?$?(?,?0?4?8? disableddevbus-cs1!marvell,mvebu-devbus = disableddevbus-cs2!marvell,mvebu-devbus ; disableddevbus-cs3!marvell,mvebu-devbus  7 disabledinternal-regs !simple-bussdramc@1400#!marvell,armada-xp-sdram-controllercache-controller@8000!arm,pl310-cache8Lscu@c000!arm,cortex-a9-scuXtimer@c200!arm,cortex-a9-global-timer  Z timer@c600!arm,cortex-a9-twd-timer  Z interrupt-controller@d000!arm,cortex-a9-gicevi2c@11000+!marvell,mv78230-a0-i2cmarvell,mv64xxx-i2c  Zokaydefaulti2cmux@70 !nxp,pca9547pi2c@0mcu@2a!cznic,turris-omnia-mcu*led-controller@2b!cznic,turris-omnia-leds+okaymulti-led@0  indicatormulti-led@1  indicatormulti-led@2 wlanmulti-led@3 wlanmulti-led@4 wlanmulti-led@5 wanmulti-led@6 lanmulti-led@7 lanmulti-led@8 lanmulti-led@9  lanmulti-led@a  lanmulti-led@b  powereeprom@54 !atmel,24c64Ti2c@1i2c@2i2c@3i2c@4#i2c@5crypto@64!atmel,atsha204adi2c@6i2c@7gpio@71 !nxp,pca9538qdefaultZ$i2c@11100+!marvell,mv78230-a0-i2cmarvell,mv64xxx-i2c  Z disabledserial@12000!!marvell,armada-38x-uartns16550a  Z okaydefaultserial@12100!!marvell,armada-38x-uartns16550a! Z okaydefault pinctrl@18000 !marvell,mv88f6820-pinctrl ge-rgmii-pins-0Dmpp6mpp7mpp8mpp9mpp10mpp11mpp12mpp13mpp14mpp15mpp16mpp17ge0 ge-rgmii-pins-1Hmpp21mpp27mpp28mpp29mpp30mpp31mpp32mpp37mpp38mpp39mpp40mpp41ge1i2c-pins-0 mpp2mpp3i2c0mdio-pins mpp4mpp5geref-clk-pins-0mpp45refref-clk-pins-1mpp46refspi-pins-0mpp22mpp23mpp24mpp25spi0spi-pins-1mpp56mpp57mpp58mpp59spi1nand-pinsNmpp22mpp34mpp23mpp33mpp38mpp28mpp40mpp42mpp35mpp36mpp25mpp30mpp32devnand-rbmpp41nanduart-pins-0 mpp0mpp1ua0uart-pins-1 mpp19mpp20ua1 sdhci-pins<mpp48mpp49mpp50mpp52mpp53mpp54mpp55mpp57mpp58mpp59sd0sata-pins-0mpp20sata0sata-pins-1mpp19sata1sata-pins-2mpp47sata2sata-pins-3mpp44sata3pcawan-pinsmpp46gpioswint-pinsmpp45gpiospi0cs0-pinsmpp25spi0spi0cs2-pinsmpp26spi0gpio@18100+!marvell,armada-370-gpiomarvell,orion-gpio@ gpiopwm) 0 <ve0Z5678gpio@18140+!marvell,armada-370-gpiomarvell,orion-gpio@@ gpiopwm)0 <ve0Z:;<=system-controller@18200M!marvell,armada-380-system-controllermarvell,armada-370-xp-system-controllerGclock-gating-control@18220 !marvell,armada-380-gating-clock T phy@18300!marvell,armada-380-comphy comphyconf`phy@0aphy@1aphy@2aphy@3aphy@4aphy@5amvebu-sar@18600!marvell,armada-380-core-clockTmbus-controller@20000!marvell,mbus-controller Pinterrupt-controller@20a00 !marvell,mpic pXevl Ztimer@203001!marvell,armada-380-timermarvell,armada-xp-timer0@0Pu      {nbclkfixedwatchdog@20300!marvell,armada-380-wdt4`   {nbclkfixed u@ cpurst@20800!marvell,armada-370-cpu-resetmpcore-soc-ctrl@20d20#!marvell,armada-380-mpcore-soc-ctrl lcoherency-fabric@21010$!marvell,armada-380-coherency-fabricpmsu@22000!marvell,armada-380-pmsu ethernet@70000!marvell,armada-370-neta@u &Hokaydefault rgmiifixed-linkethernet@30000!marvell,armada-370-neta@u  okaydefaultrgmiifixed-linkethernet@34000!marvell,armada-370-neta@@u  okaysgmiiusb@58000!marvell,orion-ehci Z okayxor@60800)!marvell,armada-380-xormarvell,orion-xor  okayxor00 Zxor01 Zxor@60900)!marvell,armada-380-xormarvell,orion-xor   okayxor10 ZAxor11 ZBmdio@72004!marvell,orion-mdio  defaultokayethernet-phy@1!ethernet-phy-ieee802.3-c22 Iswitch@10default!marvell,mv88e6085&Z portsports@01lan0ports@11lan1ports@21lan2ports@31lan3ports@41lan4ports@51cpu7 rgmii-idfixed-linkcrypto@90000!marvell,armada-38x-crypto regsZ    {cesa0cesa1cesaz0cesaz1@Urtc@a3800!marvell,armada-380-rtc 8   rtcrtc-soc Zsata@a8000!marvell,armada-380-ahci  Z okaybm@c8000!marvell,armada-380-neta-bm  nokaysata@e0000!marvell,armada-380-ahci  Z  disabledclock@e4250!!marvell,armada-380-corediv-clockBP T{nandthermal@e8078!marvell,armada380-thermal@x@pokaynand-controller@d0000"!marvell,armada370-nand-controller T ZT disabledsdhci@d8000!marvell,armada-380-sdhcisdhcimbusconf-sdio3  T Z okaydefaultusb3@f0000!marvell,armada-380-xhci@@@ Z okayusb3@f8000!marvell,armada-380-xhci@@ Z okaysa-sram0 !mmio-sram   sa-sram1 !mmio-sram   bm-bppi !mmio-sram   okayspi@10600)!marvell,armada-380-spimarvell,orion-spi P Zokaydefaultflash@0!!spansion,s25fl164kjedec,spi-norbZpartitions!fixed-partitionspartition@01U-Bootpartition@100000p1Rescue systempartition@f0000 1u-boot-envspi@10680)!marvell,armada-380-spimarvell,orion-spi P Z? disabledpcie!marvell,armada-370-pcieokaypciPȂ  @@  pcie@1,0pci #intxue@Ȃ3`FTf  xokay'interrupt-controllervepcie@2,0pci #intxu!e@Ȃ3`F    Tf  xokay'interrupt-controllerve pcie@3,0pci@ #intxuFe@Ȃ3`F!!!!Tf  xokay'interrupt-controllerve!pcie@4,0pci  #intxuGe@Ȃ3`F""""Tf  x disabledinterrupt-controllerve"clocksmainpll !fixed-clockT;oscillator !fixed-clockT}x@ cpusmarvell,armada-380-smpcpu@0cpu!arm,cortex-a9cpu@1cpu!arm,cortex-a9chosen /soc/internal-regs/serial@12000memorymemory@sfp!sff,sfp# $ $ $ $  $  disabled #address-cells#size-cellsmodelcompatiblegpio0gpio1serial0serial1ethernet0ethernet1ethernet2i2c0i2c1spi0interrupts-extendedcontrollerinterrupt-parentpcie-mem-aperturepcie-io-aperturerangesbootph-allregclocksstatuscache-unifiedcache-levelarm,double-linefill-incrarm,double-linefill-wraparm,double-linefillprefetch-datainterrupts#interrupt-cellsinterrupt-controllerphandlepinctrl-namespinctrl-0gpio-controller#gpio-cellscolorfunctionfunction-enumeratorreg-shiftreg-io-widthmarvell,pinsmarvell,functionreg-namesngpiosgpio-ranges#pwm-cells#reset-cells#clock-cells#phy-cellsmsi-controllerclock-namestx-csum-limitphy-modebuffer-managerbm,pool-longbm,pool-shortspeedfull-duplexphy-handlephyssfpdmacap,memcpydmacap,xordmacap,memsetmarvell,reg-initdsa,memberlabelethernetmarvell,crypto-sramsmarvell,crypto-sram-sizeinternal-memclock-output-namesmrvl,clk-delay-cyclesbus-widthno-1-8-vnon-removableno-memory-wccell-indexspi-max-frequencydevice_typemsi-parentbus-rangeassigned-addressesinterrupt-namesinterrupt-map-maskinterrupt-mapmarvell,pcie-portmarvell,pcie-laneresetsslot-power-limit-milliwattclock-frequencyenable-methodstdout-pathi2c-bustx-fault-gpiostx-disable-gpiosrate-select0-gpioslos-gpiosmod-def0-gpiosmaximum-power-milliwatt57