ELF@h@8@h h    =AB8? lTTT> @_ <!{@@D?A;8D,@ 4T8D,@4T___֠AB8? lTTT__{&R{_;_? ;@F_{[`RK6S 0c*"#SA[BcC#@{Ũ_q4`VTs@˟s˵{ S@A@!@AA@C@B@!? TC@A@)B@a LR^J @{¨_{CRcKSc  [@qTD+Ks0*d Ӛ qAT@x#cT@SA[B{è_fRK{  0k99#ƚ$ƚ: }S[*c+SA[BcCkD+@{ƨ_ֿqT`YTt`qAT@{s"@raT@4@딒{s˄t qT*CB8c SqT<^c4E@ @BҟTҟT ҟTҟT ҟ◟Ҁ҄q@cc`FA$_B Ң҂DbB{gR)SK j0*)!Ү@S@凟K  0&ǚ }sk`Ts@a? qTstqaT|Ɯ&ƚ }skT e@ TqT *b@ @ q`T-K { ~_@eSA {è_{cd@凟4E@ @{¨4_@S*{SA@a@@-J5ҷ6E' ASA@{Ĩ_3@@ is㇟D@s{SS@T@SB@A@C@!!AA@AA@ASTSA{¨_{@@@GB8H@ S?qaT @ ?@B8 SqT82AB8! S?qT?{_qT @  qT @ NBqaT<>?qaT{ {*{{{@B8 SqT8Հ7@@@@B8 Sq!T82AB8! S?q!T?{_qaT<>qaT<>?qaT@B8 Sq!T8`6{AB8! S?qT?R{qaT<>?qaT_@B8 SqT8S_qaT<>{S[cA@D.I@@Wt~@@[BacCSA{ĨqAT6R*R@B8 SqaT8AB8! S?qAT?_qaT<>?qaT@B8 SqT80 S_qaT<>{q{U{@B8 SqaT82AB8! S?qaT?{_qaT<>?qaT  ?9@Ӑ\C`0ClMBeZ Ś š)a6IvI~TT_?*9KiXkP8^T L%̚ @ KT T՟??_ _#;cLPӂB ÚC# ~ T?_#;cLPӂB ÚC# vT?_q?__DB8՟ lTTT><8աADB8՟ lTTT?DB8՟ lTTT   ?DB8՟ lTTT?`_{@skc[SKC;3+#              { KB8!lTT+TR>"@>@>R<"@<@<R8"@8@8 _        { KB8!lTTT"@"@"@                 { #+3;CKS[cks{           {                            {c                            {Cz                            {#g`IB8?!lTT+T՟?? ՟??՟??_FB8 T@T+T@T%_FզXA>տTXX@$@֦XզX@$@00_{@@@@@#@'@{_@ @@?AT_@ @@?AT_O`@bAdBfCh&Dj.El6Fn>GpFH@`bdfh&j.l6n>pFO_X|aa Io@J@|RR@@@X7IN@ @:@`XXTA:@Mp { ! @TX !BB*, ,?TBBc @D@!|@? T _TAB8? TTT>><86``6u?AP{¨_{CRA@"<@ "@@"HC{è___{ pr`@C4.F/ @{¨_{S4q/!!0JRR 5B4`C9`C9q!T@@dv@b@4@dv@%`@SA{¨_{Sr4@aT*@6SA*@{è_rT*{ @!t0qT`@40~ @{¨t@@{S[ 8@ HRr?k T1k~ RSA[B{è_a @vA1_~~7a@a6sS@ssksR`@A@3<@R_{@@4@L2 A@|2 AF@2 AJ@2 {RA@2)JAJ@RAF_B6@)?R__R_{S[A@A6c@`@AN@BN@|3b Ja@b@4uf4RJ* BIzqTTДIw@е^3~s4IzsqsIAT[BSA@{ĨI{ 4a @I5zE{ 6a @I5mE{ 6a @I5`E{ X7a @I5SE{ @8Ia @!|S$6@B8B`TT@Iv57E`88I`<{ H6a @Ib5#E{ 6a @rIU5E{ 7a @eIH5 E8{c}}<R{_{ `RB@A:@!A:A:@!pA:A:@A @{¨_{6{ @?x? _ҀH@?PR@Rܡrr _@!5_{@Cz@{Ҩ_A@?<A>@?A@T@>@ @R_"@#A@#DA>@C@ `HC@>@{@@_T@"4@_HT 4@C__{9 ٚ6 @{¨6`>@>@R @{¨_֌6`4R_{ R*sR۞`4`R2 @R{è_{P9`6!RC"RR*49HR  @c#RR4 :H{¨_c@9ac#R c9 @R4: @c#RAR5c@9c#RARt2c9 @5$FC{P9 p6`B@5!R"Ry*49eHR @{è_@#RARe4 :XH@9#RAR29@4:$C R`R_@@ 8R_{R{__c`AT_`0ET_RbEHT{@;#H {__{Ss c`[R 4<|a OФХR4<<4 RSA[B@{Ĩ_a PA`@" 44=G @5{|@{_{CS[*cks@>A*>6s RA Jp`:@ J Ҡ= R`>X6@`6H6@cC  @f  *qTq@ T=GA G3RD>G@ऀRz:A êr?kT{[ 5(N 4 ?}{c 5oGx?s{v@9?XqT?qT?cGz@9qThTq`TqT`f@Z`j 8qТc B S Ҡ AW `&) qTq`T@  CcR RR7O@uK@a*`j!z@9`9~@9`9r@9`9@Z`b@Z`nv@9`9`C9 qXzTcaRB@ qB:@T  `.@aj@B$4{g`.@aj@B 4`.@aj@B(`4h`.@aj@B,j4`.@`b`.@aj@B`4`&@@ `@Z`v`C98qTaf@an`v@`vu^V6@ IGc @eC98qT҄$Ś6dC9pqHTc$Ě6ҍ*5V6C9|@C9K;Ln@:qA T9 4O@!!l?!<@?@v#**RG@*45*Q 1Tg@ITyFvFa@$7XQ1T1ATD hF/`2@@`.@aj@B@6`4bL_xE*OF"!j`z!z!5_Rᗟ?jT;@G@?"T&@`@9qTt;z3R\4zr@zt>s{S4@m 7j@ ;mSAR{¨_a@v@`2@@?{[rS*c#@mR>T6@6 E[BcC*SA#@{ƨrjv8qAT6_8qTҗE@9@6HEqAT@aP/tcaM 5`@`@RBqB:Tl@v@k>%R !U 6l!2D RSA[BcC#@{ƨ_Cav@b@HDxO8xRq T{S[7@&@! DSA R[B@{Ũ_@x@9qTҀ2@qTpls#!қ'@@sxu>2@k T{@2@Rv@zD@@B?R_qT{S @$@A! `DSA R{Ĩ_t@!t,D`@@S*@4BRRGS4R_qT{S5@&@`! 6DSA R@{è_Bl ҶDa2@a4b@CRv@$ D`?p/lM=R___{S**?ր@C9qTqZSA@{è_R!1 `_@"@9_qDJzAT_!@B@ C {S[ @9q!T`b@969Z=W=iTs,C{@*SA[B@ _a@@<<CC!tCd@#C?*6*#RlaRBTRv3R'@{SkRD7@SA@{Ĩ_ { @|y`@zy`@xy`@vy`@ty`@ry`"@py`&@ny`*@ly @{¨hy{BS[!c*@@95y``c`@aTh68 R` SA[BcC{Ĩ__qT|@#hc8/7_kTja84D|@dhd8d6BB!9{[RS@` R$@8*q$q`*5G4qT@#@8*q(q jTF6@ @9(qAT !@SA[B{Ĩ_ր5@R` _qTRBRB #RR|j``@;<54 @` {BRS@;@qTa@!KBSA@{Ĩ_@{BRS[@;@qT@!KBSA[B{Ĩ_@BRNCx*{  k@RCq @{¨_ { ?PTp}B` @{è_sJ*`\*L4@9@9@9!@9@9@9=B R C%т{CSR? [cks ks9s#L<^ R`^`b@4`f@7j`@RCYCpj;R*|}R{ASB[CcDkEsFC%_a@a@!B R?@26a@h&jy@;`@; ~@xBd@BBT+Aa@a x@ `Z@6jjii! #A`Z@@6!L ;#O@69`Z@t@@AT CR;tI;#F;C;a@Ta 9;#6;3;pA&`@;5?@C6a@ABAC:iBh2A|@lTw]Cҵ:#C:C:RCC'YCpDiCgA`;Cwia"@A`@:5wsR{@fi0@{@R0*R 4?@@@@h"@(`&@`dHiCi l/?iv&P4v`&@:4a&@ _8x"?q`&@:: :G:G@! ! ::@  ~@w@x۸c&@BG@G@GC*v6`"@a@87a&@@hSRkqTh@l P4{j?@@0{ 7@h38 R @{è_{S[c#*9@c6@*!K@[B*SAcC#@{ƨ_/@*6hy@SA*#@cC[B{ƨ{S[cks7@qT*97@"R0@HqT [`xa RK@[B*SAcCkDsE{˨_:R97@*@8q TPqTqT[ bB~B*@7-B7@<!K@b\*7@ҢvR :A#4`67@!K@@@{#A @7@C"R@TqT`K`8a 7@"R@q`T0qT@@@@9sAC7@<!K?A*`7@@j9@ @@A! *:a9@9A*@@@@!D :`R93@|@4v3@@B|@38@@3@h"86M@@ A*@#@@A@'@A#@+@@ACA R@cAc R@k7*?@@@wu36!8 B~BLr*6d7@d !K93RC {S [88T!8?`{@SA[B@C _#!!?#{{S@)u`@'uB@T@SA{èuћ@{SuR9c$Rc 6@SA{è_{S,[cks C)AR$ `@}r !f[B`7"R7_T(">vq*rqT?@Z4s@@T`^a`5Qs@7@[\> rq T[BSAcCkDsE{Ȩgra@`@7q`@7@4Z@*Tqq@T1!Ta@"> 1TSA[BcCkDsE{Ȩ_{S[cR#h8wZu yb9x97HT8``@h!8RSA[BcC#@{Ũ_`R7!``@It{SU* "5> RSA@{è_u6 R`8R{ f8RR'1a@ @!Zk{ƨ_{#R Rb@BZv1a@ @!Zk{¨_xab5_!{T~Ӈhe!ZaT{_ց@@!Z! !t~B?T{Ssb`@qTaBB)85`@SA{¨_sb_@b6__kT`{*@@{_!&!H&!&{[;@S*c*#*/5&!&!'=!{=qTT4qT*x'q=SA[BcC#@{Ǩ_('f=q TqT/@7u'T/@_@3HT#Rc*S%1T/@!/@77@//@7&`!(v{RSZ<T([c=(=`r@9l`v@9o`z@9r`~@9(=,)=`@Z}b@p)BZ<b@)BZ<`z@9x?q!TV** *<TSA[BcC{Ũ_#*<K@O`z@9qT#@<qT[BcC*bA)SA!Z{ŨBZB@Q!Q<{S`@`6`@55`@SA{¨_sb!(Р! !,!$(!P-@_xraT{ ={ xR_R_{< d{RR={_{d S}dSAR{¨D=S2@T>@A6@b_iTT6@< ld R5=s`SA{¨_{ \d{R$={?@T6_{SzE M`5zEd5Ҳ<@SA@{Ĩ_{cC{¨_@ᤀR!êr_k T{q{xS_ R_(@_{CS[c*!!P4R5@5/@a3@ (@ $@ @9qAT!@;`@c!`*@?tb.@!,5? 1TR`2@x.@`55E<??@*qTq T AR"5@ 5<3?@/xE@61`TX?@ ;s:A?@ऀR êr@?kTo Hi5(\4 ?oq5x?or@9?qaTv@9kT?qTXqTz@9? qT g;/@Z3n?@cReR 7?@a:;@a>`[Qo{ASB[CcD_{S[cIcҽ;4Tc0&oSA[BcC{Ĩ_T0R0D@;@#x?o:{CS[cks(@@R{ASB[CcDkEsF_֓.@q!TR!EB4 @*Ҧ O C#R*cGRR 7O@#7*V`7B@4ZB9Z|Hv@4;aT@kT@;@@?B: R{S@a@a5@a@7SA{è_{* *}:*! @!{¨,{S[c#b*OqTqTPgn a@ऀR êr?k`T]n RSA[BcC#@{ƨ_(5d455`z@9qTbB@`AZ5D@5 RE 475@9`4` *6T:V *`6!*`6PRB  * 6@9@4]*6B#*R 544*f 5cC*4}E*T|@*"!ҟ!TAT?TB __'xfZ&xdZ€xccZ{S*R[c *R tSvS!|@|@&&k,TqSA[B|cC{Ĩ_֧}zejg q!T! a9#<Sc9#\Sc 9#|Sc9#`c9#hc9#p!xc9a9{edkgqT! aj"8#<S9#\S9#|S 9#`Ӄ9#hӃ9#p!xӃ99sZaZaj"{*[STvSR~@@3qsmT` ZtRSA[B@{Ĩ_az`!Z4{S[*b s*B@Z`SA[B{è_ R{S[*ck+37**o@Q? qTs@?qlT*!X1H8SA[BcCkD+@{ɨ_tSR|@2* *`6o@!Q?1 TbD@BZ@*w@Q qT{@qT*M)*`@5 D@Z{Q1aTvSRB|@2*S5* )J  k l}~ kT*** TJ K) vS!;B|@2{S[c***`7x4*cC[B*SA{Ĩ *  R[B*SAcC{Ĩ_{S[*1T* * 6!5L8[B*SA{è_{S6*;8K`R*SA{¨_ֵ1RB<T *@6t{S[c?TR[B*SAcC{ƨ_RB*@7*RkTC#*'@!T**@6*7R% qB\ATc*R/ *6*i*7 Zc*R[*7 ZR[R/*cBd* 6J7p_{S6*9\7RB;*71*Bp*6*7@*SA{è_21*B*6R{S@4SA{¨`7SA{¨_{S[*c#q T*R!1DL7[B*SAcC#@{ɨ_* 6!187C R*79*RS*6*7kTzdzd@4Cui**C4* 6R{#RCc{¨_{[J Sckl 7cn Rd*!*Rk!TA 7ҡ7@6057@)05! /^H7 k883@`@9@4s9?aT*RB <*B %R4s*7@71T4! h6RSA[BcCkD{Ȩ_{S*[A*RkkTR *@!T*K#R R"@s @BZ.Z s s sNsK` Z5*SA[B{Ĩ_ֵ*6R_c !={S@S@w:@C#`5c#5b5''@qTq` T+h R`2@`w.@xE'@X(4'@ ?h5,)R5)x?h`z@9 qT)`~@94@*wp4*sbA) ZWT''@,4`@Z@ZBZbAT*`. 5'@Cc7'@aF`E'aJ'@8+]47@`@Z?T. R_{S[@6,/E4*1@446/<640*@-%R B0!2 Q*`54b@BZ(R*7|@)SA*[B{è_{S/@C|T_ q TDT13SA{è_xe!Z$Rd{AaRS[N-T]4s RSA[B{è_R{AARS[1-T@4s RSA[B{è_R{ B2`Z @{è_{S!7*SA{¨SA{¨_{ B}Ra9 @{è_R{ BjRa9 @{è_R{ BT,WRa9 @{è_R{ B+D`9R @{è_{ B(-3  @{è_֤7`RB8$B( {SBL2/RaSA{è_{ B`2@Z`R @{¨_ { B2@Z`R @{¨_ { B2@Z`R @{¨_ {S*[4*5`@;@Z t ;*5;s?SA[B{Ĩ_[B*SA{Ĩ{ "Bt`Z @{è_{SBP/@RaSA{è_R{[S*2c2c*443SA[BcC{ƨs2/@po2*B3c*bB\<\23X27T2*B3H4G23C**`4<244+@hs8s32O@k,TҔF{[S*w~-+~+`5c4@[B*SA{Ĩ4+k+5c5SA[B@{Ĩ_{S#[*9F*(51441*A9*@t51*A951C**$61 441p61 441q"qT%$՚6*8A961 QqAzT * A971vqHT$՚@6c*a*l71w441Q qT*T*$8x1U44t1'@o17@8j1S@/@8b1"qaTc*.5/@7U1*G*7G@qlTSA[B@{Ǩ_3@8B1qT**{RSДZ<[cks*p8&144"1е*@6SA[BcC8kDsE{Ȩ1;@ 1f9k*R7k@q,T!9~*7B#*90*o:**?/RSA[BcCkD+@{Ш_;@/B\?* @?qT@4?/?c*v**`5z*y4s=M)_kTsb>?@B|@)4s>s~= R{S*C*5B*Bf@SA{èk*2!\/SAR{è_{[еS68G/RSA[B@{Ũ_*lq*n4R@gJ[@4*@4@ qATp3-&@[@qATc@!_Z q`T)T?T3-`-*9[@5B9H4 QqĊNzT'!TCcC@@[[@**CYC@ 4,[_@9"qT`4 `T&qTB94\ `c@[@g@[xz?@WC{CS[6,@!9i7#*gRFRRs{ASB[CC_C{CS[ck*3? @@;@ 3&aR%@8`BT?#*'RF RR>*7?@*B*AzT c,xC@wG@u;@t?@^b{A*SB[CcDkE3@C_ҹy*{S_qmT*`@, .,Y`Q #,@*SA{è_{ *)T* @{¨Xg{  ,qTq T l`a@ऀR êr?kT_ R @{¨_5 ?_5|x?_R_4v5l_qTxE{S3*[R*zssA,qk TSA*[B@{Ĩ_{S[UQv q T`@*),@@9?qT (`6`@"R!+jg @T7`䃹LT(+SA[B{Ȩ_Ҕ Qt4` @#qT`@' q`T`@+ sB*c97s?qu4`@#qT` @' q`T`@+s?{SS6xED+"RRSA{è_R*ᶍ`6a۶m*C|Yg{_qmT`@&@{RRcw+R{Ψ_{S*[c**dv q TlTqI T`@!!"]$`5` @҆+`@҂+`@~+@!*@#*v5'@xB B!*qT`@b!?3$5` @U+**v@5$ * `@b!$ $ 5*vRSA[BcC{Ũ_`@b!?$`5@*v 44* R`@!=$`4*pv4*`@!=# 5` @+**|v4* }*`@!$#5` @*`@*`@*@"d*@#* v5'@wB B"y{S_qT@<#C*B@hSA{Ĩ_zE`@o5`@zEL 5`@ҷ*R,$%*Rl$*C { 8@$`B@$a>@%aB@,%`J@!$aF@%aJ@,%a@L%a@x%a @%A@%)A:@(&AN@P&!x&R&)1* 4*!&)*@\*4*94&)3 5<')Q')Af@'Aj@ (An@@(Af@A@Bf@wbEd()@@&5@(q#A9(m+A9(i'A9:eO@)aI{@R @C _! "'{)@@Z_qT{SSQ[BR*`@v !3Ce` @**[BSA{èSA[B{è___ qaT{R`@S)` @Rң)**x**)?)SAR{¨__{cx C)D)x*+@/)R{è_{CSTQ[t4`@3qT` @7 q`T`@; R9|.C@!RG<3@ xEA2*qTR.~QR.xQ@T$/\ R{ASB[C_v)A2@T@6@T0Gc|*CR;@5/@#C#RZ5'@@T+@ C(D#Dv  *DFxE5`СRyR{ wqT*7 <s(* @{¨_ֳ{S_qMTt@!<!*@5v11Rx}@@*SA{Ĩ_y@t(@@A6*6:k(s}f(Ww*43R1\(@q{!3 !4A!!4!h&!qZ @{¨_@R R{_qT_qT{_`@qTqT5R! qB3!A3({_qT_qT{_`@qTqT5RNEqB3!A84'{S[Vֺckb08[г@TSAR[BcCkD{Ũ_`Y#;za!@8'ktT`ht8'"bTs@R_**# QR5nd{S_qT`@*!9!`5 qTs"!R`@zSAR{¨_RR!R{S*[99cRRqT**3`@@9?q!T 4`@ 4a@9t'SAR[BcC{Ĩ_7RQs"8R{R{_{R{_{_R{_@Qq T_SA[B{è_{S**[`@!5Rc@bQ_kLT@qT!!T"[B*SA{èR{S*[_qT`@!<;{ 46R~@R`4RL[zss[ Rk Tv4@RC[SAR[B{è_RS{S[UQv RqT`@@9?qT@9qq*!4v@Uq T@#Rw'X1`TQ"O*S6 ['@sSs**w3*(6PG qaTZ>N>&SA R[B@{̨_`@*%' q!T`@!=5`R4qMT$=&'pN ?N *DN3"!hB&s |N!37&v s~@oN lN Z!'& aN3!&s VN3! &s $KN3!H&s d@N ;  &'4y' &7ZR?֠8 Z`R?&!%!%3'uY_qmT{BR`@=&! K{_!R K_DR|UDRUDR4VDRbV$RtU$RU$R,V{S_q,T%RSA@{̨_$R`@j*7@@o 4a@**`% Rq!"_8"5 ?T R_BC@9?@T4hc8c c5R5@_T{S* [c#M &4*@4 R wYkLTSA[BcC#@{ŨnYqmThYfY `~@@aTbT[B*cCSA#@ {ŨF%R !B%uWQk+TSA[BcC#@{Ũ0%kzsҖ !!Zs)%TWxQ8!%kT.ju8kҖ@!%{ \!%` @!{¨L{S[ck+_qlT>`@*B!U* 5 QsBRR4`@@9?q@Tl%;545<?q T?qT5R@8A5Qs"8R4@f@;4R`Es 44;@!!"$[B*SAcCkD+@{ʨ_!L!!}55`!L;@Afq`T`@"%;@"@BZ_kTU5*"$*SqR?jTt#$`@B!#5q T` @t$b,"4`@$qTE@Z*E+4t#[$`@$EB@BZ_kT#N$<RuE$KX|`@B!|&5qTaRAE*6&E@6 '`@B!!5*5q TabAE*7EqTkEck@c`*:`6 )*k@?qT'#7tb"|@`@k;zQ@9?qT;;@a@9?qTkT(59@yR6$a@9?qTZk@k;@lT0(o;@;;;@@9?q`T?lqTsR;;@@9tqT;;@@9?q`T59@y;k Taja8jT;@@9?tq`T'$8k@ks;@;@k@ k`zy9;kLTq`@@9?qTkq Tx @qT@9qATwAEy@*7@9qTqTqATE**E*s*@9qT`@#*s@kT_k@9sqaTk!TE* KE** 6@9qTa!|@(K)3#lE*'` k@! 7@9q T5A!qT`@BRw#*k@D4*p5qT@BZ!)"qTsQ kT5R@T7 kTsRq,T5ҿklTjss""*qTJqT!|@k@`h*p?q R$BzT?kR q Tx @qTt@E?*7E4*s@`5`%"`G;qT+"s@a4"MRE** q ThTqTq@TRk+T+q T$q@TE*KkT @9@4R!K:!*m"~qT*4B"Bx"QkjTk@R!K:!`+T"4k@1aTE*RdEa @!Za@ Zsq+TTk TR!K:!x+5"kTR!K:!+*"s@a4`2+#"R!K:!+"B!||5a @E*`7Eq-Tb@K68,6,`@@9?q! TEqT` @@9qTu:Ҡzta@J4*AT!t`@!Z @@ -!Z!E Z@H-BZ*!E@-!Z!E @-!Z!E@X.!Z!*.!E@.!Z!q TE@H/!Z!@RkTE @/!Z!BqTE$@0!Z!E^*\0!b!0@5qT` @"ZE A`@aB!`5qT` @R`"`@R["E{qП`@Bҡ!:*` 5` @@9qTEֲ1$*0`!X]!k*TE**641F***`B`F!qT`@R "`@R"E`62qT`@Ҷ!*E62`@b!$% 5 qDzaTq!T` @ҟ!`@қ!sѠE\E`@B!pf5 qT` @҄!*EnR7+RPRPR{QRIQRQQQ{S*[**7`@7`7?q`T66@RU`@x`0 `@x`* R*@5 SA[B@{ɨ_?1@T: {S[ck_qTx@*_qTB5` @!X5sb5RqTt@B* 5S@9qc@R w*Zg/@SA*cC[BkD{ƨ_RS4@**h cw*S@q"2!2!SS W@A4@*|@f5@9!4 *C/@$R`S@`72SR"W@kT/@*CsRN4@9q TTqTqTqTuRc*4 *^*[B*SAcCkD{ƨ_5RURR[@!8_q*P:T[@\[@55[@*[@*@1T` qTqT*@1hTq[@*R3R.4[@x*@1 TB1T3RkTX[@RB1 T[@M4RB1TsBR$_qT{SSQ[R*`@v !`;|[` @**[BSA{èSA[B{è__a!E!{S@{_R_{S[*@5@qT*ۄ*oqSA[B{Ĩ_ր@*<a**4* R{c5@]40K R{¨_{S*5@*"RSA{èSA{è_{S[* 5* qT@R*R'SqTzaT@*R@5s*q!T@RDSqSA[B{Ĩ_ R{ _qTm5@@0R`@|*|*Ru*@4*q @{è_`@{ @@P`@6a@|sMp@ @{è_p@@)"@@Gp{ _qTRr5@@sb@ab@?TR @{è_s.@`@"*Rt*4*L R@{S_qMT`@*1* 4*!3Ro q`T @*@*@4*@*`7L3[@*SA{Ĩ_{S_qmT`@** 4*!3R> q`T @@7`4*@`57@L3)@*SA{Ĩ_ha8_qT@9Q_ւ4!? T{@S8K@s\4K[c?Kk B_qLTSA*[BcCkDsE{ʨ_7`@** @{* @* q TqT@p*#*q*d A:TG@*w*4!6R*(;@?G@?CqCR5**ʁ*`4*;@*ҹkHTT`T<&`xRR_qT{S[VcXwkEEA7`@*RT*`7@@ A!E? qT@ @Ry~@ *:* RSA[BcCkD{Ũ__ R{_q ST`@`aE2O @R{¨__q-Te DQ*RP_@ QqhT{`@[*SҠ@qT@Ҵ 3%ݗҠջBRB5T@T3SAR[B{è_ң*@`F`j58__q T{RS`@T*7@| @xT"qaT`@qaT`@ qaT`@y`@9"qT#@BqT#D@B qT`T"@8#$@xB_SA R@{è_C{CS[#_q T`@*S* 7Q?qhT@@*XaW@+E @&E@ e~@ATRе>4qT!@D@TT**P43Ry5t{A*SB[C#@C_"qT!@D@ qTD@y!@yD@9!@9B3R{S[*ckZs[SEtE7@@RjS* 7@A!EийC957qTa@51"qTa@5*Е~@H<0@4q`5!Tu9qT4K~@s qTa@ya@9R7@B*B5SuSA[BcCkDsE{Ǩ_֟qTaV4"qaTa qaTaya9 R_qT R__qTR_@ QqHT{R`@S[*R*qT@XAR!E @qT@K~@!TRSA[B@{Ĩ_ qT5!"qaT5 qaT5y59_ R_qAT{*`@S[cR|@s7@W @E@E@5H RSA[BcC{Ĩ_b~R_{S@9"@9_qT `9SA{è_{S4<@y@y?kT(Q`@ya @yb@* SAd{¨GDD{S[cks_qT@*p99@0@99@Kk9@Ko9@Ks9@Kw9@KOy@K7`@@99 T`@@99 q`T` @okqT`@wsqT`@ҐOyqAT>oB9k~qIT!"B_ 4[B*SAcCkDsE{̨_R`@q<9B9q!T q`TkB9*з*rkTR:RR{*9:5@*{B9B9cj:**U:q*:qc@!****<ssq TkB9{*@{R3sB9k"TAB9 09!0B9 9AkB9 A@ sB9 AwB9 AOAy @k@ **Oy943R**XuwB9_kTkT_kTikaT_kT**^3@OAy[*qTkB9֒RsB9kT**|943R**CwB9OAyk"TqTkB99RsB9kT**SyD94D$3R* *wB9kBTSAy*k@k@c OAy *c*c<Sy:9`4!@Bf 5sB9_+qTwB9c(qT3RLkB9 RRo CkT*X*84**3Ro9 c@7kTo@5WBp ?@9c@_k@y @zCTK@6`x*?@*;"@yT;@#T@*G@y@y!  C@!<G@@y@y5q!TR F6MqT@q ?ТRd R;@{Х  qT*GG@@ !@y*_@! n*B ?qT 5*@_qT_qС$!x!?qT*!!"Bҳ 5 qaT8s` @ 8p{SR@?TSA@{Ĩ_ @9qaT !@94R`R@@9`5b_qm!T{[Sc**ks@@9@L@L@L@ L@L@L@8Xy7x6@p9@z T@@9qaT @7L@@)  @aqT@ qA T0(E RSA[BcCkDsE{ͨ_RQq`TqTqTx Q*R<qTxRM ` Wk<8o5j 5QqT QqhT @qaT6@scY5qaT-7R9R)7@L@)3( @scA5;@c@xxk@_k-T5g"@*@**?5***(@5o@kTZ@*@** @g@)V`B@?)Ck T?@*xxh)Gc@);k@kTd@*@*?y5***6),3@@*@*@7;@*@C@*B<o@k-Tg@_ֳuB6@c@k@g@ooS)qTqT@`B;k T@c@09@ @ @ @k@ @g@ @o@ @ M{S*p  qT`@c}|R`@E Ҁ RER@9c4aT5X #TRSA@{è_cQf$qTc|!nE5 {  R{[*Sa*c!@bRuL@sQkkTqT @?TxD6 qT@**SA[BcC{Ĩ֠3D RSA[BcC{Ĩ_R{S_qT`@uDς`D3RP4[@*SA{è_**q!  4!4J5q {S?!P4 `5z{`5zB9~B9c2\S@ vB9B C9B|vC9B|`@BTSBKbj`b@!IAKa T{@SA@ _bh`4a@!Kғ`{@RR{_ {S[ck+@@D5aA9t5b @ab@5"6!\HaA9bf@5ED95RC`^@4Ҷ*7 4uA9*{`{t*;`{tq!!!aA9!(!697CTz*@5ԺB9е&:*!q@Tq`T5h:~S4{@SA[BcCkD+@ _!g?>R`@z@{*4X`@"/5#@!w@!!@a6?rЂBh&*Bl?As"qT*z*5 qT?;Bt~};@jt*`5s"RK%@<3?k T}a@,a@-a@4|-a"@-a^@4P.aZ@.a6@0/b@a@c@"!R`B@|++T,,D,R~@Qq T_SA[B{è_{S**[a`@!RzD@bQ_kLT@qT!!T"[B*SA{èR_qmT{`@S@hT@`0y^}RSA@{è_a@0:1k`@ Tz~4a`@_ R{S[ 71T<SA[B{è_ր@T1sR{S[c#5g@d3)b@_T3+<RSA[BcC#@{Ũ_**@5?q`T@@7@l2`@@T2<@3{S*s@t.F?k@T@*04$ ;.RSA{¨_@{S[c_ qTlT_qT_qTSA[BcC{Ũ__q!T`@OAKh4/Ҵ4;`@;h4/`@1 @+ *4 R@R!d54!5`4!545~@6x@@#'46RqTqT,75a@!Z!@#'o5:q!Tf`476M;a@!Z@xl{R R4.anB?qT7(a@b@8B| S"a@`8a@8a@9a^@t9aZ@9aB8: aVB:aZB:a@T;.a@;.a@ @;{¨. @{¨_ѠD<{CS[*c*k s .a!,FqlT R2@5!h -5@R;R! " 4R{E*SF[GcHkIsJ_! 5 q!T@R:@`4`<: @4@$\<:4R!`5@<<`@kT|4k@q=k@a@!ҡ!`{S= 5 qTRRT* @9  4;!=4!=*`4!=*5R kT=Mg@ }cC3KFR5@K`5@R8k@o@@5 4 R*q !!`q[4ҁ! y*5 q T @Җ|@ !D#kc*a@ v4F5`?4R,9R3 @h=Nq @=Hqx@RR@R6R R>9:5:a@8?4R,9;`@RK_`@`@@R{* 64R;85\9u@r}Tg@9s"f_8e_8d_8c_8b_8a_8`_8`@9wl| T>@9Bb_8R_8B_82_8"_8_8_8C_8;_83_8+_8#_8_8_8 r_8nֆ"5 qT @q!$*!=RR@ !0# 5!hf@*@cC3ER5@C`5@qT@w@7@l2*!$ҋ4!}*`5B qTr9@Ҟ0{4*4R "q!TDa@@*o@|T29`@q3R! !|@wr9k@s@5 4FRwWg@cC3bQFR5@*@5@qaTk@So@R_To@44@*~!ˠoo@Rzq@!d54!5 4!5@4!D#5R@Rw@k@5yҩ*w@qbB+Bq ccX`z34k@[R@yRRq@@5y*9S4*A!t2D[y*@*`5v@@ B!D;!  5qT @Rғ|@kBR@ҍvB)k@ qT4 )qT @RkTt@ZRKk T R`@K*!x*6@*@ +a@`@ :z4t,k-Tzs@9sRzy9a@`@+;y*64R`@`B)*YRQ@zb"RB $h`8J$h 8 u@KkTRzxa@{`@1y*6* `@{"R B@@"6  @{¨_` @"RB 7R{[*c5959S*`+A xq`TTqT q`T[B*SAcC{Ǩ_ֿqT5a@ RR59:qTDe+R5:qT`@u@#@5 T@xDM+R*[* 7A4`+A4`*9y94$*8x94 *A4`*A4`*A4*9y94,*44a@SA[BcC{Ǩa@ RR59:qTC 4v`@dAR x Ra @594RkRK`RHRERB{S*[*@ABR!>@bQ?k+TqT@!T @SA*[B{èSA[B{è_R{S[ RV5@^*J@sb@bb!@_TSAR[B{Ĩ_a@ b@a@drs.@sb_qT_ @{¨_{`@  4Ra@6W R<RR{S[c_qM Ta@#RmX*4@>3R[B*SAcC{Ũ_'@@!4@"$@#(@c!,@+@?|@5T{R@}R!8'@@!4@"(@@?'@@!4@",@@?kMTzu{,q{__qT{SSQ[BR*`@Av !=` @**[BSA{èSA[B{è__**?qmTR<)_{ *#``REF*#'@@@L @{Ǩ_RAR1T#@5#@7*hR{S[_q-T`@*@9?qT@9qTSQqTt 6RRҴ*4;~zRSA*[B@{Ĩ_րzvR5zvkkT5RaTR{RS[*cRWRkRsRa@*Qq T@"b@9_q T5F*qj`@qT`@!P44`@Ҿ 5DR q T&Qb**`N 5DPGlRaRB R0@%_q`TT_qT_q@T_qT_qaT` 5 RWR 5 RRb@8b5 5 R*:R8R44 RSA[BcCkDsE{Ǩ_js8?kaT@94sDT*s XT*R-o@k@TpRґ@@y@R{S[*cRWRk+Rz@*QqT`@b"@9?q T%7R QfB` 4 R*DХPG2VRaRB R? RSA[BcCkD+@{ɨ_?qTT?q@T?qT?qT; 5WR5R;R@8558R q!TSA[BcCkD+@{ɨk<@@sB!D ` (R7@q;~ R;R DХPG2#YR84;2QBRa` (T _qmT@@87 R_ R{@SA_{S`@( Bpұ,!R,7A9a@H!B5RARR]'9RaR_{S[cR*_qT`@@9?q@TbR8R;'QqT[B*SAcC{Ĩ_R?qT@85s"BQ`@*q*{RRQqMTb@F@9ߴqTqRן_jT**(%RF@84߄qTߘq`T{;R_j Td!N(R{__qT{R`@DEc`CR@{ƨ__q T {S*[c#q T7@9K,URR@`@9qaT5"8RkTҵkT@C73@5ֺ4R0RE3@*C5x4@4C9*!,qc cvqaT'R@p,&{@SA[BcC#@ _RCC R_C {SR[**C@ QqT`@C6 R{@SA[BC _` @RS#@@95@*#\C5qT qT'@bCBt@ҔCqT`@&Ra @#@D*@6+@*C@B,~`{S[c#_qlT`@*!*@5QqT`AcCRC`7qAT`@&[B*SAcC#@{Ψ_``@!< 5cCaBSA Q[B#@{Ψ`@a!%@5RcCaBSA Q[B#@{Ψn`@a!8%`5"R`@!X"`5BR`@!0?*5Г֢4s6sˀ,n2sCЗ4s~RR-RXRRs~ !T5h-Z2W2BqH`@!!*@5q TuZAcs@B6-34RnA/@ 95$.'NB}{SSQ[bR*`@Av !@"9@?kkT @**[BSA{èSA[B{è_{RH?**d?c s?*@ RgT@ @R{è_ @R"@**@G@*`T{S[c#*1T@*?[B*SAcC#@{̨_C*CR*4@*x*C R*`4@*CC4kT?q3sCC RAR9RRR{S_q TF RҥRSA@{Ĩ_`@!X 4s@F@ RS@ spga@@]@~@zTS{ _qT_qTR @{¨_s@@ RB0lS4> RF46@0{S[v=@9 # 6R'@RO5*q4T*eD2BCRaR R <[B*SA{Ũ_bR@3R3_qT{SSQ[BR*`@Av !$8` @**[BSA{èSA[B{è__{S_qT_qT*SA{ƨ_֠8%3Rs@RO6 `D$BpRR74@Rf*as5R!5B {[vFSsc#$*BpcR 5*$``6a!)ABZEqTj78TU&qMTo$S@ qlT"qT@!3[B*SAcC#@{˨_s{ _qAT$ R7@R*01@T5@ * @{Ĩ_֠3RP { *S2k)TJ` @{¨_sVS{S[cks_qLT[B*SAcCkDsE{ͨ_u@*WQ!C*@ 5q >T` @R8` @@94_@@9?q?qy jaT*?qT@94R"_@@95 q`:T`@R*`@@94_@@9 5q 9T`@<`@@94_@@95#***5c@!RS_4***5c@L@@F***p 4RR****uF@/"5 qT` @` @@94[@@9`5F#abB&RQ#@5KFB!`@?@"mTRa!$4!`4!` $5 qMTF%RB` @@5v@@9q!T7R#g@`T@9 574FB4*K!55F[@B#@" Ta@x`4FAK`?֠5{`@!`5FK7_T @BCX4 ;҂?8G`$K;@?VT;0R/;@ 3Re B;@ˀ sK?@s\T7@KC@ a G@N?B@ *KZ5@ C$ 5 @*By5BT@*BTqK@!`!4 7@Aˀ{7@*g}Ҁa š"qRqy`@5`@*_@4Fc@@ `@aТ!$4Fc@@c@q@*cP #c$C4*H>@x?:R A`? 4F@@*@'5@x?#!|5qT`@L7`@#E7` @!5f4` @!a5RF LAdA#!|@B|@6?q`? RRHR9RrRA{S*_qT`@ab!:E`5 RoqSA{¨_`@!+54*SA{¨c1b R!_ q,T{S*[ck_qmT`@<qT @cC$R>*7*+@C@l*E"FT**| RSA[BcCkD{Ψ_nqTq T,7X5-Ja@!Z!7@+@tє/@ Úc!FTKqTw`476^-a@!Z7@~ x@_{[РLS*c'5HRr 66ЁL?q T@q T`@# '@ C@9q!T#@ '@@9?qT# '@@9?qT# qT` @ҕ qTb@c1'A@9!4 Q$qT Q<q)T \Q<qTL RSA[BcC{Ȩ_ ? ~!|@7 SB`h!8dha8*ЂBLL**uТLCLc@**K`5+@h*5+@ЁL1dB1u*4*+@kqju8@!! ?k Tw2R{S[_qTSA[B@{ʨ4`@*!%`Qs"7RqTqT  RSA[B@{ʨ_Ru@qAT`Dy @%`t@`D3 `@!& `@!&``@A!,Ra@&FAR`@/` @#SR36 !RCB@*R$R4'@u6$'ܹ'@*ٹ*Թq{SR[@a@@,&@5Ҽ&`5@aSA[B{Ĩ_{*S[G'_qT#B !QR/6*'@}ҁң vss~׎ss l+KҿT++[B*SA@{Ũ_ R_R__qT{Ss R[UQc8?k9sRR"C9RB`Bq T@@kJT``7A@7@!#@9@5~@^B)kmT4RqSA[BcCkDsE{Ǩ_Q?0qHTKa8`! `@`@`@a @q`@a @q`@a @|SqaTq q T*qRRZ`@a @qן`@R` @R`@R` @R`@R` @R`@R` @Rǟ`@R` @R`@R` @R`@Rb@'*qT q@TqT{R*s7k T*WqTqq * R_{S[RNFxD?kT. 5(@s`9`5[BSA{è_{S[D9  7.RSA[B{è_*NFh*qT/KaTRNFB@yqjTKTD929D929`R{ j@4k`NF@ծNR @{¨_{S[LF"|@PNK"X@|$IT0yRSA[B@{Ĩ_ɷ*60lKuSA[B@{Ĩ`RR{S[cks^@D9 6R2ISA*[BcCkDsE{Ǩ_66R@2<a:@? T24t:@3-`D96aB@4'`:@?ITub@5TLFDNQK  ~@ҡ!zw/ЖR4 wb@뼒 ךW`b@ ?kKTK**LF*R0*4*K4@ +`b@ kaTZR@7{<7@뼒9{vRR{[SNFG@8aGd9!Ta.N:"| aRN:a6N; a2N <aFN<bfNabNH=aVN>azD>R8?!R?aJ@`!QafDabDajD(aDbD@!<2*`5 qT @@9?qT5R!&5qj@TqT5RqATRҚj`:RsrNF xDkT!6"(@A@@?kTBR40+`3R~@+xa@@Rr?kT5! IT$?TҔ",*Y{|j;8{@+`!xx54"@@?@C{ @xDkT<j* {!vj;8b2 7RR?@!*5 q T @`NFxDkT5(@``5@!05qT@bҁ!Lq@R*@"a!t*4@"!8| 4|qaTRqaTR6RRqaT@@9?qTRsRLFdDPN~ 2q T @RKcC9 R)Gh<'y 8G9G@NFE@7C977@$7fxDk T4R*tD6R1@TRB QB_qhTbPN?k TcDN?qT" AA5qTR4qa\7!;!NF_*@!t 5qa T @ B@NFLN4RNF '38@h'RaRBx1 R2qsZB@*4*\fZ@RZ@k T@g)BNF!(xa?B!(x!dD`D hDlDcK`!Kd?qT_kAЁBKc  `dh?qT>NF H@Q HNF*F*`5@"!T`5q!T@B!* @- qЁ|7!7!8 cB@RLFBBa!%CD95!2"R!C9`D9aB@@3`9a!xR!@a!$[@5qT  @v@r@j(T@ҁ!=C5qT@*@5@ L@U@5@!"$5qT@B @>{A@SB[CcDkEsFKqaTq!TsR{L 5 R @{¨__qATs@Ia@kT*P<"@9_q TT_,q@T(T_q`T_(qT> _@qT_Lq!TsR=_qTHT_q@T_qTSRT=_q3R=4*Hj@q@DRcR"*cR * RR!2bR;1ATDmR >Rp>`@Ђ!%5{ASB@{A*#SBc@'@R{k SxE`[*c.*qT@% qT @* @q`T@sqTq TT*~a@ऀR êr?k`T@v RSA[BcCkD{Ȩ_I5@(`z@9xqT!@ =``~@99qCzT!@4  ?R@5@ x?IH~@4TFq TA94?q` T@x'4@P7!)@4`7*6@*R `5q-T4*5@**4@*@49;@3?@7*  F8 x? 7@!!z3@|7@@ Ri*3@R4RA{wR{_{S[_q TDSA[B{è_v@Rd*`@R_*`@RZ*** wR{ _qTL @{¨_s@xR{ _qTL @{¨_s@|xR{@QSq TXoSA{¨_*_ qT`@! 5 q3ן`_CxR{ _qTS @{¨_s@PJw ER{S_q T:SA@{è_u@Ҽ|@`@Ҹ|@H&**w R{ _ qT @{¨_s@ҙ|@wR{S_q TxSA@{è_u@҂*`@~*~@wR{_qT{_`@xR{_qT{_`@xR{_qT{_`@xR{_ qT{_a@xR{_qmT`@R^* R vR{_RR R_@_{  @ *R @{¨_?֠5+ R{@{ {_{ S,Ff@S`\]0Y4b @@_q!!Rp0SA{è_ց@! >R40&j`5@{S[R ]`S0[B*SA@{Ĩ_PY*4 @ _q!!Rp0 ]S 1{@Ҁ @q šB7Ts1d,`{ 6@2T @{è_R6@2Ѐ! 9Rl443`5@{ x`RUq{|@_ R_ R_ R_ R_ R_{_qS[u5T!3R!t&Ha@*R q`Ta @;qTA!=a@3sb'R-L 4q!T9#D5 RSA[B{Ĩ_R74sqATD90@ 43a@4 ?05|@4,@BR r?kT57@)Rf D@! KqT!K_kTX6A)@#Rdh`! KqlT_kT77 @8 ?q@6|_{7R soS @{¨_{1%~  c$`6@%@- %}|$_ _{! `vAv@ !!@+Bv@P A!!6Bv@A!!.Bv@A !!+Bv@A!!.Bv@A!P+Bv@A!Bv@ABv@A BBpCv@b$BB Cv@b(B Cv@b,BCv@b0B)Cv@b4BB`Cv@b8"B,Cv@b<"Cv@B(b@B1Cv@bDB@4Cv@bHB`6Cv@bLB0Cv@bPBv@ATBv@AXBv@A\Bv@A`!Bv@Ad!@Bv@Ah!`Bv@Al!7Bv@Ap!P9Bv@At!>Bv@Ax!Bv@A|Av@ R @{¨_ւR*5@@@9 6A@@ @kT@ A @9__ _@9_B?1T@@4`R_?(q$Mz TA@4? qT,T?qT?qT#A!C 9@ @A @ !R@9A@9?qT?q!TqTlq RCzT_lqT@9 R@Q\qTcp-cHd8d#`C@9lqT#A!C 9RqTqTC@9qTTq@TqTR_q`TqTR_C@9qQqT@R_R_ R_R_R_@R{S[ck* RsRR{RRq$@zTqa 5*8eQ@8? q@ TrqdZzTQ8 4@9 * R?q`TT4**?qaTqR@zT!Q?k T?q!!8*ha8b59Kpqq@zTq@zT9Qt8q[z`T|9?qTsRR9 Qs t8Rjc8h#8ccj!8!?TRqdZzTaRR!RAR`9{@SA[BcCkDsE_{Sa@[c4_8$qT*W`@kTz'RT@QSA[BcC{Ĩ_`@Q`@9`@?$qAT@`@p ``@9T`@Q`{S[6r@T*qaT*`@j 8RSA[B@{Ũ_bqHTQ?\q(&Tp>Xaxa q%Ta @)4UK QBKB!`B Rb@*KRR~*Q57Rx`@Q``@@5`@j 8@`9`@)kTJ`8g`@`@4R``@Q``V@)kTQkT*B cb@*RIRQF1T`@Q``@)kbT!KЀBR5a@)Q`kHT`@)kBTB !K`@`2@9R`29a@45QJu8qT4QQj`8qTb@B56KBKB!@ `BuRkTRklT`V@)K RkMTRQ*RRR`@Q``@@5a@!4BRa@)Q`kHTd`6@9@6 JBqT7Q" _1TBlM" "JchM_kT RM2bU`@`5a@5`a@kTB!K 7BhM_kTclMkП _kT!25`R`@Q`BURa@)Q`kHT`:@96`@)kTJ 8`@a@3#! `@ )`@a#4a @)K@` K+a2@9u@)"7a@?kTQk(TuB4a@KqT QB!h`@*j 8b@`@`qTRG`@!Rj 8b@{S[*cR Rv `29t 4Qa @)ju8?kT?kiTRkTSA[BcC{Ĩ_"bJ!8!Rb@`@`{S[A@ 6*`L5@5B2@x!!9?PaTl h  d R` w#Rv~@4R R99?R#r!TqjTRF4R# 1` T5@9g@q@zTj2xbjM"lMLqÀj kMT l  dM d jM *SA[B@{Ȩ_ֻT K*`cT*4q@TT q@TLT4K@qTRR qT(qT9E`K\qTq TTq!TsVc@kTK91c@Qc*#_K@qT`@9qT*#Q&qaT9#!5+"4Kc@x'!@c@p ct8K@Kc@99cR?59!5@@9_@" @9qZ_@@9_c@9B5_ah"8{Z8{_{ {_{{_{S[ck_qTtNBsR a @X44R[B*SAcCkD{Ũ_s@zuBs6`klT`@5a @Rv2`5s@x*O5R@@9!!"hb8_@T@9@9#hc8@aT_|q T_q_R{S* @a @u@?kkTa|@``K`@a h!8` @a@` ? 8RSA@{è_ R{S[c@`@9!56R5+b@A!v _q811T AR 8 8`4w@qT@9?(q!TE51u`@}`@R``@@94a@9SA[BcC{Ĩ_@9(q`T`]HTXQR !8` @5BR9?9@R99R{S@@ @a@@@R@!!|5@B|5h"?? ? a`*@ $SA@{è_{S*` @` @a@a @ ` SA{¨{S[c@5@`5@`4@ R@ `*@@ 6ւ*C@5 @X6ҙa@?0q$FzTdR`r`@4qSA[BcC{Ĩ_f `u @` @`6!Ru@a@@ N;`@4`@ @(7]b@T@ RA|@`@@@ ~@~}__pqAT!!"@9B5@~N@@@@@@9 `@qTf!ROR?pqAT@88@9A5{S[c#SSA[BcC#@{Ũ_~jxxw@@?kLT@j8`@u@kLTt @@@{S*5*SA{¨F,  R?4SA{¨_@@9_`_{S@9qTa@99?qTЁ!@FNBSA{¨_ր@`5@@{SГBSA@{è_`@`4s@`@B4SA@{èLJ`@Q`@O@T@ SA@{èD_{S[*!!@9!hb8?@TR@0[B*SA@{Ĩ_8@95R Bң ``@c`4s@`@]@5q T`@5uR`@4LqT`@qmT R``@`B`u~)@ 3R{Ss*[RckaR8`4ER!6AR'[BSAcCkDsE{ƨ_֟T ~@6~@@aR 9ARRR   4 !KR9yx@R94  !|@4Ryj68k 8~@`R5R89@9qT RRqT :RqaT <RR4 f9xX@R9{S[*@9A4ARb`@94HE!O*_*  1aTF[B*SA@{ƨ_*_*3RR{[Scks@{RR7RRRgSWv@QqT*@5zR@kjT@*q35 @*@?0qT_0qT@!@@@?0q$FzAT`3R[B*SAcCkDsE{˨__0qT qqq @zT@_q@za-Tgg@q?q@z,TqCz TqT@4 @@@@@@?Ҭ@k@K@@k@8R @@@W@@@@ g?@tR7RRa@;@@R;`@9 5@;@`TP#qaT{RKk@O~}}@B |@d?@j7ajwK@ljw@sk@O@k@ jw89*c @@@@@4S@!@qT@@W*L2qT&qT5tRw*qATq9Z@xd*S55Ҁ@{}h{ Cwk* 5#@4@K@9qTqk@Rs O HKC@x{ H|@ARj 8R9F1jT K3*QR@9@RhwRc@hw`T"@hwW@zq@ Tq Tq@ 5 q`R7RR7RC@7@h{T#@Q#{sk@a@!xS!@! O@`@4K@`@4K@ C@x{`TS{s9aR@Ah{<@B@q!Kc|-"qq@g*tRge{s<r{S[VR*Zck 4R3@7GKSB C D3@ ZRRaRy7@!RARZCkTR R`a @ ?*1T@"5CQC!R:O@* 1"T?@?a@P?ATR,?1@T57a@?aT`@@95q[B*SAcCkDsE{̨_` @Ky8 4?+qTa@ ?*4Qq!T@4@*iR qTC 5?+qaTC!R5@5@`5R?qTa@ ?*@j`8@` TaRK@ @ a@ ?*@j`8@T?q`TaR?sqTT?q T?q!TC!RCr?qTC_qaTa @ ?aR@@@*5a@ ?(qA:Ta @ ?_1T@*a @ ?*@Jb @@?*_qT_qTaRK@ @ a @ ?a @ ?q*A:Tq TK@ @ aR**aRa @ ? Ra @ ?q*A:T?1!TH` @4@qCU_qTa @ ?ARa @ ?q*A: T` @@4n@ 4[@"1aT?@? qTkT?qTLT?q@TT?q R T?qT9R@`5` @5` R` O@GkAT{P@(AR C\1aTF{è_{ `Ba!a!8`! @R{¨_{SssF lBR*G;* aR`l >;|@4` =R` 5;|@4` 4SA{¨_֡R{[SF 1!TSA[BR@{Ĩk1T7*`, 44R` @RF4SA[B@{Ĩ_қ*4R4R*qRן?jTTsQvR _{[vz SR*+@e D3RbaRB( RSA[B{Ũ_֕+qAT*bB( ke` D3RqT*q@T RReХ b RB( SAR{ŨR_R_@ !@BR_@:@t@:R_A@X7BB@A:@!A:A:@!tA:8@HR_@J@P|@JR_R_{@@`X7@:@@N P@7҂{@R_@j@{@j@Af@Bf@B@BZsAj@AfR{_R_{` UR{_{@"AR`@R{_ RL0R_R_R_R_R_R_R_R_R_R_R_R_R_R_R_A@{AJ@!`!|AJAJ@AR@@R{_R_Af@Af@!@!Z!|!h{AnBn@AJ@!!|AJAJ@Bn@AjR_@J@|@J@J@@RR__{ B@A@@>@S@@!H@s!T@>@CBAR|BQB B|!! šAR!$š?kATB(*`!@R!QE#R! !|`~c Cc$*kaT!(*_k@zT`$a! R@R @R{¨_*R_{S_2T2@`T6@B@`6A6@A:SA{¨@J@@|@Jf@H{@_@4{_R_R_R_@@"@@R_ !BN@ `A"@R!A"_{`X{f.R{_{`!Rx I9 4Af@ FbzER `z @R{¨_R{`A@@LR{_{`7VVJ`)R{_{scI/ C)` ``@@6`R{¨__VR/{A@:@PR{_{R{_R_R_R_R_R_R_R_R_{ A@.!AA@!oAo\R_{b@f@BL<Rͧ`{{S@`@@SA{è_T@ShCT`B@4s@@d_{/ 9/RsN @{¨_֥@{S@``"@ tB` @@`3dCRSA{¨_d_@@A"|"dC_AT?dR_{kS3kC[5vеF>c CTSA[BcCkD{Ũ_wzBaBPX{t@*@I@@@`\C!Ts@<{ k dR @{¨_`+ R{SfC @}5fCSA{¨_fCq dC_{[S@hCT` Bzs @@U53`*@SA[B@{Ĩ_sT@dC@@_{S4U RSA@{è_@**?7`yR{S3Tu<`**@*SA{è @SA R@{è_{`DS u@~hCT` dCSA!@@`{èB@SA@{è_{c8*S;[bR4SA[BcC{Ũ_@yRkT;*BR 5@yB*"| S"$Dӂ9! a9{R{4`aR{¨_?@yR?k{S4*4}RSA{è_*BRd4`D`A-_@yRk`TrAT*RQ4`S@y``6*RF4`@*R=4`t% W@y[@y rT Ro7@R{S4*4*R!4`<`*BR4`_@yRk TX6RSA{è_`P6R*R4` S@y@`6*R4`h*R4`[@yW@y (RjTG7'R%҅D|}"#|@B'!%cha8dD9"@9aD9 *?@ @T""|87 @kJT"_ |@kT{S@4<zIj<<99*yy҃ y7sQD6}sQN1ATD@:ISA{ʨ_S5 q-T{Cc7xRSSs" s>kRr R3 |@R[*Xj@*@*R *R!*q[zTqT@9?kTq!T{ASB[CcDkE3@_֠_ *!R{Sz[*RkT*`6*` {@*SA[B _**`ГTBR({RR dR@qCh|96qT*@5}`D9`~`q TT qT@q T`!34qT`RjR @{¨_ R`j@RB{CStR[*c8<W kRr R`j@*a@** *R!*qlTqT{ASB[CcDkE_{RS4<[U**q,T**DRqTd@9**qTa@95a@95ecA "hb8F5"kTbja8bhb8B B5?q!Ta@9?k+TxSA[B{è_*a9 xqT7{*S*6SA@{è_}!4DsQ`7:IRDA_"HOa87@@_@|@RRCR{CS35HOӥ*h@@A *%R!2"R7q !R! t@B! tl@A! lR{ASB@_{*$RSszAR q T* 6D`SA{ʨ_!R`<`@y{* *AR*` 9!R2bR"qПD@T {S[*4_9Hsz5R7`@9 q)T`@y I* 7cBR_k#T*j!8{@SA[B@ _?Td@95dJb8Bcj!8!R_֠BR*{CS[cks8* 5uwByxByy@Ҁ@94R?@_Tj`R}R4*@7|@!!z*RD*6bBy`aByP8? @@9qaTVR?@TA@9?qT? ?@@T@9?q$@zTThTaTT{A*SB[CcDkEsF_a4t@9?qT`h:@9?$qT``J"vJD9wJD9z{**Z {O"n9`*Byk T@94@9_q@T_q` T_qAT?$qT`x,"?kT` % @9kTtnD9q T`  mҋ`ZD9*k- T } RY`n9R"Lp~@L!RxD999@9 77~@LD9!9?q$Iz`T kT` 6`(!~@LD9?qTxD9`!9% Rҁ<`?q`TkT`"*6`x#RҀ~ !  *) *ij8?k+T`j@Ra@RR"R * R!2d^D9*5 )w"vu"RBR>R:a:D94xa>D94raBD94lbD`a:I#! C{CS[6#@4*`${A*SB[C#@C_**5u@ R*R!S!2RRRT*6D`%Ҷ6{ASB[C#@Ci!R*4R_{S[D&&@? qT@9`e9 @&q`T`p&9R9SA[B{è_&@**RbR{Ch@@h * R2cR{A_R*RR{CrD9h@@ qh * RS* {A_**R"R{Ch@@h * R2cR{A__{@*&q{_*RRR{C rSh@@H * R*R*7D 7D9 qT`@9aRb@9 *A BH6!2_rAT!2a9!|Sa9{A*SB@_{c?z[5**S#* 7@y*R@!TS [B*SAcC#@{ը_*@@66?RzR}R*R[*`79*7@ys7RqTq TqsD*C**6*"Rd1T*`H'R*RV`qTsR {CS[cksD"%` zRt$7@9R2qҀ*7@`"v.@9BҠ@9a.9R9`>R`FBҪ`*@9@9 a>9|q`T"@9aB9&@9aF9qaT*@9`J9 @9> @9a.@96 *D9qT"RR`5 R`29qTT5D94@SR`RqTj@@RRR R * RRr* 7qAzaTD 6`Ju6@9Rw@zS>IkKT`'nRk"q R5uuR>Ik+T"3R>Ik T`F5 R` 3;z?;@@ T^c;@bTj@җ@A@CT?@* 6ұA@Ta@ ~ @`RRMRDR@6uJD9 qTq Tj@*@RRRR * R!2R6{ASB[CcDkEsF _@D9 qT*R(*R$x*^ `'`L`@ A|?@@y@y*6 6*R-(6D9 qT*R%*o6*"RqT*6*`6*BR6W7*bRR**@B*_ qT*`(iR{#{D@A4R_RR#R{C@h@@A *>R!2e2@96`@D`7>@$`@Ra6@9r@!@S" *h@!*A* >@`@a:@9@!@S" *h@!2A*>@ R{A@_тR{CS-RRcy`@RR#Rrh@@A *>R!2Re2@9}l`@a6@9@!@S" *h@!*A*`@a:@9@!@S" *h@!*A*{ARSB_Cc'{CS[cks@9 @DCB@chd8h@!\Sb(6t6@94<*Rr**RR>RZq@T`@R#Rh@@B9A *e2@9!2R5*6`@D6@h@A *!2`@{A*SB[CcDkEsFC_t:@924<*F@V`@~@J@mlSv4kGRЖK`@3**>R)?*`@O)D6*^`@9@@kATR`@D`'7'7@kTQ4*@k aT{"PRS R}R$@9#@9!(@``@`@4@qaT`@4`d)l  `B@9qT@9 qRzT`*@yqZSA@{è_`*@yqTqTR{[zSsRcRxRkYRZ>*F@9 51TV@9a29*@ya69*@yA5@46@D7@ ? SA[BcCkDsE{٨_րF@94R` B9R99S9*A9@R9 *F@956@D@6c A95`&@<`TqmT`e6A9d2A9*bA9a@9`@9 qRz!TRqTqT*qMTe6A9`d2A9)bA9a@9Ԑ* **7{RS[гvJ@`R9` B9RS`9@R`9@`F`J*A9@R`9"@@?vJSA[B{è_{S[cks !M"! RD!RЛ*@9` 9zK@y@yCT6?Ss_Sw~S*{`RoZy@R|`w@R`9` B9Rv#9S`9A9` 9A9`9@y` yA9`9*A9@@R`9"@@?4 @x o@qoTsRjRq[BSAcCkDsE{Ȩ_`G@9ZT{S[cks !!! RDM!RAЛ*@9` 9zK@y@yCT6?Ss_Sw~S*{`RoZy@R|` R`9` B9Rv#9S`9A9` 9A9`9@y` yA9`9*A9@@R`9"@@?4 @x o@qoTsRR[BSAcCkDsE{Ȩ_`G@9ZT%RRCR{Ch@@H *>R2"R({A_{S[c#@9'"C!hb8B9(_@qTc@a:@9zy@S!@S9 *ah@!29*jRAhrF#F@ 29 B969>:9B@`@s*>RR%@6SA[BcC#@{֨_` @z`7qI`@a6@9F@@!@Sh@^S5 *RrA**a:@9<*B2!*rJ@!>R@6`@D6b:@9qa6@9A7R`@s*>RRq@z,T`@DA6a6@98Rt67@jRAhr_kTF@!Q?kAT2@9?qTF@〹T?qT{Ru+SR@@5`+" RSA@{Ĩ_j a@vR_{ qT`,`H-aF`F @qßZ{¨_{S[D9@ 5**VD9 qaTD9QqTR u t29J9D9`B9D9`F9qT@qAT!0/P`RVVRD9_kTzD9R`5`6@9 4`:@94`F@9`5`>@9`4aB@9 xq`T?qT@. !@@-RSA[B@{Ũ_"D9B_qT#D9b 86b69"D9B_ qT"D9B b>9"D9b9!$b:9?qaT R`*9`>@94a@9R@S?q!a9b@A@ *@h@Rr*!*a*/`9#@7'@?x@ ` SR0`y RR{Ss[zckRYRsRvJR@@$9@(@9` 9RH` B9{Fy9S`9*A9z9@R`9"@@?*4qAT@T01\` A9qT`2A9qaTc6A9@b2A9(/a A9"6@9qAT29SA*[BcCkDsE{֨_qT@9$79`6 R69ҀҀVԐRvRR9999R` B9F9S`9*A9@@`9"@@?@5 @z2 RRR[RRvJR` B9zFy9S`9*A9@``9"@@?ր4qT@0 @x h@@)7R29!Zr!ZrrA Zr" RkA   *~{CS[ck RDR@4@R2@9rszh@@'RR A *>R!*"q-Tz@9Y'90R*AD@@RR8*57@@$9V(9qT@7@W*5kTRRf{A*SB[CcDkE_R7@f$`{[SD@T SA[B@{Ĩ_@_ @ Rwt@4_$@ T{S[cP@ 4`@ 4w` @9@R3a@a ?`"@@aTa@b @@d17`"@@T@p a@@_@R@@@ ?@_@+`54@@1aT@`{@SA[BcC_`@`@ R`@ ?b"@X@`T@_T@р@`54_ @{S[c#tD@AT0` `SA[BcC#@{Ũ_ր_BѶ@7`4w`B@t R@R R_{S [ck**\TP` M[BSAcCkD{Ũ_`{S[D@aT` @@31SA R[B{è_@_@(&@_B!@` @{S|@s!`zt(@ ?֠4`ztSA{¨,@A@@@`6RR_r{ B@"@7`@95 @{¨_s|B@"A@6 @{¨ R @{¨_!! `$@a_RA@@6A@@@`6 R_A@A@7VA@aA@6"4D*C@r_{S*@@@6!5s@60@aqkT@*SA{è !qSA@{è_!@{ ?qП{_R_֡{S*q(T5!!434qTSA{¨_Cv@!@+a!6Bv@ACv@B.!P+b B+Cv@bB.Cv@bBv@A_qT!! `(@_A@@@`6R!R_H4R_R{_@@@{44 qT R {S*`5$9Y@94qTsqT@RPA!1B{5 RSA@{Ĩ_ A!1Bn4A!1h4A!1bq* H"_H__{ *@j @{¨_{S*7*SA{¨JSA*{¨_*{S*[*A!1 4A!1`4A!2 4RSA[B{è_ RA@!6q TzrT|S@R7H R{RRccR RR{Ψ_!A@R_{SUA@@?T R@RR!bҀjsjss"! AbAT@@@RSA@{è_#Y"c6c6sd@T!@{S&DRE,DhT(DT&SA@{è_@,A( $_{3S @4@~~?ssts@? T @!ATaT @?| T!@AclF`RSA@{è_֠ @˔@ HK  RA@ H6 _@3@e@@B~aT"_cBaA @@`pF_cT D_3c!`@Tf @ R@f7!@53_aT  Rb"@bah! 5?T!C"R |!B !xS@! _`# _ R @E "I?'hT FBxS"E__AT|!R! @eC _PhT@l_PT L_PT O R_TR0@_T@~?CT @B@BH7cB(D,D`_SA[BcCkD+@{ƨ_{!\?S3[ck+-T5|TC"BxS"C@@@T@ @_T@ @!~b C"@B@"!@3` T@B~D˟|T@@ae h"@IHTF!"BxS"B@@ @T@c~e˿|MT!Q!PhTlPTL!PTO!RT!R!0R @@$ A@!@A@_( TBC#RD|BBxSc c"C_@` |"RB @TT!tB!T#*cxS## @ T@@AT?@T@"@BCT @@~_|T D`oFTsN`T_iTT H _T @s@ "DIT "DiT DI_'HTCFcdxS$_!Tc|"RB B PhTlPTCLcPTCOcCRӟTcRc0@T@c~HT @@~}T@@ @a #@ AE h$H@!@ @ AA " @t`_!QTz!BTc*sstaoF?aTvo@T s?stsT! H ! @! @T~T @! @@B~B_|-T @@  @b|!@~)TCV{S|luA@H7R_B~B _ (T_T|_(T@|@SA{è_|_ `T~{S[ck!SA[BcCkD{Ũ_SA[BcCkD{Ũ/A@H7@02Ae_\A|_~9zBѿJT3B @A@T#Cc@C7!~T#TA @ @@@@? TAA A@B!@|T@!Ac@@A@!@AeVCe 7t_T˃@c~B T!?l T"р@A _ T_)T`@ `@_hTsBa@a@a @ @ @@}` @`@_ Ts`@sa_.?,TAA @ AA ""_ HT_)T`@ `@_TsBa@a@a @ ? T~A@@!A?T @~u` @`@_ Ts`@sa_"_ T_IT`@`@_TaBB"@"@!@` @ `@_ Ta`@ab@8@@@@@B{S[B@H7SA[B@{Ĩ@TSA[B@{Ĩ!\6|"?€@ Ԛ|Ԛ!˿"Tq[BSA@{Ĩ_@ԚS@KU|@BѠ|HTa@!~! @ @@ a@!@!aKa@!~!?|MT`!@@a@!@!a=sBA@RA__B@#|@E@Ab!B@!@@T{RaRE2B<B 3R*{_BB}B_!R*@kLT{ @@R{__@kLT{ @y@yR{__{ *`@H`R @{¨_{ g`R @{¨_{@ [y`R @{¨_{ *`@y`yR @{¨_@kT{  @R{¨__{*R{_{ S'tRSA{¨_{S[`~j`ݾ 5s~7sSA[B@{Ĩ_s!T qT{S[*a6qT@@*#RRǸ*@B|3P qTRSA[B@{Ĩ_ր @_@>@_ *4QARq_ R#_`_{[S#pDTSA[B{è_t`r`5s@{S &SA{¨_{  !!#8@"8!#bR @{¨_`@!!#R_{Rcվ!`R+/3;7c@R{ɨ_?~bRaRA{S3|@1T`|@< 3R R*ARy*u4@*SA{è_j385R_qT{S423[*zs@zs  RSA[B{è_*@5skT_{ s"@`R@d4["q @{¨_{@4Y׷ R_@^@ O @c"RR?*@@D5D{A@7@@@6@59A@7A@7A@!hA@A6@7@5(_{S[cSA[BcC{Ĩ_*RR|@RR!Tq!TK@i5@TcB`6B㶍c۶BCmö!B|{ @@@6a@@6`@@(7 @ R{¨_@R{S*[*cksqA T3|}`>|c @\kTs"їQsq TRr@`@@ qmTZn"Ts"Ѻ5U7ҟkLTR*?*SA[BcCkDsE{ƨ_{"BQ{s@H5@ARs{u*Xs*kT{u3RsY975R%@H%q$š0q*_j T#R@RqRjT@#R@RR_{cRS88[kq- T**B5QCz *Tk,TsA!/z 3@{ry@@AzlT_'qT*`@ER[B*SAcCkD{Ũ_*cC*kD[B*SA{ŨRt*~@ QRK@*j"T@tkLT@I5b~}akT@*/j"3{S[cksa@[@7w!?(@4R{@SA[BcCkDsE_*CqmT _8  R@9?q$IzT4{'@95}k 4c h`@9?qT_qT!@!!$ښ!7#%R@RR5B!`6鶍!i۶m!Cɶ**!| R4`5q TR R?q$IzaT9!T*q T4_qDIzTQg*C@s55R߻*V  { qLT9?kT?q!#|@!!qT@9!$k#8w@?9X FvRr7@j`8%hd8kTk,T*c >RDdjc8$k#8c  4qmTuK$"`@ `@@@?@_<** R@qTqTC@vx*v@Vs4@{ 4_'qTQgkaK?q-TC@s {S*_qT _8?q!T_8Q@TqT!03h8*SA{¨_%R @֟ @{@s?{¨_{S[*@(9c*#9@D9kT@@`@@L95RSA*[BcC#@{ƨ_zss@k T[BSAcC#@{ƨa@ )?T6@9z2e @*s*?*@@_@ 1!T*?1Ta4{@@H:O"R*{_*_{ScRˆ5@R@{¨_ R`qT qT$Qa_{`@:{_@:_$qT! `_@;xbhqTkTB_!TR R_{S[|@`@95SA[B@{Ĩ_RwkT@9q"B|@S5 R{S[cko2**1ATVA1ATAF9D)9f6!29cy g@!7xA!xqmTB9`6C?ѺC0C{@SA[BcC_C?#ARF97!RAR9T@сB?T_R9VUR@y6B9!7 @BT|A@?kLTg@`#Cg4Q`c8(qC9@@@?`@b@@ 6_k-Ts@s`T _k+T6@`"<6`@`@6@_@@@7{!@44SsC`UB4s~Rs~ @cTA@!pAA~Aa5RA~R!RRRSA{¨_ @@B!b_xyC@A a`{S (@9TA@7qT6 @@<6`@@=6a @@=6a@y@(=4 7"Rt(6_qb@!!@T+SAR{¨_b@R@8=ڿR Q_$qT QqhT \Q_ Q!Qq 0Z{@9 7*@9 q`Z{_ @94)LqT,@94{ @6&*{_ւQ' _$qT!!Hb8bA!  QR@ aD ̚!T TT7|@ '7@|@ A 7 @|@ ) `7 |@) I@?kT7%* k@ Q&RQFRQfRQRQR Q&RRR@7 `i(8FR*_{S¹5@iT4#`9 RSA{¨_{5{¨_{Ss+[`P96RD9RR? 4?A9q@TTqT qT`*D`*<4<4qе+RR+v``Dk T<@4`P9 7`BP9aFP9JqTqTbq!T`.D`.qaT `&D`&qaTR`SA[B@{Ũ_֝`@?`4?A9j48 @9 `:@9 @`*R[*3O@kTab@9`f@9 aj@9@`n@9 `ar@9`v@9 az@9`~@9 Ta@9`@9 a@9@`@9 `a@9`@9 a@9`@9 Ta@9`@9 a@9@`@9 `a@9`@9 a@9`@9 ZD@T{S[c?@!š"BBzBc""zATaTa@9`@9 a @9@`@9 `a@9`@9 a@9`@9 !AT@Q 5v@5wҿҰ4@Rv҄`BA9aFA9tNA9 `JA9 @aRA9``VA9 aZA9@`^A9 `~RSA[BcC{Ũ_A4)@р Ҭa&A9@ `"A9 `*A9 @a.A9``2A9 a6A9`:A9 a>A9lT5`BA9aFA9bNA9 `JA9 @aRA9``VA9 aZA9@`^A9 `B|R*afA9`bA9bjA9  R"@anA9A`kT@@RR_{S!Eq Ta@!=qSA@{è_{S*a [@!Ú# cczcc#˿'q TSA[B@{Ũ_z#q!TR@'@kTRs!4a@9`@9 a@9@`@9 `a@9`@9 a@9`@9 b@9a@9A b@9"@a@9A`b@9"a@9Ab@9"a@9A!!ˁ@ BpҀb@!îҡ!qa@9xSA62rZ"R`BְR{b S[c#@BAc!!z!c!˿/z`q!T 6d7^ֆ 8W T @QR@*/@?k(TTSA[BcC#@{ƨ_4`@9a@9h@9i@9 `@9 @a@9``@9 a@9`@9 a@9`@9 `@9 @a@9``@9 a@9`@9  !`@9a@9 `@9 @a@9``@9 a@9`@9 a@9 C aBt{SR*@ q@s@*SA{è_<@kT@*4 {S[+`"@94%XqT67ֺZ 3R*5@5@*#q#g5#@ή#@`4#@ sqTSAR[B@{Ϩ_֢B#|ChckTA! @_!?@T {S[*R@5s~|js1T[BSA@{Ũ_sBBqTq@R#R5'@@sb'@ab@?T@k!T`@kTL@4s.@{_S[*Rc*#5'@R@sb'@ab@?T@@!@kT@kAT"@5SA[BcC{Ũ_ןs.@sb{[*SRR**L1T@5@"@94s4@RI9sqSA[B{Ĩ_{ *5@0@9?qT%* @{è_3{S*R[5е6**L1T@5@2@9qT*?sSA[B{Ĩ_{S*{*5* ̳@+*SA{è_{S** 0**cL1B:T d@SA{è_֠5@ `2@9q @B4@B @֠_RD@{S*R*SA{¨{S@@*SA{¨{S[**R#*5'@@sb'@ab@?aTT @?kaT@kT[B*SA@{Ũ_s.@{ 5`@ @{¨> @{¨_{c5@{¨{¨_{ *5@* @{è @{è_{S[cu`@4@@@@)44SA[BcC{Ĩ_@?T@@)Z{S[Fa@74@@@)@@[BSA{ĨSA[B@{Ĩ_{S['a@64@ @@)z @[BSA{èSA[B{è_D@D@D@{S*R@5@S@b@b!@T@*SA{Ĩ_@?kT@ks.@b*{L1T *|A {_R{S*[*cks71T**377@\*4*[B*SAcCkDsE{Ȩ_*R*5?@@b?@b@?aT3@kT@@kAT* 7@qdB:!T*.@*?@~@22 9" 2A 2@(6{Ssfs~@RHaSA{¨_|@ ]{S[cksF @r*@ 5 DZ`bxn7@z |`"auJ@t@77@@!t@7o` @@f@c2*@5_@@4:`@2` _ ` 7@@h@!4`@!|@2` ` `@d@5"@@p@!4`@!|@2` `:@:`>6*`5@A7@@@`@2`[B*SAcCkDsE{Ǩ_ ?*4*a>@@ >`@6`@`@ 6`@`@6` @ @ @ ?*`4@ ? ?*43ttttA={S[6@@v6p@6b@[BSA{è% SA[B{è_{S@``7`@t@Z@`5`"@@ d@4b&@!t@`&a@ @`@5 @@l@4a*@r@`*`@@A`@2`*5`@ g6R*SA{¨_a@r@t``J@ ?*@4{S@ @!7@*5@@2@* 5@@a*4!R*@5@6R@*SA{è_ր"@@@hq T!#T@$@ ?*`4@x ?*`4@"@@@hqT!#6@@_@ @_@@_@@_@$@_@(@_{S5RFs`TSA*@{è_s>@ s{@V@{@ _{S@V@k@5SA{¨_ 4@_@ R_@"@#<@Ba!R__FcdaT@d @@@?kTRC_c<@@_@_`@4@_ @@@_{c@`{¨_@7c R@<@!_R@!2_{ ɧ ``@2`R @{¨_`_(_$__ __{H@ q{_{ q{_{S[*H@@f@*|**?@f@*qT**@f@1* 7@f@BB*z a ?!|6!~iTB4@f@*wSA[B{Ĩ_Cxa!cZ`kaT{*S*@R@f@BB*SA{¨R{AT{_R{!0Sb6`63ݝsCs~Rs~ T@SA{è_ց@4* B!!ݝ!C!|R!|"?aT_@_kT{c0k:!0S!YRR+3D[е0*Rk TqK:.1aT9qT[B*SAcCkD+@{Ǩ_*?qTqB:{S[`[BSA{èSA [B{è_{S[b6s0ckb6s?B_ !!`;V  sݝ{sCRs~Rs~ 7@kT77@aTl @1ATR8`Tsz @z @z@@ / 4ZCC@ G@4Z `7`r@`6G#9*L1 Tq`4T&|"R3"aRBRkk@SA*[BcCkDsE{ɨ_{S[W R[B*SA@{Ĩ_ l 7**x *cq*@z!TR{S5H@A7`@x6X 4SA@{è_``@p@7tFрTR `7*>@@V@@@V@_@V@{@@bB`CR5AV@?H@V@*`5A!{_֠_{*ZR{_{*@V@1ATR{_B@H@"B~CV@*y{S  # ('*5ҠzsN @V@*]5sTSA@{Ũ_R_{ R5*5* 5*5* @{¨@V@i @{¨_{S@V@,`SA{¨_*@V@ @b@@ D`@aT_@!@?kT@{S[Ab@*@**@ b@4!|@ Ҿ `u`BvV@b@@5a*@ ?*4b@4`@a@@ [B*SA@{Ĩ_RtT t{S[*#*5'@Asb`baTT@f@a@cxkT[B*SA@{Ũ_s.@{c5@@@{¨_@_ @@@TB`RF`aT@_TA$_B,@B`{S*_g5@"@#@_Tc`*d`_aT@5SA{è_c,@!Qc`{ ?J5@"@!@?`T!`a @{è_@" @#,@B@a`!R_{S@5SA{è_{S[caU|@#*5'@AbрbaTS @(*5@CT[B*SAcC{Ũ_֔.@{S*-*@*SA{è{ @t@6Bf@@@f@" AB`C`T @{¨_C@B,@k_?1aT@_{S*5@# Ac`b`_T@SA{è_b@_kaTc,@_a6@_{S*5@# Ac`b`_T@SA{è_bH@kaTc,@_a@_{S5@# Ac`b`_T@SA{è_bH@aTc,@{S*H@qT**SA{¨SA {¨_{SS5@ Asbab?aT@a@?!T@5SA@{Ĩ_s.@5{S*@5tSA*{¨_*_{ *@ @{è{ "*@ @{è{ C*@ @{è{ T*@ @{è{ d*@ @{è{ 2*@ @{è{ g*@ @{è{ |@ @{è{@c@{¨{ ?f5a@ @{¨W @{¨_{ 5`@@ @{¨_{]5@{={_@V@@b@@R!D`@#AT_!@!R{S` @!@"@4T@! @!@!@a ?֠4bEA"SA{¨_R @!@! @aR_EbCR_{  @!@!@`@R ?`4 @{¨_ @@ @ @{¨{ @!`"@@@R @{¨_! @!@!$@ ?`4 @{¨ @!@!@aR_{S`Ɯ?$ RaRBR*SA{¨_@A6ХH$ RA074$C R@!@ ?*q4T*t$C RaRBRQ*q`4JT*\$ Rc*q`4jT*Ɛ$c R@6vZ@ 6nV@6fLD*q`4T*Ɛ$CR@GA"@`86@JH~{[SRckF9ZsvX`T6* pBcRaRR7[B*SAcCkD{Ũ_֗`@!T@q*@zaTf@B*RRR>@{ @!X@4I`"@@d@4B`@@!`@5 @@l@46`@x` @{¨_{S*@6*9qAzTu@r@7r`T?jTp6p7 45@a`@7r@R?jaT@`@x`R R ?ր4SA@{è_@(@ ?_ր@{S[Rc*`FX?T*SA[BcC{Ĩ_֕@?T*1TqXz!T*>@*4{SJ@! !c15#@`'@` +@`SA{è3{S[**ck9? @@!@4@*a@@RS$@aRc*2q Ta@zS*Fsѷ`aT*Qc =kTSA[BcCkD{Ũ_*! T4T<Q @+a4z!!s>@szs?kB**s` T`>@*B*s>@s{S@*@`KSA{¨_{#S*[ 5**'@֢@@d'@@sb'@bb!@_TSA[B@{Ũ_`@*c@@@RRBa@?1`Ts.@sb{S6+ҰSA{è_R1{S[cXw#FscTSA[BcC#@{Ũ_`@y4ɟ@5*c>@s**{ST[6UH,E*SA[B{è!l4**[BSA{èSA[B{è_{S[5@!l}qR#*`54'@@@4s`5*3s&qTSA[B@{Ũ_RZ{ Ss0[b6scsCݝWb6s~R֪s~ TSA[BcC{Ĩ_ց@ @ӥAΥ˥@bB{4Ss0[b6sck0sCݝДb6s~Rs~ TSA[BcCkD{ƨ_ր @c*@ @5/@@@$4/@Y9@b/@b@?T65@!T4@n@j.@b{Ss00s˔0е sD^ZTSA@{è_ւ@AH{!|| * ^R @{¨_{S[ck++* 7&*7w+AT[B*SAcCkD+@{Ǩ_X7|B 4*`@R@f@****'R`T7@Z`{CkT! Y7! T7!!ORR7 R@R**s @k) TP!@& @B G7(T!@TTT`T_֟ T@q@Tq`T@ha?&@ha8?`9R@qTq T@hax<?@hax<`y@haxZ@qTqT@ha?@ha`@haZ@ha`@haZ|` *R{@c5!@?qTT?qT?q T? qT@c@9{¨_3@y@ @k TP!@& @B G7T!@TT TT_֟ T@q`Tq`T5`@?@h!`@9?@h!8R@qTqT 5`@y?@h!x`@y`@yZ@qTqT@5`@?@h!`@`@Z`@`@  *R{@qTTq`TqT{¨_ qT*c9*c3y{SДV![@4b`4@5@`5@SA[B{Ĩ_֠{S)`@TqT`J@SA{¨SAR{¨_{ {qT@ @{¨_{SR@4`J@04|@SA{è_'@@`4@@`{S**@f@pb/B|~?cT_ZRSA{è_֠@ R{sR@{¨_{s@{¨_{ *@f@Wpsa @{è_ֳ/@{SSA{è_/T{s@{¨ _{*@f@do|@{_{**@f@y1T01AT@ {_֠{@f@q{_{@f@m|@{_{@f@m|@{_{@f@,q|@{_@f@n_{**@f@p4 1T`{_֠{*@f@q|@{_{*@f@{q1Tq{_ր{S***@f@X*`5E)` `2?q!Z!|@aМ*SA{Ǩ_{@f@1pqZ{|@_*@f@o{{_**@f@@f@t@f@t{S[*wb@@~*z**@***SA"[BB{Ĩ@f@nR{!p! 7!! 7!!6A@! @*{¨_!"7!X"6@@k@!R!"7!"@7!4#7!l# 6{** "@f@B7R@`@`R @{è_֠{*@f@qq{_{S*#R*SA{¨*SA{¨_{ #A @{¨ @{¨_{!#S`!#@uҡzs25*SA@{è_saTR{ @@!4@"@a@@?a@a6q @{¨_{S*@R%@`  @?kT@ k)T@sK~RSA{è_{S!'J@7J@!'6 R`@RC!!.@J@O* 4*!|:p(t J@!'`7!|:'h*SA{¨_րRJ@!() 3{S[@R*@5@R@sb@`b!@T[B*SA{Ĩ_`@6T @ s.@sb{S` @kHT` @1`@/SA@{è`@xt@&{ k@2`@` @||S+` `@ @`{¨_ @{¨{S[H@RSA[B{Ĩ_R)v)P6 5@ @2 "|S!xb$_{S@ d@@**R7`@c@@cCc)SA{¨_ {S*[V@#4@@A6s7@?k T @!s6@* 6b@"*@?qSA[B{è_@@R`R{S[!@9!hb86*@R#@1T`@a@{@4A)K'T#@ۙ|@#ARޠ`5'@a @?T~'@RSA[B@{Ũ_{S[A?*5s@`vK@@~ @K@ [B*SA{Ũ_*@}Ӣ6{z_~ B 6yB(6x_{Sca @?qTSA{¨_a@@?kT` @qlTR`@{S[c@@4@B@@`7 @@`?* 4[B*SAcC{Ĩ_փ@ @Ra|S !~Cha*@h!@@x!s{SC/#cg c"  ʙ=SA{̨_{ 5 @{Ĩ_{S*[@64@*@`6@a~S ҂ @!~ s~}Cha` @h!@hs@h3RSA[B{è_*@?@4{c5@+@{è{è_{!4* 5 @{¨ @{¨_{S*!\*{5@c6q@@"4@D @Dq@SAb|{¨c{bC(6s5065@SA{¨B@ց@{TC @*SA{¨C@SA{¨_{S!*[E*5@3s@@4@``T`yT`{@T"@@`b|(B@`?`4* 6@BS@`?7[B*SA@{Ĩ_ @@@?{c'5cҷ{è_{ *5q@BB @{Ĩ_ҡ{[+@|Sc#5*|@A`@@!4@#@!@@R`4SA[BcC#@{Ũ_`?5@*!*!`5a@[B!cC!#@SA{Ũ{CS*c**B*+[R*o****{ASB[CcD+@_{c`5c{è_{ @a@ @{¨_"RR{S[*c*#@94@_9c**7@~@c#c`@>*B +s̝* qTq TR[B*SAcC#@{ƨ_/@K !|@c#cB"@*@?* 7*c/@KqRR5!|@&eХ*B0+%C{CS*[c*H@*RB**J@q**Cן*{ASB[CcD_!@@%{S*[ҟkTSAR[B@{Ĩ_aZs*{[c*k*S+*k-TcV**%R *1Ts@4**SA*[BcCkD+@{ƨ_H@*{CRFR+**)R{A_{S@@d@BP)cA) 7`@qATa@qПSA@{è_R{ *@@?  Ӛ_j @{¨_{S**|@  Ԛ`@4*`SAR{¨_! a{ *i@@?*$Ӛ @{¨_{S**Z#@a Ԛ!*s4@A*@! RSA{¨_@! { *C@"A Ӛ`@*`R @{¨_{S607R`!+J@` @!+RSA@{è_{Rc!(-{¨_{S@B8 S qTSA{¨_րJ@a!_X, 4h,5@R (R R{!x, `6B,q @R{¨_!,z@7ф{C(FqTP{A@_֟q!TP{{ @)f @pSq$$ *d@Sd@`bE4QpSQ#$C81aTR_@ {S*[*@u4@@@@`?1@TSA[B{Ũ_sSO)C'"R@`?{Sk>-`J@?SAR@{Ĩ_5@?@?kBT5{S*[c*k8@ 4@@@@ @6,@:R4@klTRc x5c@{BRg@2G#@`?4SA[BcCkD{ɨ_֠* cZq!34c@ @5S2$)!`! bU!CC@"| `?{S[*c*k+<@4@ @ ` @60@4@klTR 5@"Rjt8AK 8c@`?*@4[B*SAcCkD+@{̨_ֳq T|@s*k@~@ k`@\#@"R`?*T@{S[**#@*B-CКCƔ@#!-*@5'@^\)'@*'@4: S @@! kT#@*`5#@[B*SA@{Ǩ_s{S***R`5@*R5@**SA@{Ĩ_{S* 5*@SA"R{èSA@{è_{S*[@64@  @RSA[B{è_*@?4{SԐR`J@!0."r)*SA{¨{S@44@@SA{¨SA@{¨_{S*[@@4@@R SA[B{è_*@?4{ @`R @{¨_{ *q T \DRaRBp.Rj @{¨_R{@{_{S*[c**A?5An405@4SA*[BcC{Ĩ_APޔ*`4Q4RԔ Д̔A9ƔA3kT@!4@!@A{RCR!!.Sm*qT73* @*SA{ƨ_!!P/L*5RR"R#*!#?qBR{"RSH@!.<`)!J@!61T 4YRaRBp.RSA{¨_`R{ `J@ @{¨ @R{¨_{ PRRRIRHRܡr R$!R|*F ?k SziTg**c  qTB_ qT? @R@sr},1* @{¨_{S**@`@RAsr `RSA{¨_{S*[}* 7}R @?36 @?`S"S*k2*SA[B@{Ĩ_qAT@?`S!S*2*{_rS*[RRW? R*5?w?v **SA[B@{ĨSA[B@{Ĩ_{S[?* Rs }5}Rs @?qTq!T @?RSq@r*SA[B{è_{S*)@bS@B2R**5?R * R{*`5@?*@*SA{è_{S[@0@9@?տĉ{*$*?մ?@RTsr *vR)RSA[B{è_{ a@5@!x  @R{¨_{S`@@f@@B/j` R@f@B/@j`29ԐRJ@!0."r`RSA{¨_`{S*[ @?@?տ?ĉ%?v?u?*SA[B{èN{S*[cksR=qBzTq@Tsb;@w@cKBq,Ty@)X@<u @v @T@ 6@?Հ5*qMT*SR*Rs51aTR"S*B2*Q R RRs51AT*q[B*SAcCkDsE{Ȩ_#@chb8h$8jz8?? *R*RqӚ™s2? **5@?ՠ9Q@?Հ5*g*SR*R4 R5KqT*qsq-Tjy8?? *R^*@8?? *RS*{S@`J@!#< `J@!`6`J@R !1`J@,!B!ߐ4!h&bِ5 `@2`SAR@{è_ R{SH@KRSA@{Ĩ_Z5A{SR5@@sb@dbc@aT@ @ 5R8SA@{Ĩ_s.@@B4@B@b֠_{ g@?qT @{¨? q @{¨_@!4@!@a֠_֠_{P@q {_{S*A@qT qTq T*SA{¨SA{¨_֠{ &@` @R{¨_{ DR @R{¨!!.!1V{S*[4sQ1!TSA[B{è_{  RCy R'+A4a@`>@! @ !<!*!2+`5/@a> @{Ĩ_{ }QCy)*`5G* @{Ĩ_{S? qT T4!Q?qTX@P@*s Ԛ RSA{¨_!Q? qTT@\@!3`@{!RrS[Rck+4R#y@y!<SCq* 5`R?#yzRCcRs)v* 5@ZaJ @BZq TqAT?q`RCR` bN6`6@2`6a @ R?kT[B*SAcCkD+@{ݨ_@R r R?9RzRRRrRqTcy)'`5@Z`7@Z@6`6@2`6*(A_jTR){ R* @{¨_!R*qd@zT*L2͕0qTA!# X`_2{R RCyR'@y!<S+`5/@a @{Ĩ_{!?qSB_qcA9@R?q3|>RsjTA9A43|c\SRb@*yB2RcR)5}R!Rb~XqAzaT~@s~@5?@87!?$qT >CT SA@{ƨ_ր}R{"|S*!R[21!TR6r`5?@@6 ?8q!TjTЄ3#%RaRB\3 R[SA[B{Ĩ_uQqT}*qTЄ3&RaRB\3 RC @5{R#yR)CBR6{è_R_{R#y@7!R?@R!C;{è_֡R{S[ck+I@d`.@9W7@TЄХ4B\3>RaR RSA[BcCkD+@{ʨ_a@5*R;R?a@4b@7_qDy |S){)`5 TR4Є4d8RaRB\3 R* T`@\TR{R@RcyR+)c{Ũ_ с{S@@_kTR{@SA _sz5B9`B9?k`T vC9`vC9?kaTC9`C9?kTC9`C9?kaTaRRƎ4 {S*?qTiT QqHT#R!R5szqaTsz5`B9q`A{@SA _R тR{S[@! ?k(Tsz*@5@@ҷ@@9`C9 qTa!!x`?R r?kT`րwK ITVRr?kiT`C99`C9anB9QB!_pqR9bB99`C9B7`4bB9964aB9a6arB99oӀZev`B9R&RoӀ^`F@9_8<S  _8!+B4dC9|!avC9!|!ma c T4a6B9`:B9@!\S @ a2B9_q"R aC9!| `vC9|mӀva wr`B96`rB9@AT6#R* |*5 R`9`C9TS@44`րwӀV`C9avC9|TS`B99`C9DӀ9R{@*SA[B _`B97Z@8J$E @u#RB *H5B !RC?qTB {S[*Rc78A9 !Rcpc*,*4qTqS:T**,9[B*SAcC{Ĩ_ {S[cks_qT@Rar RarkTЄ05P㊀RaRB\3 RMs{@*SA[BcCkDsE _փA9{7Є5PR@5Є6P#R@*z4 X5@ 4ЄХ$7PB\3#RaR R@*@5[S*2}hbD4Є7PRaRB\3 RRR${ "4 B@6"R B b*[T47Є8PR1* 5zB9~B9\S@ vB9 kT*ЄX9PRaRB\3 R"@9B96@2V?R$R *!@!6# e@*c! ~6qATk TB97:d*nB96dD;P㖀RaRB\3 RU4B97#R* E@5 R9C9TSRpSQ!R'o7*5o@qTrSQ!R'+5qTR*R#@*!Rc$`5#cqT9nqT*b !R`5_q`TB9kT#R* * * !R*`4*D7@B B)ka?k! 9(_{S[ck+@`5`~@b6!;>`~@b"!;9*R`* R`9`@RqAzT`:@h`:`@* 4[B*SAcCkD+@{Ȩ_5һ`@ @5*5`~@`z R`&"RRP*5_,9RyA5R`@ @ r@RkRg5A9qaT@R` 5}RRR9R:R[Ry )`5`@ygb @ @_k 2 k5o@7qT}jb @AR_k`T!Ra `>x^`yR1T*q*5`>@ 7T ҔG R`9 v7d< B\3mRaR R n*l{"Rr @!@!*8UA5d<=#tRaRB\3 Re@ @{¨_R!@5!Ra9{S[cks|@`@@4R[B*SAcCkDsE{Ԩ_Ҿ`C94`C99 5@RyR"R)5*53`1`Ry`@y<SR=*5` @`6Ay`y RyR`@y<S,*5Q)b )R)a )e @RkTCtZ q T_rTqTqT@R#rc ECccB@dVf @che8e q"xb0LeFb|#Rb )LPb c d@cc$4S@A*!_q A|@ n|` @RBbkIT`4`B@1 T<SRy)RyR`@y<S*5:R`9z`*5 ,@9*5c @)69*5v6@3`:@tx jTd =/RaRB\3 RtA? *4:`>@97!R*5`>@78T %R` `>@x^` R`y+qTRfRc@RCracR_$SxA*!DOx@@#jaT"Ҁ@5k{ jTRkTRkTRk@$ך@6Ry`@yR<S)N5qRyxS)C*`5RkTRkTRk`&b @!R@_kT@`" 5a~@qaz`RRRCy`@yR<S)5RCyzRcR{)!5ҡz`!Zz @aT @ RaRB\3 R!@@#jTv3@@9q?kaT@@ jT @ !Rcx*5@RkTRkTRk`&@?,qT=aAtAێR !Ra~@azR" R`&2T"RR?0qTaA0>X*5 @#7@`"5a~@qaz`Rz*5 !Rg*`40qTa!!X`R "R_!<@R_{`pOS!5!Rp R*`5* RL1`Ts@ts?b4@`@`!@_ATRR@*SA{Ĩ_Q*@4@^3CRaR@ Rn@,@`{{@{S@*5-*`4@*SA{è_|@@!4@! @a֠_|@@c4@c@c֠_|@@!4@!@a֠_|@@!4@!@a֠_|@@!4@!@aR_|@@!4@!@aR_|@@!4@!@aR_@6{D@{__{S[|@`@4@"@#[BSA{è@SA[B@{è_{S|@`@4@@#@SA{èSA@{è_{S*`,@9kT`A9qT***`5@)D@*SA{è_Rs{* * R 4* @{è_@2{ R1P{_{R|@c@@{¨_{ RS@5@R@sb@ab@?TSA{è_cC90A4s.@sb{[Vе?S3R#c R'@ <SA[BcC{Ũ_B5*1*q`T5@@4 @s?qs@@@$@#R{S[cksT@*o@[BSAcCkDsE{ɨ_b.@9* R@7@* BcBB9" 7KcccBxތR9RzRRRT @ˁ6@@4*B T @`c5@c||?qR%Ag7y)57@g@y{5RyR)5s}R>`4ҡ@7R{S[cks@*@.@9* RB7a@U5Z4R\R`@@딒 @)T @ftSA[BcCkDsE{ʨ_4b@7`y`@_qS){|9){44FTRyR)l44}R5`@`!TC@C_C@C_ D@@$hTE @C)F(@B@_qkBT(@B4c$š!$šcKc|c@&˿_@c!R!||ha4h!!R9_"||!hb`4 @_{#@* ca||ha_qB{_R@|`h` 5E||*b"$Rdh%Ad9_B_aT`{s`={¨_a!= P9@6?9_{ z* 5eB@d=*!TXAc4@*| @*{¨_*C{ @`ZA`ZR @{¨_ ?4{ ?1aTR`ST@@!7`=FAT @4|@ @{¨_{SR[>ғ5@4|@SA[B@{Ũ_ր@9'qT#w@'@a@Ta@5`B@nw`@ @`43@XABQX6{cc4!BpR8"Ȇ@a_&@@(T%@˿T@P6$ R 9R_8@֠A{S@T#TRSA{ƨ_@@F?@7a^@4a6@?kTL@+`?@_֠`A{ @#TcTD@eP@@CP6bP@+`?@a @{ƨ_ @{ƨ֠_֠R{S__k*5N@B@e@@   `?@7^@46@?k*SA{¨_@A@ ?*__@P6{?5#Q@%E@e@@ {_{  {A@ @ ֠_t@f@#T˿T _֠R{ @5cc!6R82؅`=RRRD@7`B`Z`6@`5`^@`6`@*4"ZZ_a@`&*4C!Z!Z!"R@ QB a)a@BQb2! TR @{¨_RRb@q Az Ta@ R@T@֠_R@$A@T@P6 _֠{S> ݱSA{¨_{S[c*#R$@R`Kqd@zTkhTb|@*5@҂j88[B*SAcC#@{Ũ_ccc3{SZ [c@@ 86sK@ R7@ @R7@` utwB B8RgBeB9BRR qlT!@ "'5'@$'C '@@94aR '@'@ARhT'@ '@h ) &RR Xss@R#1@TBD7BV9B 7e5Ba@5SAR[BcC{Ȩ_ց@?T/@6@| 9B@*q 4TRvRqT *J38'@@6'b`@)TR 5W`@T'a@`?T#4a@ `7b6G@47@7@G@Da@`?T6a@ `B@h5R8V<@B@`@@\@@X@@T@VD@!VH@!@T@@@@ T`VP@!֠_@d@@h@{S @@ @8@@?4a@?T@!aa@@!aSA{¨_Vp@!Vt@!Vx@!@l@ V|@! V@!{  V@!@?ր5a*A!a* @{¨_֠__{SR[c@''@@9?qTa'` '@@9?qT#R'Ɉ` '@@9qAT!R'S' ڇ #R`?Th χSA[BcC{Ũ_85''@B!#5`@2`'@''@@9?qTa@?TR'@5@tQB|@؀8u'@R?q$@zTc@BP8`@T{ @@@@ T@@ @@qaTe"@`*@@4c$c|@ $c@ D(@F @c|T`VL@!`?41Ta"A!a" @{¨_e@`@c c|@(1Ta&A!a&_֠{S@f@@@! A$A?(1a@AT!$Ab&A! !Ka&SA@{è_! Ab"A! !Ka"_{S@**z@SA{è_,{[RS2z@Rd@T@s[BSA@{Ĩ_ր@9`9@@ `@b@`@`@`"@`"2Aw`2@`B@6`BF@$`FJ@`$`J>@"`>N@3`NR@$`Rb@#`bZ@#`Zf@%`fj@&`j^@P#`^V@#`Vn@(`nr@'`rv@0(`vz@(`z~@)`~@`)`@)`a@&`:t @!a!aTv&@4.@?jaT`@ Tv@_T`@ A@aa@`@@!a@T@GR&`a@TccL@@7b@_q Tc@e@҄6@&|*hfTA4Q|@ a@_kT|heT!5Cc4![Ra@P6b&@`@B4b.@@ 4!xa\@a@P6b&@`@4b.@@ 4!xa@*@`*Z@`Z^@`^6@`6@@!!_kTiekITe@`b@š`b@š`a@4`*A`*`@`@T@!"_aTR_"XA5!@! R{S[Rck+ @3G3@@9q@zTR~ 2RҿkT@@9?qaT6R  57@`SA[BcCkD+@{ɨ_q5`@T@``@@*@!TtiÚ@ ` @ATz *@{s`{S[*ҟT[BSA{èT~`j`P{S[cR#9@sw@uTSA*[BcC#@{Ũ_a@`?`Tc*@6a@* @*@ *~`@{[*cS#klTR^@TSA[BcC#@{Ũ_@A`@c@b{S[@ @ RSA[B@{Ǩ_H@!`6!4v#7`6RMT#@@`'!!>Z'`6Rc!56c@2c#@W#*@7@T@M!@a @_@5`B@?_`{R_{@_@_?@zT{S|@*`*!8x4` )ta`@"B@(@ `,F?1TSAR@{è_,_`B_`E5!R&_a{,A"@$@oC *ATcc!TR8!5cc!TR8HB@6GB6XB7cc!TR87cc!TR8%@4cc!T‚R84! @kTcc!TR8ۃp6cc!T"R8σudB868A$Ě|S`|G4 !R! ?kTcc!TR8^@{__{S[cksV@>O1Tu@dBR&`ZB6aB){:RkTRSA[BcCkDsE{ʨ_lBkTu:A`fB&t| ~@{#@6cc$!Tb=R8v`@c?_ 41`T(1aT@ }5`@9kT`fB@#{ 7~SbFC!|@cR` Cha8*@h!8`*A`*{S[6Rcks*@@: "QSs~s~@a6@! H ^BB|@RR&RT s*SA[BcCkDsE{Ȩ_RfB 7|@!"`4B ˔B o o@&RgR6(1`T1!T*JRTs˔R kb8R`)  jT! FC S!|)|@a84kT@!c*i)8.A. 9qMTB a* c*!cqci)8*A*{S[cB@"87@dBRSA[Bc$šcC{Ĩ@|kafBc:AA:T`:AafB$ anBQ?klTR zuc$*e4SA[BcC{Ĩ_*5R{sS[ck@p@9a@qcRA@?ovgB86a;A6$֚1TaoBR~ *s:@9!Qw*7a@6$֚!R{z@1T  6w@@*RkTDХ5VRaRBT Rn`SA[BcCkDsE{ب_s@5RhGC#|c8(Sc(C7c_BugBK?@5 cxzkTB! #B9 k9qTTqT q`T"qTRRRoo9~@b_Bc9g9#šp6agB"@ @ |@6S@?!T`_Ba@`&|a@c!sa7 L_!Tc_B*RB|@+ÚK 9{`@@@@@6@? hz8$8aR(KRk+ T R{`gB"R@ |@ 7@{?na@Rs@! sw@! w7{:Z@@Qk TRdRRo7R**RwRoR!RbRos@*ca!6@ H9 !93R{@{@3`@Rb&šBL{ @@  s@cbGC $|!SBd8 B(B@(! bhb8!|@o@ B ja8" j!8{S[cHCLCDCfB!R@! ^B (R|@t@@ a86jB**|@ @@9B@9@@9!@9@ h6**`7W@h6**7[B*SAcC{Ĩ_s{S[c#dB @86`:AunB$ךR8QklTSA[BcC#@{Ũ_`@5R$ך@@Tzx?1Tb^BCR`fBdFCK!(%|&Sc e8(*%8@qT@4`fB!|@! z9 @ 6@! !KRRHR)R@  klT4@4QafB|@ *fFC|SBg8e(!c*'8q{S[@6@@6BSA[B{Ǩ_`@3'[`@3741`T(1T`@a@ B ˵B {S[cks\BdB Ko@@ 6@$Q86:AnB$Q {><ҀQ?kTSA[BcCkDsE{Ǩ_:R9Rk<8R`z<`@fBkTb@~@B a@b@6a@z5A9"wz[B*SAcCkD{ƨ_49?@3QKs!4@K!|@@*qd@zaTR*?|@cB_B/}q*Zz@T*?t|@ˠ/@˔GRRR&h`8hf8J06Jf&JTa||A*`gS@*|!*` @*`!*`D* S!*`S`*S%**gS*S*S*c*S!**2 *A9@9RE9_D@9`@9E@9Jd@9B@9Je@9J**4DJ RB |S_kAT@Jb _TqTEJ RB _k!TpSctSbB*xScc*`B*|S C*B**@*|SB CCC*"Rc*B #h`8BJ"h 8 R_֡<S *R*5?qT |SA R@@@9?_@@y<?_@@y<?_{"R@9`?{¨_{!BR@?y{`?{¨_*@AT_$h`8d9*@AT_d@9$h 8B|@AT_$x`xdyB|@AT_d@y$x x{S*$AaBB4XEy6A9B9"R99?@5c&A*bBSA{èRSA{è_{#RS[cks%C48C9E7E8B:E?~@#@z5aE?k TzE9@RZ5SA*[BcCkDsE{Ǩ_d C7ZQ?֜7@{bB{`Aha8j 8dC?6&A&ZQ"Ak#! "{S[cks;8Co7B6܅<8E5`Ek TcC[BkDsE#ReCSAo@{Ǩd CQ9Z?bBzacka8!Ch 8R  B@4{S XEy6dABRҀ?b@jt8@?֟ATb A@?rSA@{è_`A_`A B4{S XEy6dABRҀ?a@ ?֠j48ATRSA@{è_`A_`APBb5RPAB8AB$@BAB@=AB?@B.T?qcP.B.B@B.@BP @B@2@B 0T?qc`1B 0B@B.T?qc/B.B@B0T?qc2A0!A!P(BaC?TKkҖ~:CR4 o:C`~@4~@`o:C4ks?s@?@K@*AqM)*@?*5k@TzB{94`jkT@g@g@?@g@@?ִBR@;n;@@@6ˀ u@@@?[B*SAcCkDsE{Ȩ_֓R{ A`B\BCK#  R?dAR*?b A@?ր7r @{¨_`B\BbK!({RA*?R{__q$@@T{cS[6*a@ ?j48kHTSAR[B{è_@`?_{S /o`5n*n<TaA ?4#R"R4SA@{Ĩ_#R"R5@976@9 07Cc?!rR5t@9{Rk*"S[csW~)8B@\@)***@5 R R aE?kTq T[B*kDcCSARsE{Ǩ5kҕRox o@4*SA*[BcCkDsE{Ǩ_ @q)T*RR 4**Rs"K{ R{S[ck+6E7E;B~@5E~@q T@B@`BkTSAcCRkD+@{ƨ4*R/5BEs4R'5@{*R5BE{4R5@{QRSA[BcCkD+@{ƨ_{S*R@@554@aBR@SA{èSA@{è_{S[c2RaAA ?4`BRR`c"_mC';+@SA[BcC{Ȩ_#R"R5A9`77}nqAT{Sm*m(T#R"R`5@976SA{è_{S*[**?q! T@kTUK Rc@bR`?bRc@*`?ֿ1T`VB6qTTBqTc@R*`?֢Rc@1T*`?c@~R`?`VBp6c@~R`?c@"R`?֟q`TTBqT~qTBq!TSA[B{è__qTUQ!RRbRQqiT~RQ$Ԛ 7`A[B`RSA{èmBqTq`A@`Rmc@bRR`?c@"R`?[BSA{èn |m[BSA{è%{S[**?@qAT@RU c@*bR`?֠ 1T1T`VB6qTHTBqaTc@*R`?c@R~`?֢Rc@1T*`?c@~R`?`VBp6c@~R`?c@"R`?֟qThTt 4`A [B`RSA{è-m*QqT~RQ $Ԛ6SA[B{è_֟qTTBqT~q(TBqTVq@TBqTq`A``Rmc@bRR`?c@"R`?[BSA{èc@bRR`?[Bc@"RSA{èc@bRR`?c@"R`?֬ l[BSA{è_q$@@T{cS[6*b@jt8@?ֿkHTSAR[B{è_@`?_{kCS*[cs@t~)`@)UB WEs *@5` |RRT5*a RRgkTqTSA[BcCkDsE{Ȩe* 4@q(T*q,TkbӓRkg@9 5k@ R{K"qМR )`5M)K*RR4SA[BcCkDsE{Ȩ_*R}4{S[ck+6E7E;B~@5E~@q T@B@`BkTSAcCRkD+@{ƨZ*RU5BEs4RM5@{*RE5BE{4R=5@{QRSA[BcCkD+@{ƨ_{S[ck+7E8E;B~@6E@5`B@`BkT[BcCSARkD+@{ƨbC!R@?*R`5bE4R5`{c C`?*R5bE{4R5`{QRSA[BcCkD+@{ƨ_{cQS[Rcks8E E{ B;@b u@:B@78C{@  7@G~@{@kkT;@d;C"cEaBkT[BcCRkDsEb@SA{ɨbC!R@?*R5@k@k'*47@Rj@q@zAT4RjG@Z7@c C`?Cx`h`8%h#8SA[BcCkDsE{ɨ_{S*R@c@554@aBR@SA{èYSA@{è_{S[cks98C:E6B;\@7E75bEaB_kTcCSARkDsE@[B{ƨ3bC!R@?*R*5c CQ`?z`#k`8#h"8SA[BcCkDsE{ƨ_{S*$A c&A*`?*4$BvRaR R@*SA{è_b@*@?hb@*@?5b@*@?*a*b@@?{[S@C)q*@!@B@#_!TkBT$|@@?T\B!$Ú*Ú!!|_ThB*֚*b@*@?`^B*O`4b@@?[B*SA{è_`~BkaT`~@@\@bzBqTc*CB `?*b@@?t5@c6C{Sc"R[syiaVB?`Bk6xk@'/`ZBC6`B)KVRRq`@`ZB`x6qTSA*[B{Ȩ_ 6R{S@@_@@@ TR@@qT@@@e*n*SA{¨_sA{*S[c**#**7BK**7BK**`74b}@ Ri4"@Ri4~@Rit  [B*SAcC#@{Ũ_**{["ScRksZ~)V@)3B6  8E @\@7~@;5`B@`Bk T*SA[BcCkDsE{Ȩ_bCR@?*RO5bE4RH 5`sbCAR@?*R<5dCҀ?*bE7@sB4R+5`@s(1aT`E7&A&QaEfE*;@Rb`*7"Ak" "R4{S[cks;B4E5TB9EaQ! ZAӵ!!K<7P~4dA*R?4*R* 58RkkT9QRz9#~k,TRbB@4@R`5*QklTRkT*SA[BcCkDsE{Ǩ_d Cb:C3oB#?`Eo@3@c `ޅ!"L@B%@_kaT RdE{KQckcg j B d|jRcc:CdBB{`a!hb8"9dC~@b:CyCB?(1T`E 7&A&`E `ޅaEcERfEb:CB7"Ak"! "{S[cks48C:E6E8E B[@3~@7X5aB@RK53@8aE?k,TyE~@Ry5*SA[BcCkDsE{Ǩ_bCR@?*R.5c CQ9`?7@bB{`Aha8j 8dC?(1AT`E7'A'9QfE**RP 7#Ak"! #{S[Rcks*#B@7B68C8E9E:E*`5*RR5aE?kT[@<@R5*SA[BcCkDsE{Ǩ_cBz`aha8Ah 8bCR@?*R@5c C`?dC7?(17@!T`E7&A&QfE**R@7"Ak"! "{S[ck*s$@`B#֚"5"a TU 5R@@hB\B&*@?4R9K&ך7R@R";Җ @9vRR@5a^B~@*#S4R9`^B#A9b@ q@?SA*[BcCkDsE{ƨ_`~BkT kJTx~bAazB @?6R9~@`^B"`bB `#T`zBjATb@9@?b@*@?ָ*{S-*4qП@*SA{ɨ_`ZB7 RfabB R 'lb@R`@?*`FC5*5`*A`*RUHF9LF9! Bb! 9RdB! R!| SB A|bD!R! 06TB!2T_{S[cR#1*5b@RuB@?CRR* 5`BF9RR`FF9*5aBF9@?k TVSA*[BcC#@{ƨ_aFF9@?kTҠjb8@5B_T`!!@9|"hb5cja8hc8k`T T_q Ҥq T!klT_kT|#`Zt4Д"!`VBx`V@ B@yb4B<@"Qe4@`@`F@y``JF9 B`" 9@l`:`VB@*`VJ@y`yN@y`y*@``@`@`aVB 86 4#СРc!b"Rk`VB**`Vc@q7T`VBR``Za:AqZQb^ $šQ`z`@qZZQ`b`fA44?q!Z!Z!Qaj!K?@qT`VB2`VR`!`q)TaA8?T``ZC @@[BSAcC#@{ƨր&@9@?kT@`@ (5cRR5c!d5R*`5u #R R*` 5C9C9A *? k,T9?qT*$Х@cR RBUUR`` tB `@@tBA9RFA9NA9 JA9 @`brA9vA9 zA9@~A9 `ZqK!!QA aRA9VA9` *`A9A9` A9@A9```ZKA9Q R |@a|cB|`:A9`" 94`VEy6aVB!2aVA9?q T@Ray`y*`6R`6R`6@R`B5cRRB5c!Dd@5RJ*5u#R@RJ*5?)G9G9A *? k`T9?qT*$ХR RBҩRPqT`?6_q)TaA8?T`2@96@9 *RlS<|.^R5:@9*$R!\S5 Q !|@@9@9A *? kAT!c5BC@9q`TC@9B!# qT@R``tB`@@tBA9RFA9 JA9 @NA9`arA9vA9 zA9@@~A9`@Z_q`KQ! aRA9VA9@ *`A9A9@ A9@A9@``ZxKA9Q R |@A||`:A9`" 9`B4`VGy6`VB2`VaQ9? q)T`Q9`y R 9`B5@ a@A`@l`:@5aZCA @@`JF9 B`" 9 @@ ?`VB@*`VE@`@`|S` R`" 9k TRL!`?q!Z!Z!|^@9@9 *a76 Ry @9`4 @9`y R!@9 `yl@9@9 */7'6R{S[*c#@!a@qT`VB2`V!(+6`ZB2`Z!pk !Pdq!@T c*@ 4R1!!,c*4!c4!b4!b 4!b4!,b`5R4RTRtRRb4!bq! *!!J6$<<=2RaRB R{[B*SAcC#@{ƨ_ִRURU4u1@TtY7yqMT`!6`E2`aVB!sc*4b@@?`&A`B4uAhӿqTaB4RK&Rұ\`4ZRKQ1TaB*R5c&AbB`?@5tR* 5b@5R@?ֿk*T*b@*@?CRCRWCA9[@b@?kTGA9_@?k@T@?`:Aun~@|`@?t}{AS,ABT#c<eR!8htdEB@6`2@@`>@`*@`.@VB``6a6@H7`:@``@ `"@$`<cfRaRB RçSA{¨_րVB`7Rp-\::C@!4!@ Eb@b?q T@_q@TT_ qT_@q@T#kRc<:C `_qT"B #BB/bAB?q@TTA5!#BP2c`)bb2a>!cJaNBB`"B?q T?q`T? qT#b|Rc<a"@a&@aa@#"mRc<za2@! a2a2@! a2a>@!p%a>a*@!P2a*a.@!#a.aJ@!aJaN@!aNa6@!a6a:@a@a"@!a:b"@a2@b&@bb@aB ?Tb>@!p%_T#qRc<3! ;a2a>@!a>a*@!-a*a.@!a.aJ@!0(aJaN@! aNa@kTa@A5#bsRc< !R!$a"!(a&!4a2!a6!9a>!P2a*!#a.!aJ!aNa@a5 RaaRa!RaaF@aaJ@aFaB@aaN@aB"d@*b@5c@b|a kT#BRc<#vRc<"@! "b@B|bVB"J9H7qT?qTT?qT2A$~E!x?qT^B?$qmTB2V@qRR!9VB!u҄*~!,K!TS! $:!3J!&N!p5R!=n!~!! 6@`@ )4R? q`T?@q!TAR22 |S6 J9?qTXB!2XR_{ `RF94`@@a@ `>`B@ `BR`j?`@RSA@{è_!R*c&@R`>@b@cB Tdxa!Db@ c*@|SaB@Bc`Tdxa!D44Ra&@B `>@!`z@aB@b@@5"4`*@B B|S@! jTR5RajjT!R4Raj?a@ 6@Ra@`j?`@Ha@?`@Ha@?`@H`n@QqTa@?`@Hu4 R`*4 R`.{S[TC`C`@4\*`@@?`4E`.@5\ T@ /BD @ñRaR@ @g RSA[B{è_և  ñRaR REqDzT`@qR{CS[cksRҵU\"RJ@!4 *qTP ܀RaRBD R){A*SB[CcDkEsF_֠J@! j@6J@!\d`6 RJ@R!RJ@!z @q- T bB+c! )1 J!*k(nb @kTR:RRU&@ @@?,2?Ձ@ oqaT!@HTAR)@ RrARB*bR?`Cy! TB 2 (  T$,T`@!SBD (U@RaR@@ls  RaR R?@xyC@`ur|VCcCx@@` 4`@@?hHx R@R!a`@?q0*``@@?``@ @?``o@QqT?`@(!Rf* 5@ 5BcC4Ahqa+TARRK?ց@ ?@@?SK@(@!*b|ib_k@Tc$AT@BD xP%@#>RaR@ @$`@BD *@'@ȀRaR@@WR@q@0*`cCp@ 7,@a@?qA0*R@T`@as@BD *   ƀRR R`@BD  /@CR@R@@ @ڟ9 @kT_qSsARRR? A@?6@ƀRR@@ @*c|@cCc WOj@j*HH }RBM@)@ @!|}|!̚̚ ̚? k!Ћ kЋ\S,*@@|̚ kЋ kы=SM* *A5B)!|}!̚ ̚? k!Ћ kыR *R*A@!|!̚? k!ЋKC)k}B}k ̚B̚ kkэ_ kkmSBЍaA*!* )?" @@? @O@ W@`@@@q  T@2WB2W|@@ @@q l*`ZBAR*`Z @`J `N@@4@4<!<*f@B<rhB@R!qbBRbb@_q@ T"Rc g@4k! Ti@ k T~{WA)c@c@c@cbcO@Bb @bb@ 4b@0q@RB ?kATG 5a@BD !@x(@ cÀR@ @'@aR  #>RaR RZqR!K! Q?ql@? qaT qЁm@hT!  ȀRaR`EyaEyBb@_qATRc@RcÀR aR R  a@`@?k T`o@QqHT``?q`'@a@`@ `;RS`'a@`+`@a^B$@@@5`s`,@@Fq`@<*a@\Bq 8*`A@? q`*``5@qZ`@BD *h@΀RaR@ @q  ΀RaR R@  CRR Rs4p@c<q%,@S'F%F S?q`T,T?@qTlT4?@qTхp={CBD @@RaR@@ @4{AR_?q T?qT"R4R"r*?q@TT?@q T?@qTR_?qTRr*%*0?@qT&@ 0@@@kbT@x@H4t*Rr*@ @ "@_kT\Pӟrc@*B)?q_@@*@_kT B*Tcc *t*Rr*@B 0@#@kT\SR)#@k)Tt*Rr** R_փ\Pӟr<Sc$@#@$@ф ҟTchc8q`T@@@kT@@@(@kITt*CSR*@B @kTRhrb*|)*RŠr*RRc$r*4 )R4Rc" r*R RbIr*)І  R RaR4{S*[*c*kTC`Ca@a6ARV Far@?k@Ta@`r?`@a@?`@ Bq`TqR*9R.yyj****5y.jSA[BcCkD{Ũ_ֵR*ҤX*`@@?`4`*@5X T@ЂХ8#BD @RaR@ @SA[BcCkD{ŨІ  RaR Rzr`TBqTb@a@@`kTBqTR_kTBq FzTBq@zaT!QRk{S*[*c*TC`Ca@a6ART Far@?k@Ta@`r?`@a@?`@ *8R`xj***Rc4x`3X*`@@?`4z`*@5(X T@Х8$BD `@cRaR@ @SA[BcC{ĨІ  cRaR RjSA[BcC{Ĩ_{A@ Rc!YqS:T*@Х5BD @RaR Rs{¨_R_{ @4@@?*6*%ЂХ $BRaR@R[* @{¨_{ @4@@?*6*%ЂХ BRaR@RC* @{¨_{ @c4@c@`?*6*%ЂХ BCRaR@R+* @{¨_{*[***B$S**\Vd****}\5@@DSA[B{ƨ_{  \5@!@a @{è_{S*(D@*?SA@{Ĩ_{SPTS\@*SA{è_\[*5q*5`*g[{{N{S*@4` @5*  RV:@W@?SA@{ɨ_֠{S*έ@@*?*6*%Х <6B4RaR R@*SA{Ĩ_{S*`5*SA{¨_{#RRA?@7@9{¨_ARRARҁR{S[@RSA[B@{Ĩ_ A?q 4KT s @%{S[*cF9lCy`R`9@ R`ny4Rx9wnySA[BcC{Ĩ_d A*? 4|@ T7 @@dR_" #@kaT @_! ?!T{S[*R\O**ȖSA*[B@{Ĩ_u{SR 9`@\6RSA{¨_a@ ?iT`A`R"9`@\ 7C|S#9# @9*c4H#$9#`@9c4H$d9$(@D4"9b6"@9cS#`9B2"9"h@9B2"h9"(@9B2"(9"@9B2"9"@yAq@T"*q *@R 9"y_@{AR!rkTF9F9"*9 R9c)'f6@RCC'@cc\@7C@9{Ũ_RR{S[UU)T`@ЅB8 T@iRaR@ @I a*A ?ր6SA[B@{Ȩ_ֱ@7aAa(6r TdARR?ր *A6eAR!rkTaF9`F9"*9 RC9# )?ae6@Rs?`@#\7A9r@ T`@Де:v(6Х@bR@ @aR6`@Х< @@cRaR@ @dAR RRRІ  bRaR RХ@#cR@І  #cR  cRaR Rq 4R{6R  iRaR Ri{S[cks@3@cTL7@`A*4A?TQB3@_V.`A6@6`ARM Y@z6[8T`69h68dA?_;{|@5@@ š`TeA?@SA*[BcCkDsE{Ǩ_{{SdACR!R?֠7SA{¨SA{¨_{ 6 @{è_`6R2979 5qT7{ @79@R9 @{è_֠{S[ck6@@@ ` @:@R9R9v5R 5R4*qR9SA[BcCkD{ɨ_փ`5{*@7@A@6TA7cG@Z*@5 @7 K^*46R*cc9GF9yF997A@?*@Z*5@sR*{"R!*c9A;yAR?cC'F5?@c'yZ{Ũ_{"R!c9A;y!R?cC'@'bZ{Ũ_{S RbF99`F9[y9AROS/qT`"G9@69bA`@Z4|@SA{ƨ_S@S`@7Z|@S@q {S"R[A9F9F9{yF9!R9*C9_c7kGA9|(CE6S@C9u c@oZ4|@SA[B{Ǩ_ր@Y5'@c@'7@7{S໛R[rcRkZs+{s7@bA `Q _z*$՚6"՚*7 j`8"@ @9y`R9@RG &@999B9 cA|h(CS9@49 *Ҷ7"R 9j`8"@y`R9@R)O@49 qT>rZK! Q!5SA[BcCkD+@{ʨ_%!p @7 rX@9a9@dP@9T@9 `9ZKc`Qc4!p r7 PB9a9a@@`5a9@aqTqTn@`"RR_ RC{S[cks@C! R!r! ! !0!P !!0! )6|@@H'TsRR`*@ya@|{`.@y`@7A!\"2`@@H@f7AxA y2aR9! R!r 6RybR;9a@a(6!R*R;y`R{9@ R r#`@`06A2R{y` R9 R rC`@`6A2Ry{9!R rc`@`6A2Ry`R9R!rABR9 2 R9R r!rb@06!2 AR39A0d 4`"@9qTqT `@@a ?9a@ 0T4h7CQCR@7@`ʈRr?kTWB9qATcB9B9 *RkTkB9q!T[B94}RJ RP* 6`@B8"6 @URaR&@ @p_4G49`@@@?`@``@t aB!*@Wt`@``R`9 R`R`{@` `;'`C`G{`@86`A2``@H6`A2``@`6`A2``@p6`A2``@RR`@```@7C@ @X6Axc@=tAT>7`F95`2@yE4`9`F9 q`ETqI=Tb:@9B5s`@`@CG9!GG9KG9B8@ aRR@@ @ {BSC[DcEkFsG _B@C`"1Q`5Ss"& R aR R   URaR R_[B9cRN!?aT@9?#qiT@9@99~ R\S@*@9*P?C* "*7@@qTAq@T5`R`9`9@* 6`?T Є@pSW[cCR@)A{b@j T `qT!R%R @){`$r Td@ @4@^T~_ T @_T ,{CS[cka@9`@9t@9@ `@9 @a@9``@9 a@9`@9 T&;@X<**RaRB& R{ASB[CcDkE_T`@9@ 4*R`R@9*aV@9u^@9#WN `Z@9 @!CG` Z*qqEz`T(1 T`@9~@a@9 `@9s@9 @!CG`s ZL*k`TR74R k@LjvS**B@96 _R@F!k`T@R** 4q T Xe&;@+/RbaRB& RqӀ k`˜*8R*'R* RR`C{CS[*cksҁ$@9; @9,@9<@9 (@9) @4@9`0@9 Z 8@9 @@9`@9s Z @9 @@9`@9 @9@9@9 V`@RE|)c@9g@9 k@9@o@9 `Z s@9w@9 {@9@@9 `Z @9 @9q  b@kMTb <`5%^@^^џkT?@)T*{ASB[CcDkEsFC_@ {Ӂy:@BT: C@;@*G 5J@RE O) T) @@94L)G@@3 @9@96 @3 @9 @klT3S@9W@9@ [@9@_@9@`Z  @ <C@$U`^|kT`Cd#Ѐ@T;@=e8@8,bB&@RaR RːR,*;@** 76;@*@5d^@)E@N@5{@Z`@)Z*C@9_q 3C9@9 3C9 @kATS@9W@9 [@9@_@9 `Z Rd{AkEsF***SB[CcD{@C `S@^kaT_@{S[7%$S^@Q^SA[B@{Ĩ_$@v{C[S!`cks@T@A"|{ASB[CcDkEsF_Bw^y?T:@0e.\RbaRB&s R"`@1aTz@`bj@)\kaT `*eb:@ -B&#TRaR R @ZRvD@!` \S"|SB*"|SA`* Z*"929<S&9\SXӀ.9@<S*9*69@\SBXӀ:9>9R *7**̆<5`@a@` @ ?R{S[cks7D`|{B*SC[DcEkFsG_ `G9g{ocR4DJ`ZRD `^RD _|@ajR@`*Nk Ta:@`;pP@4B@* zV@R`*NKR@KRqJ@@?4af:@7&CRaRe Ra:@XN"@"`^_1aTz@""ebf:@>B&#R"@!T@?aT@T`JG T6g"(Ra^@k'T 6ef:@d CˀR@?1aTz@@@?1aTz@@@?1aTz@@f@4f:@6e(þRbaRB& R @6ef:@cۀRbaRB& R@7@`7 @ 7@7@7@e7@&66ef:@RRQrk(T6ef:@@cRb@kmT 6ef:@R Qq)T6ef:@R`RNBR k-T6ef:@,€RO!O@@@ @k`T6ef:@baRB&#ɀR R@ce7@6f:@6eĀRbaRB& Rj@k*T 6ef:@ĀRbaRB& RuYn@kmT 6ef:@hcŀRd*NkkT 6ef:@(#ƀRA)qT@kKT6ef:@ǀR$46ef:@ǀR@@k-T6ef:@4cȀROg!O@@@@k Tf:@6ebХB&ʀRaR R@6ef:@bB&ڀRaR R R*('E:!R"! Ѡ!@@@@0@94@9A 8@9"@<@9A`!Zk@T6ef:@ ӀRx@B@#RKqK@*Ez@T6ef:@< c̀RbaRB& R‹qӀA@@ @9q _kTf:@6ebХB&΀RaR R@6ef:@bB&܀RaR R^'@@%"@9 @9 @@ "@9@ @9@`"@9 @9@"@9 @9@ T6ef:@ baRB&CπR Rw" @9 $@9@@ "(@9@ ,@9@`ZkT6ef:@p πRbaRB& R^ @9@_k@T6ef:@ ЀR"0@9 4@9 @@ "8@9@ <@9@`Zk@T6ef:@p #рR"`@9 d@9@@ "h@9@ l@9@`Zk@T6ef:@ рR"p@9 t@9@@ "x@9@ |@9@`Zk@T6ef:@p cҀRKF K@$P@9T@9@" X@9\@9A@ `Zk@T6ef:@#ԀR) `*Rc?7R`*NkT 6R `!j!8 *<*qTā@Tj68 `@"R! T@"R? T@"RT@"RG@Tx63R{`*Nk T|5@@ajˎ@V@`*Na2K`6J@`:n@`z@`j*^5z!*5I*@]4J"u`BBj!8@ѱj!8@Ѳj!8@ѳj!8@Ѵjv85f:@b&cـRaR R9RY*H*F|{S@`zDkTSA@{è_֡zta {SF d SAR{Ȩ_{S[vBR4 `zDkTSA*[B{ɨ_zt#H ! `XD!X_XD!QX_{S@xzDkTSA@{è_֠zs@zss{CS[ck3 qTq**!Rt xcB@YJ`>G`@4f:@7ebХB|RRaR Rb`BGP`nFNLabN7@a.$@@4!$ša*@a@Aay9!2a99a>G"$@4$šk $B$DZRB|B   bBTSB C( ?kԀ`rb>G@@9 qT`y92`99A@aF@0AC@c$cJ |@4џT7ef:@WRbaRB| R@!š!@@@`r?kT D5|@4TdbN`K `Z`^4 `fKdj 7ef:@#YRbaRB| R`b`ffbN'QK  ajN`V?@@T7ef:@]RqT|@|@ Td.N|@!hTj`T 7ef:@l_Ra*N?|qTFR! aB#hT!RaNKdR@@P7B@@`a:@XI R`N`.R=`BR*`4 :eB@d}Rbf:@B|aR R+RyvD?1T`9(@`NN[[@5RaBB  !"@B9Bx"@9afD5aBB!uC* *40ef:@0#iRbaRB| R`* U`BBKa ;] *@40ef:@(jRa:@`E[@*C**Ib:@ya!H_`zDkT$*5 ~@T`28 :ef:@@bB|CRaR* R$A{xa *4vе*f:@~eХDRaR R ef:@lFRaR R@`dGa:@*B@THb.N`a:@ dRNC| Ha:@`bFN!dJNcrNHa:@`dVN"bbNcfNHa:@`c2Nx#b6Nd:NHa:@#RdzD`bJ@X$BQHe^DRa:@`bDp%cDHa:@`bfD&cbDdjDH R` R5tIt|q T_֠{ASB_*{CS*`XDBQX"44 l$ef:@bХ)B|#RaR R!R4M`>Ga:@@@`)\H# :e`BB[~`>G7`BGW~`nFU~`>Ga:@@@`@*FHR{cKS[kqTRe*DCRbaRB| RDSA*[BcCkD{ƨ_R;7 #*`5/s R@@kmTcRmH/@@9b5!T@T**ebh+DB|RaR RД?klT*u#7A}* e,DRbaRB| RPa H)s2c_*6B@e ,DbB|RaR R9zs8@!R8su{SДҀzs8@!R)s!T5#4A}SA {¨_{*H !{_{S[c#ЦK߀q!TebХ<-0B|RaR RSA[BcC{˨_AqT*e-0㶀RbaRB| R`4sQ@`~@s8?(qATj 8C:RAz3sAT#@e.0cRbaRB| RhK R+@s ~6`}@/@x#RG'@~@Tw)TeT/6îRaRb RB|G ҡND!@9?,qThT4?qTeT/6ðR?4qTvӂ v*NADA73@"bARb4e/0㻀Rv NF7@bARM4e00CR~@ ҔNBK R\{RSx@B!(|Dxa 5cBBd~DSA"R{¨ SA{¨_C{S3@[ckR@/sCzDk,TӲRzDQkLTR@`_8xBa_8w2_8b_8 `"_8c_8 @aB_8``R_8{_8 Zz_8 ab_8@`r_85``_8a_8 `_8 @``_8 *B9B9@A B9"@B9A`!ZkT 1eb:@1Bp2RaR R* R{BSC[DcEkFsGC_75C@@ 59s Z Z*!*a7RNkKT 4FN!Q?jAzT  _kT1e:@2RbaRBp2 R\R 1aR:@e#R\5b RBp2M*WcQqH T_qH T6Nk*T 1e:@3RbaRBp2 R4 RuZ>q T`@9 4!@@? 5 TRuzr*zDkTs*I:@9>@9:@9 >@9BZB<r Z<BzTB<@BX?5 1 eb:@l4Bp2"RaR R* * fֲ@R`RRRRR@R`R{S[*ckR\D9 j TSRv@T*j`˲{[B*SAcCkD{Ũ_ R`9R`"9`&9`.9R`9~Sa*92969:9`>9R9V9Z9^9b9f9j9n9r9v9z9~9D;@D; d9<S`9\S`9|S`9``9h`9pӄx`9d9!@*`5~DVN"@S*`5# @)R*e{1Tq@TB@ A@"@t{S*ZZ`9@ttB@TuBBxB`6Na:NRK`f`zDkTR';8`< Rz@`.Ra!:>`RNZ@ )j~@`RNK|!: "`z(tz Z@ `J@`J`fDkT jwr2f:@ecQR;aR R`:N4e 5y%f:@$eb9Bp2c:RaR RqKTTR*5a:@`8Cyu@9@9 @9@@9 ` R'?7@9*@9 @9@@9 `ZZ@9@9 @9@@9 `Zz"@9&@9 *@9@.@9 `D9Z~6@9A392@9?q! ^:@9>@9" BZB<B<@aRN KbB=9BBB96D929BB9@6`vD1T hef:@9bBp2FRaR R|ky`BBvBfy`zDk Tzuayz5{v{9`J@`JK) q!Tb@ )@ : 9* @4@?kTD929b@f!Q!|":A:@jb@?k+TxyB>`zDkTRRrkTef:@=C[RbaRBp2 R'*7{uZ@5a:@@B@?kmT @?kKT@^@_kT@?kT@~@?kTR@7e&8@@9@!`ZfDkmTw+:@eR RaR:N4e <:@cRaR RtBbҺ!KfbDxaZ@ bvB@9@9 @9@@9 `|@`zRNA  b`~B9`^J@9N@9 B<@B<@b:u*^* 5`ZR~4` `Z@kTaK)? qT` )|"`:>"y`"`R2`:`Z@Zc`z@Zg`~@Zk`@Zy`^@ q9`D96C929b`:**5*RJ@Jw{A*SB[CcDkEC_`@x!!c:@*`` )`fbj RbZ@bD!KbfDbZ@! f@5 +e:@ +RbaRB R RtRt<S*99\S|S 996*@+e:@bh BcRaR R~uC{CS[ck@@B@xNN5^@*qaTf@k T ebf:@BC8RaR R~{A*SB[CcDkEC_րZ@kT~~R<3kTF@q,TZ@KqT`fDkT uf:@e;RaR R~`:N4e "  "? y?0YR{_!@!(x!_{S[@B6@@R!99`^@qT`D9t:x`9`b@* Ú"a )!af*aD9!xa9SA[B{Ψ_`j{S*[c`$*!\@? qATFN7QK  RKb~@8**4*cC[BSAR{Ĩb@*RBKB|@8***cC[BSA{ĨSA[BcC{Ĩ_{S[ D92 9RR&2```D96R`Z@kTv*n*5x* 5`@t`D9x`9BBRtB@ҁ!8 R*79&*`D92`94[B*SA@{Ϩ_*u*5ab@Rv~!*`t{S[ckLN@56`@!Q**Ԛ#4*_MT5K4Kk`@ҕ~@1 4[B*SAcCkD{Ũ_`b@ k@TaQ@T`@K:`T5`Q?T**@5b@*5`D9*x`9`@tc@*eA*4*vb@`@kҔ~@y15`b@kTaQ T`@KZ`c@*eA*@4*8@"PN"TN"DN" pN"LN _|qT{ `R @{¨_֠_@#@@C8@@ X@@ 8@@ \@@ @S@ @ S@$ x@@( `@@, @@0 @ h@y@y_@@{ @@3@_ q@TT_qT_q T"D@BQ"Ds @{¨_qT?T"H@BQ"H"L@BQ"L?P{S[c|qHT*AQ*? q T*j` 7xDk* TR0 6(@3qTqT`R@ qT 5`J@`J`F@`F `@@!T* *6~@{BSC[DcE_ր5`N@q,T`N`R@5`&@@`V@5 R`R`*@` R`VqT`D92`9`D92`9Ss (7t~@e:@CRbaRB R|sT{S[c#![BSAcC#@{Ũ_**6*q T~qT*`@ҀzDkTS!{ua @kT!$65***NS{* @eB@`@7xDkjTA7gf@?kTe*7hb@e k,Th^@qTQ?kTgj@kTeD975R @{¨_***4(1Ta^@?qATaD9!2a9*@@ @q`T#\@qT"7#X@kT#D97_֠@a7X@_k TD97@a *|S_֠1@T0  ?Dq$R4_R@kmT@jT@@k,TkT_{ PB @!Q 5 @{¨;r @{¨_{S[*R*/@\) **RBd@t~ s#"@"rR@IT*SA[B@{Ĩ_ր@kT@mT @@ kct{S[7@@LN5*** 5@~~#h`#7"h R*****[B*SA@{Ĩ_ֳ{S[**ck*s:@@o**5@v;6**m"@R5[B*SAcCkDsE{Ǩ_^@ q4`^R'/` aj T*#R3q3@*Ez`jTqTQqTaNNA4@ˌq***<!RaN< C@9qA@9@a C@9#@A@9a`!Zctqo@*cVN* (*@4q T(1aT^@ qaT< U5a:@4R`*,Q;u54**|544R"@c@?kT{S[cks5@@LN7-5*****5~~;@~~ha77@*cWN*  41Tay96RrkTa{D Rr  ` R(@C`_.ak TR{`G`K*`6`kp*aON!4*c**a;@G@*:*#Rq*Ez TqЀ***$Rk`kpk@*aOB !aO<S9\S9|S9`Ӂ9hӀ99pxӁ99*) * 5@O`CG<@R84qT7@@`CG4aCG$ cWN** 5`k˥pC@*;@*@$Rh!*a;@@L:**H[B*SAcCkDsE{ʨ_aCG*cWN*Aq*EzT***$R{@q{T`ksp*uK@a;@e:i`o!RaOn`_R-akT**s R9RWaOBR !aO<S9\S9|S9`Ӂ9hӀ99pxӀ9 Z9 Z#99Ra:9rkRu9!@ Z!Zar99Ra:9rkt9@ Z!Zar9@9 `:@9 @*` Z*5~~7@@~~hakTBG*VN*qEz!T`@9qTBG*u**BG@75*qT R`9 Z ZaR9@9 aB@9" aJ@9A@bN@9"`aV@9a cZ@9#@a^@9a`c@9q`T R EІ:@RRBaRB\ Riu:@EBB\URaR R]u R{ASB_փbNBZk`T E:@SRVN!Z_k`T E:@CTR {@TEІ:@XURBaRB\ R)uR{CS*HG7R{ASB@_A@9B@9" a @9A@b@9"`JR!ir_kT`$RBZ@r ,EІ:@BХ|B\RaR RtQW4,EІ:@@cRBaRB\ Rt{S)@9 @9(@9!$@9d.@9bV@9 `*@9cb@9fr@9 @a6@9``2@9g@9e>@9 `:@9 @aR@9``@9" aZ@9A@b^@9"`af@9a cj@9#@an@9a`cv@9 fz@9f@c~@9`f@9 f@9j@9@RN` qT:@8EcmRaRB RB\t:@8E!BB\xRaR Rt RSA{¨_֫ZZBZ!ZE* *cZ**%68E:@#nRRQrk(T8E:@@nRqEz,T8EІ:@|coRQqEzTQq)T8EІ:@|CpR Qq)T8E:@pRDR k,T8E:@,qR*? qAT!58EІ:@sR"58EІ:@psR!Q? kTK_kT8EІ:@#tRtT8EІ:@tCuRkh5*8EІ:@vRaB48EІ:@ vRX"58EІ:@!#wROA48EІ:@wRFRXC{S#*HG7R{BSC#@C_A@9B@9" a @9A@b@9"`JR!)r_kT $RBZ@r EBІ:@@"B\㙀RaR RsEІ:@@BB\RaR Rs 4EІ:@@ÚRBaRB\ Rs{CSy96*.N>G~!*6 d+EBІ:@X#B\KRaR Rs{A*SB@_R{CSHG7R{A*SB@_**4XEІ:@@cRBaRB\ RXsqsҀ{S[**c**ks*5@9\e~@ *9@G$.NR:>GO*4O@(1@T1T:@@*x$ 4R{C*SD[EcFkGsH_9qATW@#E(%RBІ:@B\aR RsW@T*1TBz9'6C{CS[*#RXa' *RRq*Ez`T(1TH a@9b@9c@9" a@9A@#`cZkT JW^:@aRcRE Rt&r:@EХ@RaR Rr i{A*SB[C#@C_**t{CSLNG#4c*41TG@ 7EBP*f:@B\RaR ReqTh*b 5 7ZZ_f:@RaRE R+Lqf:@RaRE R@@qa:@ *@,"2&R#RRAR`,h{S[ckCLN4;@EBT'B\RaR Rq{C*SD[EcFkGC@_***** 5***U*@5WNkTCz9 (6 E#"R;@.BaRB\ RpKG6**5KG6_RN%k T_N*gN~q*Ez`T(1T3 "@9!@9A "@9"@!@9A`!ZkT sZZ_;@cRaRE R|-p;@E@RaR Rp k ˌg5**/N~@?G~@Cn!*`5KG/N@6R$;@EB/B\RaR Rtp/N kT***Wn3?GcL*`41T!kTKg`js8"h`8kTK _qR;@ZçRaREB0B\ RApU ;@*@|1Z@t 1;@**@21&R#RRAR+;@**@2 1$&R#RRAR+ gK@ E3C#R;@aRB RB\p*** s{S R*@9@R@9 R@9`R@ 9 R@9bN Z!ZA@9GK~!!|@7c%*4qT <1*f:@Ec+R4B RB\Cof:@<1EBT'B\(RaR R5o{A*SB[C#@_cB9@qATqAT<1Ef:@5-RBaRB\ Roc.N*Ri*5`Bz9`/6<1Ef:@H6/R{CS[**c*5`NN4f:@=EBT'B\CFRaR Rn{A*SB[CcD_`y96t.N*RWl Q?q~4AzaT*R Q?qAz T`>GSafc!ߤ 54a:@@*8/Ҥ/*L*5aBG*d.NR^* 5`BGb.N`5x7Ef:@84RBaRB\ Rn`>GScү4 H;CBRaRf:@EB 7B\ Rnc.N*R`BGb.kv8*c)aBG*d.NRI*5`BG7*b.W)aBG*d.NR*5`BG*b.Ng5 x7Ef:@96RBaRB\ RTnTa:@@*`:*2/*qZq`T*1ATx7Ef:@H;8R6KR{S7@?TSA{¨_"@@?|"R#@`?`MQ` 7{CSF?T#@bC?|MBQ R#@`?*4`Ef:@B`<B$=RaR Rm{A*SB_RFAaHG6`46b@_aTC@aTc߀RE{Cx="@ BB$=!@aR8@ Rm{A@_?`TB@"@@R?|_@_{S*@s @D5ZB@?qSA@{è_%@#@kTC@|@@b@kTb@mTb @d@e@b kBaR_@"@kT@$@kjT!@mT!@kT RHG6{A@@5 |E@B >B$=@ۀR9@aR RSm{B__{RS4` MQ` @SA{è_"x"#d{SSA{¨_s @3@ @~ T` @T F{CS7FT`NN5` N`4`JG6{ASB_4 `28Ef:@B?B$=cDRaR Rl@T{S*[**RT!!\a7T)(bF`@`M` RSA[B@{Ĩ_`{SM5`F* R` R-! ` SA@{è_`zF`F`3a4R@@ K?qTRb7!*,A@@ `M` T5|{CS[cks7 @ pD)@4qc`FHRq (@*aJG{@`ZN7`ZR tD|@R *RqEz T"@9&@9>@9 *@9 @.@9`2@9 6@9:@9 ~@ 6 T`- TBT$=f:@7#؀RaRE R@V&=f:@EaRÉR Rl cB?0qT $6@*R5{A*SB[CcDkEsF_R@{@|@76{@T;E@B,B$=f:@c9RaR RkbT5ba4Av3` M` `TR`F@bM"cT_$qb !R{ASB[CcDkEsF Z"9&9<S*9.92969\SXӡ:9>9@*`5`DkTv@"A|q@T@`Fg1T`y9f:@7ECRaR Rk`NN 5 R`N~`jD5`fD`5ECRaR R{kQ9R`f**@Z,**44`fD`f`jDq T4afD!afQR`j`2N`2`6NQ`6T95bjD4a:@@ 7,*{S*[**RR7 6T)4(SA[B@{ĨSA`[B@{Ĩ_C{S[ck*CbZ5`^R@ ajT`FazF`F `j bR t30@@@!K??qTa4`` M` RIuvR@q*Ez`TqTqT@t1 EBf:@B$=eRaR Rj@t1#EvR@T B B$=aR Rf:@jVtB4i`B;R"@9&@9.@9>@9 *@9@ @6@9`2@99 Z :@9 @@` Zt*@4qTqT QqT qT`>NaBNkTt1Ef:@BB$=kRaR R{jf:@@@?1T t1EBpB$=#vRaR Rhj`j  Ra`F)!T7;4a:@@@*@*;+`jAa`M5a3 ** R*4`F VR***@4`NN`5 R`Nq{C*SD[EcFkGC@C_a3:Rt;4*aB4w`j `**R*`M!RqPb @`4AFU5a3[`>N`>{CS[*c*k**Fc`FT`FT RR` {A*SB[CcDkE_azFx3M4]!****4!aF64uB4Ea~F+4u3:6R`>NQ`>@*4dEf:@h R"aRB$= Ri`NN 5 R`N*{CS@[* a:@f*`FfFvTaF*@5a~F5`F`TazF`4t3aB4{ASBR[C@b*@4+Ef:@h R"aRB$= REi`NN`5 R`N{A*SB[C_R{S*[*7aF @1T" @_kT1!T"@@R?|`MQ` #@`?`4SA[B{è_"$@_kT@?aTR{CS[c+x| l@A``7! `28b:@)`*R}g``b4a6@T  B^рTy4AрT wB4x3 R6A]@"@#@cF`"!C@9!7" 7ARL@R@aF5 A)`4`FstsazFqaFnaFk`F_[@ѱ7AR% @@` M` `Fx!@ѥ`Ѩ`ZB`fDqT!R 5f:@&=%̀RaR Rch`:N@4f:@%̀R G9qAzTG@ 7%BP*:@Bx RaR Rf]{CSD[EcF;@C_ց:@***@ '&R#RRAR@o"{CRaRSTz 1E Rf`@9a@9f@9cRE( ` @9 @aR` RZff@9RaRE R~f`"@9a&@9f>@9RE `*@9 @a.@9``2@9 a6@9`:@9 aR R ff`B@9aF@9fN@9RE, `J@9 @aR` RZVf`R@9aV@9f^@9RE| `Z@9 @aR` RZFf`b@9af@9fn@9RE `j@9 @aR` RZ6f`@9a@9f@9#RE `@9 @aR` RZ&fCRaRE Rxf@SA&R{è#RRAR@!{ RaRSTz +E Rf`@9a@9f@9 REt ` @9 @aR` RZef@9 RaRE Ref@9 RaRE Ref@9# RaRE R0ef@9C RaRE Rle`"@9a&@9f.@9c R% `*@9 @aR` RZe`2@9a6@9f>@9 R% `:@9 @aR` RZe`R@9aV@9f^@9 R%  `Z@9 @aR` RZe`b@9af@9fn@9 R%\ `j@9 @aR` RZe`r@9av@9f~@9 R% `z@9 @aR` RZ}e`@9a@9f@9 R% `@9 @a@9``@9 a@9`@9 aR R ee`@9a@9f@9C R% `@9 @aR` RZUec RaR% R\Me@SA&R{è#RRAR@!{S "&aB@ P&aZ@ &az@ &a~@ L&a^@ &a@  &ab@ H&af@ &a:@ %aj@ L%a@ !S%a@ ! S%a@ H!%a@?qT!t!|@aT SA{¨%e"B9 dB9cB9bB9aB9SA{¨%*RaR%{S4[z +v%8@9v>@9  RdZ`@9#Ra@9f@9% ` @9> @aR`*Zd`@9a@9f@9CR% `@9 @aR` RZd`"@9a&@9f.@9cR%L `*@9 @aR` RZdf2@9RaR% Rdf6@9RaR% Rd*%RaR Rd`B@95{B[DSC%+@#RaR RudqTwB!@@ 6T%RaR Rcd`B9aB9{B%[D fB9``B9RSC+@ @`ZaR RNd`R@9%#R`N@9 aR`J@9 RgF@9fB@9>d{RaRS3sz % R,d@RaR% RP#d@RaR% Rd @#RaR% Rd@CRaR% R@d@cRaR% Rc@RaR% Rc@RaR% R0c@@SA%{èRaR Rc{R%[*S3sz aR Rc@#RaR% Rp c@% CRaR Rc5@RaR% R c @RaR% R!c@[BSA%{èP!RaR RcSA[B{è_R__R__R_{S**[*c<#u@@4qT`ASA[BcC#@{Ũ_u1`T @@?@6T  u1@T@ @?6T >?ՠ@B*RT*s*?ՠ@RV*B*?ՠ@{S**[*clu@ 4qT`ASA[BcC{Ĩ_`u1`T @қ@?Հ 6T  Iu1@T@҆@?6T ҵ@@?<@@?7%! 8R">?@s* SsB*s 2?@@_@?6YT Ҏ@@? 7%!R"aRB! Rb@* SB*2?@@;@?Հ65T j{Stu`Du` RSA{¨_{ H@[u @R{¨_փR$R!|#(@dh!8(@_#|!#B p@9B*p9_**R(R$Ě7qT_$Ě`6$Ě6*"R"RqAT{_փ|#!ap@9 `p9{@#!kT***R|kjT_ւ(@Bha8!P6@!` y`9` @d@5dRfr h"4 ?` @?@!R ` @@9?@ @RqT $ SAR[B{è_`@XW`a @@9?!@" a @!@!`??4@TAR!qT %b @@9<B@0~@h`?4r`T@@!@@@9<0~ h`?_@9BlA*9_{Sc8R#w[*RKy #`9R i9a*@ !hg8a7Pq!T bV7 6`*@"RP@96@?qT@?qTBP_qTBQ!R* 7R  R a9R4?U9 i9 ]9%@?qT@@58 "]@9xa !$@9!xS!K!#@9hh8?kTj`8 ! kATT"* kT6!]@9 R  ]9 ]@9q!TW6 V R B*"]9!@?`@?`@RR @|a*@?h 8 UR[B*SAcC{Ũ_ֵ AReje8 AT "R!Rm @Ra*@"R#R|$!"a*@ R  @a*@*!@F {R[S@L89*5 @@9#R2*5[B*SA{è_{p${{ (@!@9A6#\ @{Ũ_ւR R9RAR#9R@R`RR99"RR99R RD @@@k T_ R #@tSch`?@@c2 tS?!@#h _ $@tSh`?c{ p@"A9BQB"95"$@ @R{¨_*D R(RhQ$7qaT_րhQ$a6$6*"R "Rq!T{_ւ|"!Ap@9 @p9{{@@@!@@940~)h`?)5rAT@9}4tS@?!@|@?h @@9?@@ @?@D @?@H {_ RD)kᧀ% @|{#!h`@!Pd@!S`4b AB@c@J? kT@9)A @0tS?!@|@)h b A){CS[pd@|qT`.@0@ 4`@a @@!@@940~ h`?4@TD) @kᧀ|{%A@h`b @& @yBd@"54@|S S@ x6?@qT?@qTa5a.@%"&! @B#!(@5R@'@aR @]*WR{A*SB[C_4@@  5RaR Ra.@"%B#! @&(@#6R@'@#6R  a.@"%B#! @'(@6R@'@6R  Q* ?@9a @0tS?!@|@2"h qmTC{CS[#@@ @H?a@95R"*` @?@ @`@@` @@9?@ ` @@`?` @2?@7}R q@T}` @@9?@ ` @@`?4@AT` @z?@R @@kL TR|)~@9a @@ ?!@|@?h ` @@9?@ ` @?@ ` @?@ La@9 R  a @?!@! @ {ASB[C#@C_`.@%"a@9x( @@9B#  RR C R\@ RC R@@ @@B@!?k!{ nn` @d@ 5{z @{¨^R1{S[nn$"ab@?XqT€ $`6;{y` @#Ra@9`4%",)tB#@#ER@aR@o\SAR[B{Ĩ_  #ERaR R` @a@9#R@4"%tB#)@ER@  ERu @Rv@9ҹ R}R a9R i9*@hg8 7QP1!T %S` @"R*7RҞ`R`9Rh9a@9 @9*R2 9` @  @ qT& @9 @kTa@9 R?U9  * ]9 ` @ R`@c2b@y@a@ $|{?aT@9BQ !4b @!tS?B@!|@_h!a @@9?!@"@ b @ @Ed@Hӿq!?B@AD a @@?!@"H a @?!@?P b @@9!B@!(~Bha?Bpd @B2?Մ@h!@@9b @0!<StS?B@|@Ah `@b@y@`@" q`.@"%tB# @+@  #HRDx`.@"%tB# @+  cGR3"%tB#|*@FR@  FR"c R!!#8f |c{ TBQ"0"@9` @?@ ` @"@?@ @b @$?B@@ ` @?@ @9b @<S?B@@ ` @@`?b @D?B@@ "@9`@9c @BlS@ R,r*?b@@ b@9` @B@?@R @b @ @9B@` |@Bh`?BTB* @9d @` ?Ճ@|@bh  R @9b @` ?B@|@Ch @!@~af@?|qT@cGR@aR @BRc@#HR@`@`4`@5`6@cb@%`@!@?1T`.@"%B#, @@?RR@ @ZR`f3  ?RR R."% @B#,  CARaR R`._R@@! )`.Z] M 2@5@@ p-@CARaR@ @Z`.@0@4(@b@_kT,@b@_kTa@! @?! ,@B4!2(@8R_qDCzT!2?b@A ,@a(@a0@b@?k`Ta5@aZ0@a0@4`@ @?2?a@ e R`_qAT!2_4ab@?Xq(T€ $6`@@?`2@BR!HQ  *?a@ `2@b@9pSB@ka @ ?!@! @"a @!@! @!@?!0 b @*?B@B @Aa @!@! @!$@?kTa @?!@! @ $a @!@! @!`@?"x_kT!*a @?!@! @ `` @d@@5`@@?!R*?a@ !R@_qTcA?c2?@?qAR#R!B@ A?c cJc cJ?@ _cA?!pB a" B*?@@_qTbA?B2?@b@B A?K! ?@A @!A?!x?@_cA?!pB a" B*?@{*0@6*AR*aR6@A?2?ա@ @A?2?ա@ @A?2?ա@ qT@A?2?ա@ @A?2?ա@ {_և6*AR@ A6?x?ա@ ?2{S[cksk`@kl@`5v@klfL5SR 2RR5T Brf@?qRrBA B"B _kaTR= R Rlf@!R5l bB8*@f@vJ@*j*"@f@B-*UqT1aT@f@*R"B*@f@*A*`RSp*4{B*SC[DcEkFsG_`l `@ҁ`Lf@RqRjRR`J@xc5%"-t>B#3`@]R@aR@X  ]RaR R@f@*"Bt/Q*1AT"%t>B#<.`@c^R@  c^RDRR!!.K{CRDR!!.O{ @9d@4h@!|!g#9g@5`@!k o@*@5k@'5"%B#08#`@yRaR@@X`@%"2$B#㨂RaR@@Xj@f@a@"Bd/*LS! @ qT%/;R"aRB# RuXc@?XqT?PqT?qT"$Q_qhT@?2?@ @@?x?@ @@?2?@ @@?2?@ @@?x?@ ?\qT dQqiT%*/;#R@?2?@ d@qlT@A?p?@  @d@45 @LA?!p!2?@ @LSB @|@0Ah  @@!@LS|@!h`?!x? @@B@LS|@Ah  @@!@LS|@!h`?!l!2? @@B@LS|@Ah @ @LS! @|@P!h`?!x?@ @LSB @|@PAh @ @LS! @|@0!h`?"pB2?@ @LSc @|@0bh ! R!*?@ @LSB @|@0Ah @d@4@5 @LA?!x!2?@ @LSB @|@0Ah @A?2?@ @A?p2?@ @A? 2?@ @A?HR*?@ @A?2?@ @A?2?@   yRaR R|W%"  2$B#㨂RaR Rg@q T?Հ@@$?Ձ@R!@ ?Ղ@aRB@A?Ղ@B@A?Ղ@B@@?Ղ@B@A?Ղ@B@@?Ղ@B@A0?Ձ@!@ ?Հ@aR@P?Հ@@`?Հ@aR@T?Հ@R@dg@ 5@4@?2?Ձ@ 4Rҙ #9RЀ#@#@VF"|B{? T!c2!#R8 Rҿ?Ճ@h!?Մ@#h#_ qT?Մ@#h#B!_qT$RRR)R@kT?Հ@@`"0@@9B<B*&@9B *?Պ@*Bi&"p@BQB<?Պ@!0Bi&"!c* @R?2?Ձ @ @!Q0@!a?4@g@ H_q?Ձ@ !?Հ@RR@!Rg@_qa T5?Ղ@RE?Ղ@@RE !?q!T?Հ@R`?Հ@!Rdg@kaT?Հ@AR @`?Հ@aR @d?Հ@ @h?Հ@ @lg@5?Հ@R\0?Հ@!R @?Հ@@"?Հ@R@@" '|{s?qAT?Ղ@RE?Ղ@RE$?Ղ@REh ?Յ@Rh"?Ղ@Ch ?Յ@h"?@@T"%B#$1%`@R@R aR@g@@=V`@R% 1LR@$,g@"@B#{aR,VR   @RaR R VR   %1$,LR"aRB#{ RV?Ղ@B@A g@?qT@9?Ձ@!@"#@R! !tS?Ղ@RCh!R@@! !tSBha?@B2! !tS?Ճ@bh!Ȁ@tS?Ղ@Ah ?Հ@!R#0R?Ձ@  ҿ?Ճ@h!!?aT?Ձ@ ?Ձ@??Ձ@??Ձ@? ?Ձ@?qTRR?Ձ@ ?Ձ@"qTR# +RRRR@P?Հ @ ?Ղ@@@ P? xS C# B*?Ճ@b @BP?ՠ @ ?Ղ@!@?@qaTRRRRClCR!K9999$C9R*Q29CIqTRCRRCAR94R9q!RR*99C0R;9R*R9'C9R`2'9"R *99+@!@9V6CC9C29 +@!!]8!X6RCC9C29RmaRj!R*7RCCaRRR9WR9/CRRlR*|*Rg@R+@|!7+@ 9@+@|4!"+@ C !R*7RCCR6R9R9CR=C9R!`29RJC*R3@+@|!7+@ 9@+@|4!5+@ R C*T* 7RCC R9 R9CR rC9 * r!`29 *C*R@+@|!7+@ 9@+@|4!++@ C X**7RC^CR99Rc9Rk9C*RRCre*R@+@|!7+@ 9@+@|4!5+@ R C#**7Rc9*Rk9C)*R@+@|!7+@ 9@+@|4!5+@ R C**7CRCA$99;CAR Rx*RC *Rq@+@|!7+@ 9@+@|4!5+@ R CCR9C9IRR`29999CK*R[C *RD@+@|!7+@ 9@+@|4!5+@ C ?Հ@!RbSRR?Ձ@ @?Ձ@"$@?Ձ@"(@?Ձ@",qT?Հ@@?Հ@@2?Հ@?Հ@@qT Ro9 @ 2K#C9j@k@THf@'5VR@9RBrSR R99R@R#C99@9|)@ @@y@ҁ < @d@5#@`6@@?@2x_qc@"TQ_q2$Dzx?@ @@?`ЁR*?@ @9 @!@?@ @ @?@RR @@9 @@ ` ?B@|@!_h ? qT @?@R @ @@ @ @?T* @?!@! @ @?@ @$@9 @@tS?!@|@ R"h @ @@!@@9(~!h`? @!$2?B@Ah @9#C9 @tS!?B@|@Ah @9#C9 @tS!|S?B@|@Ah @@Y?@9!R * @?B@@ @@X?@9 @  @?B@@ @@9#C9?@d?@ĀR3_@ @$@@` 4k@ T/@B#$3 @ @^RaR&@ @R_{@9B# 5H!h@dRaRg@@ @Re2@dRCg RC*99C9R`29C"RR996CRO  R9RRAR9CRRCRg *"R99*R  ^RaR R@|qT@ 5ĀRRA) kL T 3 $R @xad@@_q!Tb`ESB*?@B@E$ @?B@B@C$ @? !B@tSCh kT@ _@9!RR! *@**@ @!@_@!@9bd@!@c@!(~_qRBcha?``J  @J?B@@h!?@ K@!Rsҡ K@R~sK@O@Rys@@9x!A99g@q TR @R R@@?kTĀR6/@dЁ@# @3d8 @ CZRaR&@@ @Q/@dЁ@|4 @  aR RaR  b@tS@h`?!  CZR R aR @ aRaR&@@ @Q  dRaR R@c@qT?(qT? qhT?q3@ *3R!R!TQ?q qAT TQq$DzT!$Q?qpSRRR_{S*[* wH B6*6'[BSA@{Ĩ_ R `)` R`J6`UEc6u| R:tNvZ| wr9daTc6c`@`)`@`Fa @ ?֠4a!dT7`A)JjTc~q@KRrĒ@zT_Rݷrk`T4*{S[CR*@*?6SA[B{è_<S`**@cR?`7a@< *`R{#RS@7@`*;[ck+?59R{v*g5T"R34aZ!ZA s! "ZBZ*(z`b !" ZZ**5g@4@pk@T_1*@@T5#5 SA[BcCkD+@{Ȩ_{S*$@ ?S/ *SA{¨@!@aR_@!@aR_*@@*L@_{"RS[a2@A47aJ@?qT(7`@UWR@7)E48,E2`FqaTl82 SA[B@{Ĩ_*`5 "R*j /6  R`2R"RB{"RS*`J@qAT`B@r@TBRq"R AarT}Ra*`X6 R`.SAR@{è_RR}*Rx ?rT R`*a@6 R`. R qTRh rT}Ra*RjT77RZARa* Ha.06}R`*@o6 R{ V5 @{¨ @{¨_d<@ @**L@_{R .@7x@Rc* @R{¨ @{¨_{SH@?qT(@*qTq@R@Rc`.@qATc2@SAR{èHRG)R <7S`c*T6c2T6c2T6c2Th6c2Tp6c2T6c2T6c2kTR75R"R7@6"R@7aB@t?rTT 6c2T(6c2k"R`74@SA{èRR7R @q!TRSA@{è_{"RS7}RRs@p6s2@h6s2@`6s2@X6s2@6R@7@h6s2@`6s2@x6s 2@p6s 2B@ B>@ >jRSA{¨_`@6R_RSA@{è_{RS37Ro*>Rs6qT8CRa* 7}w {S*q!R[! !Z*0`@` T@Ф@49bN@a@!@uw:[BSA@{Ĩ_*B9{*S**R*R@2RSA{è?qR@@FzT$@f{** @_R&jT%qT** @{¨R_{?qRS@Fzt<@Tf(@*SA{¨f@**_R&jT#qT***SA{¨*RSA{¨_{S[**R<**Rz**u*RpSAR[B@{Ĩ_{S*[*R**RZ***RP[B*SA{è_{"RS[*qT:B6qRR}RSX6 B$ `@qT @q}R@Rs6MӀN)RkaTl8B2 SA[B@{Ĩ_  `5RB}m "RO**`*JӀ2 R{ N5 @{¨ @{¨_{RR <5 @{¨ @{¨_{ /@5 RR @{¨ @{¨_{S[ck+@@!$;kR*6*RSA[BcCkD+@{Ǩ_*oRBoo@ Q?kTcZ@)tbA)cZ Zz< Z Z>? #kT>{5R?*c*sB79*R6* 7> {S8@!$Q? qTR*`:@$Q?q T@Rc*RnbRsl#2bR!*#bR``:@qTbRlRbR*R`:@4qTRCR*REbR R*bR9bRt #RbR*,TG1SAR{¨_,qTcxc20qTcxc2{RR RR RRRR RR$ @R{¨_{RR bR%<bRc2RRcjRRRRRRRR"R+RRRRcRc"RRR׍R`7RR@2R @{¨_{cRR RlRc2~cRRyBRR BRR*mCRRhR<Rc2^RRY @{¨t{ zm @R{¨_{cRR @1RR;RR6R1 RR,Ri*`:@(qaT@Rc*RH;RWR@2 @R{¨_{S4'RCcR*RRR*RRBRbR*SAR{¨_{CRR RRcRRCRRRR @{¨{R RRRRRRRR RRR @R{¨_{e< " [6!RW<" B<K@qc<S3 sK<s>s*3 "@c**SA[B{Ĩr{RR jc)R"Re(RR`R"R[(RRV"RQ)RRLc~"RG#+RRBRR=`:@qTCRR5$RcRRR$R*RRRR$ }`:@qTbR\,cbR*`:@$Q qHTCRR RHR `:@$Q?qTc2RRR @R{¨_,qaTc20qTc2__{SR[~)c>X2@kTSA[BcC{Ĩ_a@)qT?PqhT@ =Xa*<>L sBB|)?PqTBB =BXaq(TC$#X`*: {SH@\R]`SA@{è_!R}]`!>]6P4`p4` !8?]@6`` `` @dХ?B<4@cRaR@@ J@  cRaR Rb@*@?7at TM`B"T b @@?aB@ i \aB@? k`TRK{S*"[R**)'@SA[B{Ԩ_{S [** w@?` kTsTSA[B{è_R*P"!D@!@Q?qT@RR@r{*CRaRdX2 RBIR{_{[֒cSRk+@f@**q$T*@f@ 4@f@**q#T@f@~@%RRҵ~ h5dxt,#?RaRB RdI@f@*%RR h5dt,C@R@f@*%R#R h5dt,cAR@f@*%RCR h5dt,BR@f@*R h5qTdt,DRqTRHHR@@"@`@?x?`qT@@?t*2?@ @? *? }ҶkTR#@b@?Bx?b!kTR RRR矏RIPHP r rrr&RR@#@?c c *?##@?c2?##@?c c *?#@?!P !*?@?! !2? @?!l!*? ,@?!l!*?B,_kaTw+R@@@@?2?@ @?x? [#R* 4Rc.RaRB RHR*`4R/RaRB RHR*@4( B0RaR RyHd*p &B#8RaR RnHkTRb @A@?!2?AksTqTSA[BcCkD+@{ը_*9R4* 4 "@?qTh .  * {RS*[*B c#@f@2`5  SA[BcC#@{Ũ_@f@*RB\ 65 @f@*2@B K 9G R}*@f@*s6R@f@*4@f@7*RgFqAT*l @f@**@f@*R*UJR*@f@Bl NN*@f@B UqB9*@f@B MqF9{S[cks@0@|Ӏj`qT*xRR;R37kTSAR[BcCkDsE{Ǩ_T@qLqTA!-!XcxbA! ֡@@R*R@rsB@6SRr*2@9 D*c*gB@ @B wRkT5d<8RaRB R{GF*C\RaRB RrGR@f@h* @f@%RRBd8R2@?տ?@?RRr *? R**@rd@?տ?@?  2?@?տ?ՀR@?2?**`R@rJ 5R@* RR@cQqAT@c\Sc*c2@c@QtS *RR{JYR{_{SBY@_sB@TSAR{¨_=a @3@{Sne64R*SA{¨_d7d{S[U@H@RSA[B@{Ũ_d@bsu3eO@6 e7O@1Td !0dZO47d@!4@A_{CS[cH@!Xd*6*3@@95B`J@Sd{ASB[CcD_WtBWW@klTR{wc R!Z]4h@  R@g@ @RUF?   R R@ R/@X@d(@RaR@@6Fh@  R@g@  RaR@ R @!@!@?hqT@!4@"4@@?@5   R @!4@!@a֠_{S@B4@B@b*@?~@RSA{¨_֠@4@H@d֠_{S*[*H@Vf@XB(*5q AzTa@ Ax SA[B@{Ĩ_*B 5q NzaTa@ $Dx $*B`4{S[c8H@Uf@WB`* RqMT*R*B*C@*R `@zbkTc@ S!|Bd@!|  !tS!|@ha# c*h!kTRSA[BcC{ݨ_֠{S[Wf@W@B*4[B*SA@{ݨ_*` @qTC@RnRa @?kTz`_q@Ta@_kTc@|d@SB !| B !tS!|@ha# b*h!#AR{S[H@Uf@gW`mX`* RB` *RB$`*BH` R`*Bp`4`[BJ@SA{èSA[B{è_{S/W J@!db`J@!^b`J@!hXb`J@!Rb`"J@!(Lb`&!J@#c`9!J@c`9RJ@![{S@4@@@R@?qlTSA{¨_{S4@54@*qaTR @*@?,1`TSA@{è_{S@4@@ ?,1TqSA{¨_@!4@"@!R R_0@{S0@a@95SA{¨_s0@0@0@R_{S@54@U@B@@6Rka@ҜOR; ";@"? #C@#K`#GW?RA@@?ր4SA@{˨_@@`@@_A@{ST@a@95SA{¨_sq_A@a@@Z_A@a@@|R_A@a@@R_@@@@@@4@@@@A@_{STf@4!\<!|;** RCZ 5@A@@x@SAR{è_ARgK2* 6o*qT@V@a~@RV5@UqT@T 4R R Z4R RY4 RgZ`4k{S_q T_xrTRSA@{è_*A|@@@k`T"B.Cx`?T aT7* Rp6*&j`7Sqj[5474qT!D@$ @B4@B @b֠__{ T @@a@a @ab9@aj9@af9@`R @{¨_{STURU@TSA@{Ĩ_`RJ@!_`RJ@!_`"RJ@!D_``@5J@R!0._`4qRR`"R@@B! !|@@ha8?_{pT @R6{R @@{_{ 3_T @R6 @{¨_{@B@c! !|@?bh!8_{ 3DT @R (6 @*RR @{¨_@{ *0Tba_0qs` PzT? q`TBB0 @Bh8aRR @{¨_`A{* @aRx2aR @ @R @BRaR R^@* @{¨_@@{R@{_ C{CS[*@B4@C@`?* 4D 2B@ RaR@@@-@{A*SB[CC_  RaR R #R'@`SHR@kT'@R#R{S** RgV@5@*5@@aSA@{Ĩ_{S*[+** RW4**D*L!HBc*RaR R?{B*SC[D+@_3@**43@DHB!@ +RaR@@ @?  +RaR R 7@@7~Q*5QQ3@Q@43@R$*4{S[***Cc*ks* RGV4**D*L!tB1RaR Rn?{B*SC[DcEkFsG_K@c*L1?*j THc#S*5O@Q4*)O@@7!Q* 5O@QO@O@QK@zQ@ 4 5 @k TK@`RVK@DtB\"@ R4RR@@ @ ?ԐR r R  4RR R4K@DtB! @ 5RaR&@@ @?  5RaR R O@$Q~* 44O@!RWO@Vw @ 4kTK@***4{S[!H@=\ԐRJ@"r! 6\!#J@ ]J@!8#]J@!\#]S*J@!#\J@!#\S*J@s*s*!#"R\q T q TqATs2J@"R!8$\q T q TqATs2 RSA[B@{Ĩ_s2s2s2s2{ P`J@ @{¨ @R{¨_!B?qTT?q@T?qT`A_? qT"7q 7r`Ar7s`AvrR{"R!@9 @*@5` @94a$@9*"R`5``@94ad@9*"R5`$@4a@9q*q{_R R#@9c7#(@9#7#h@97#@97"@9_qATR_@@@4@@@d{S[c#@B@B@V4@ 6*7@`@"@?*01`T*SA[BcC#@{Ũ_ր*@ 4&@@qTҀ"@9@9b@9s s a>!|c!ˁ @y9@4Q @!pS$! Qd8? 1T4B@ RdRarS@`*@5*@D!pSV4* sA@c@c@c4@c@e@e`@@ @9C@9@c @`@9c 4?kbT_@D)qAT@4k@(@(@4R4!K?k!A({S*O@b@?aSBl!*S6!2S6!2?a @96O@ @?ts2q2? SAR{¨_{O@?AR?!R?R{_{S*mOvO@@`4ksORܡr` <q TZRR!#rCKkcQcQ!R!  K jZAK!!Q$?qT R"hS!SB2A* *?ՀRSA@{è_{S[*c#@.O@6`@2``@$Rx`qT6`@x`SAR[BcC#@{Ũ_t@9`@x`?Ra a@?a6`@?V8T"QRk!T{SN]OP`@9`"9RSA@{è_R_{S@N@@T@r * SA@{èR_$hc8qTd_kTcBQ%kTDѦhd8߀qT*d|@#˿kTBKkBBПh"8_'hd8h$8{S[cksNv@Ss>Na'@9a9a+@9a 9 @`@ >SBRRHRe B9SyJ_SbSd@T~ **a 9Z`9c9e9a y9g9f"9 )oh9dF`b9L)BRo@@4ZSA[BcCkDsE{Ǩ_~>S`F@9{S[cksINv@Ss>CNa'@9a9a+@9a 9 @`@ >S"RCRHRe B9SyJ_SbSd@ T~ **a 9Z`9c9e9a y9g9f"9&9 )oh9dF`b9L)"Ro@@4ZSA[BcCkDsE{Ǩ_~>S`F@9{!S[ckssMk*5MHV>6 @o$TSA[BcCkDsEk@{Ө_R҆999@@RR@R9 S9R yR9y9 9b9O5@9g|q T9`6 R93RA! 6RA!@6+RA!6B9|R*9R B99 B99yS9 y9Fb9 4@qbRTB95@{TR)R9 B9\Rb9S9@R9F5J@@9@9A @9"@ @9A`@!Z?T@9@9C @9@9b@@`Z 22A 2" 298{S[6'_#` RO*5'@@b'@b"@T3@sb'@ab@?T*@5s.@"RұS*5R*`44*(56eD*Ɛ(9B('#HRaR` R?:*SA*[B@{Ũ_֔.@*@B4@B@b֠_{S[*dL9pRD9R`9RD9`9@9_kT`@9@4`@94`@94u ~@Y4`@ @9R$@5tSA[B{è_@9B_qT9@9B64%R@9B_ qT@9B b9@9b9!$c c9d5c c9$R`{S@kT@*@9Rr@*!@S>R& *h@!*@*I#*@4*(@*SA{Ĩ_?@k TqS)s@" 7 @_kKT _ @4@@C @A)K_{St<W<[BL4BzCB8B@|c"6<?sz>@@***Rh@@A *>R!2R!SA[B@{Ĩ_{K{@{Ssz[*B2@~@_@9@"qR@S *j@2!*"{@SA[B_{S*~K@*SA{¨{S*qK@ 56RP 5@|@!pт@B8BQC<? ""To`SA@{Ĩ_ք`*@{ *HK@a!p[ @R{¨_{SS<r[cksCT5<`*@!T R?klTR<Rr>Rqg*<<@*O7!z!8!@|c!ˠ7 @?zh@@3A *R!*!3@*7@T7 sKR>s>rr>RT*SA[BcCkDsE{Ǩ_ִ{Ss<r[ck+T4<a*?@!TW< R_kLT<*B R*@7qTs"Q>s>2@R5DB*kD*cC*SA[BR+@{ƨqc*y<*74 sK>"9s>SA[BcCkD+@{ƨ_ Ra{R 7[ @{è_{SJJa"SAR{¨_ RR{R $RRm @{è_E<{*s*R%@{¨_{F<*s*RRi{¨_{E4* S<*Rs /@srS$ @{è_{%<c<A<dR6F!4 pSB<c sRE{¨_*{S4 R@<#2SA!x{¨# R{ R <c2 @{¨ R{ R R  @ R{¨{S4R<@#2!x#RyR8SAy{¨R8A9?q`T!R_{R Rc RRw8 @{¨R{sR h8s @R{¨r{b R ZR b @ R{¨c{E4** S<R]/@sS$ @{è_{SR[I)ނ R7s53sjqpR`@z-T4@ ?֓4<$SAR[B{è_){%<DA<_rc"RTB pSB<!4c sRm{¨_{SKIQI"Rb RRRRb RSAR{è_{iRSi*R2SAi{¨R{b RS8b* R2b R Rhc2 R`:A9 QqTcRyRRRR_s R2 RSAR{è_{StJ@`:A9~SqTqT`:A9q(TqTSA{¨ QqTRbzR*y*bzR} QqTRR"zRq{  @{¨{S4<5 @y?kT*b RYuy.@* RSA{è>{S4<[5 V<@y?kT*b R@uy.*[B*SA R{è5{~ <B2 @~{¨{y <Bxy @ĉ{¨{bRR{ĉ{S`:A9qaTM RRM  RRBb R<bc2 R RR R#r*R RzR@2z>*R}RbR:zR"RRc "SAR{¨{S[GGG"P= RR"B $|DhdxkT!|@! @y`:9 @9`B9a:A9?q T T?qT! 5)SA@[B{è_!?$T!?a!2a!a!%a!a!0$a"a@ R ?a@ ?`B@9~@}RßR `B@9 6}៟R ߒqT`B@926}*~⿍aBSAR[B{è$! Q!?q(T!4a!2a!a!%a!a!0;a!@5a!a!+a!&a!P"`B@9@62B2RߒqT{ST<*!y*SAx{¨{S*[v<*cW<8#sqT SA[BcC#@{Ũ_֘4*<Y5 * j T}Ҧ**R{ R 2 RR @R{¨R RR{ R l R!RR%RRc RRR%RR= RR @{¨{ z @{¨{ ~❏ @R{¨@{R%R@Rc RR |" Rn@2"c< RyR @%R{¨@Rc RRh{ R  R:lýR" RXb RCR b RN˅ R7<˅c2 RB Rd2c RRJ R 2 @{¨ R {  @{¨{!R ) Rl R`:A9 QqT8R!<X6Bx`:A9 q!Ty<Bxyy@2yw|<B2wyt<B2ybbRab R<bc2 RRAR RQ R" RR " R/ýR" RRB= Rm= R<=c2 RCRr RgRb R"R RzR r< RW"R_Rc " @R{¨hN{ )9E @{¨{R : R R cR0r R&C Rb R!C R RoýR" R0˅ R<˅c2 R$ Rd2c RR, R2 R❏ @R{¨{  Rl R!R X6<BxNRb RR R R| R" RR " R@CRr R`@@QqT Rb RR RRr< RcR~R0RCBrb~R# RbyRýR" R= R<=c2 R❏ @R{¨=Rb Ri R{SRVRg8RsR%RDRc RRd{&7}"qTRbRZ RC@2c< RNb R9Rb  RD`:A9$qT R`(6b R'<bc2 R2"RRc "R(N<X6Bx>RdR@!yx<B2az<B2azR_ R_ R<S_ R<*0B*R_kTa`!{4rTRrR  R.*b R<bc2 R@SA{è{SRR%RDRc RR{K&7}kqT)`:A9qTzR<zcHc2R"|R4"|c2RgqAT R'R  RZbsRRi<rz2bsqT"sR "sc2R?bxRS8bxR_M RJRM  RU`:A9qT`@R@qRc|RbR3(bR R*=#R R8@SA{èWR{S RbR6sqTSA{¨_{S4<8A9?qT?qT!Q!?qT*RRz[*R"{SA{è_?qTRT@7vRRRRxB*Rxx R{RR !s8!R!׏h<Bx{c@y @b{¨ R{SR[pR5<R<B2epGzVz T*!׏[BSA"R{è!{S8A9?q TzR2`2czRe4BR"RzR!zRuRT R_ RdR,R@yF@x RmqAT5еRb RcR R^R RYztx RS!T@R RL@SAR{è RD?qT4ДR R" RdQR`"R@yF@x R0qATSA@{è_{S8A9? qAT4Д! RR\@yF@x RqAT@SA{è/?q T4Д2'R!RI@yF@x RqAT4*RURRxRRd+Rp RA@yF@xRqAT" R`7CRb RCR" R4Д RURRx R RDRp<R@yF@x RqATCR⎅ R@SA{è?q!TR4R2' RR!R@yF@x RqAT4kR+RURwRxRRd2R R@yF@xRqATR6RyRtRxR4n  RURNRx Rd RdRRR@yF@x RWqATCR⎅ RPR⌅ RKR6<c2RA"|R@c2SA"|{èR R?q T4Д2)RARj@yF@x R&qAT4?+RURRxRRDR@:Rd@yF@xR qAT4Д"! RURRx R RDR6RJ@yF@x RqAT"|R"|c2RbR<bc2R#SA@{è_8A9?$q T{RS4Д2-URRxRRDDRp.R?@yF@xRqAT4Д, RURRx R RD$R)R@yF@x RqAT"|R6"|c2RibR}@<c2SAb{èR_{S@J@!l*K1Ta@y`*9!2ayJ@!*K1Ta@y`69!2aySAR{¨_C@ye6 @9$@9F@y *k!T6(@9,@9F@y *kAT60@94@9F @y *khT60@94@9F@y *kT 6F(@9@9kT(6F,@9@9kAT06F0@9@9kT@9qT5 r_֣86D4@9 @9k!T@6D8@9 @9kTH6D<@9 @9kTP6 @9B@@9_kR R{S[Asb`bTSA[B{è_`@`7s.@FX?T@A7F>@5D@B4@B(@b֠_*A_q B9"9_D@4@@**֠_{S[ck*D@4@"@zCF@*?a@9? qTa@9?qaTb @9a@9A *?qT1T@!SA[BcCkD{Ũ_֠*D@c4@f@֠_D@B4@B@bR_D@B4@B@b֠_D@B4@B @b֠_D@B4@B$@b֠_{RS[B*5@C@@b@b@?AT= 9[B*SA{Ĩ_!RmFq`@z?@*.@cEq*@z!T{ ?qT @{¨_s@){Sz[*0c*Rks^?@B ?qATT?@9* 5r;~??@D@o@kJ@!ˉ);D(?a TM)B+Ay s{@*SA[BcCkDsE)_??@@@7h4R;;@?@ @;@>* 4@Qu4;@D9?4ЍJsJ5{@kTJ7@@y`5)A3`5!@"@>*5?@@>Ҏ?@;5R!X+P@*`5;@a@+YBRR44*SA{èM@5SA{è(,F|,{@!R9RS[A`5#@,-RA#@@sb#@ab@?T@sb#@`b"@T@ 5#@RaA5#@5d. [9@ SA[B@{Ũ_a@=*L1T-!s.@sb4T-#RYC*@5'@?>!R9 !R91@TL1T-`@6->@9`7ss.@3@sb#@ab@?T`@6>@9`6bs.@{S>>@t`"@`SA@{è30tRSA@{è_ lZ_@ h@?x2? h_@B@?B _kT@!|@!D_ R_jQ{S*[**@?ՠD1Ts k TqTSA[B@{Ĩ_R{ D96R* @{¨_@!@?/6!x?@ԐR#rARR@*6 /J{ *=q9T @{¨ @R{¨_{S[5 @6@SA[B@{Ĩ_3@`UsEs~ @afb @?7yJSB|S!GB  !R! l@a! !*l@7@*@!!z!M*@{ 9@9!Q?qT@9@9 S!S*a @ *` @{è_{SA!!z#b@"BLSKTRSA@{è_TC0 !?qT/BR{@?!x?DԐR#rRR+640 {_R{@?!2?DԐRR#r*61 {_}]R{S@@?` @@?T6v?a @ԐR#rR R` @4SA@1{èxk,T  ?` @RR*` @5SA@{è_b @|@!@#~A"@?B2?a @!"{{<{S*[ck*sDkT!!(9t21SAcCkDsE{ʨ_֡b?TRk,Tұ! Rsu66z$` @ `` z;o$`` @R`@"zRyҠOӢJS(R!G S 'l@:S*c)`>SzS$2*{ Q?khTa~!|@!!z*` @!z!%`@;@!!*Aq, T`@@` @2`@ @" 6`@ ` @   i @`@$@7_k2 i! )d@<SH? q@T?q0*@!2!* Rr)!R@rQq Rr7@zH(Rh!O)@ |*ZJ*)@@L@@L@ @L@@L@@KB (AR @6*A*6**{S[ @7`*AvQ`*@u6  @j{T@R@ `*AqT` @* "Th30@6 @4 2 SA*[B@{Ĩ_{S[*"RsbҢq}!`RT 4TDqSA[B@{Ĩ_D{s?Sz[ckD;@qן_*4;@@ @_LS  |zC!#4O@R RC@RySOӀ Gl@JS7k@2`@ q` TqWMW@*:Sc S(S*bl*R*r*D97@? qT?q0*`R` }` CB9R&uC;@CSzS~z@` R&R R9,9K9[}*?k)9Ә) ;Sg**"@ *  nJ Rg@&RW) R@45RARЁR7Rrw^)` V4 57>}s4*@K! cJqT~z RaS@`j" Rr `2B7@zWTC@uO @@??Ձ @  @@? (6ҍROb!q}w7@30- @86O@sTR@u@B7@ @@?2?Ձ @RR * @E*6t6 @@?ՠ(6?Հ @R5;@@@zT;@@! ;@!z@4*6?587q TT@qTqT4z@$2?Ձ @ԐRR#r * @qT5O`TN@qTCB9 RCB9 G@!l@ ~S! *G@ lҀzP@K; uD?ZSA[BcCkDsE{٨_@%b*ҿaTn_{S[c*k+ Db_T@:H? (T`5`RDy@9z@9`@9 * `R[Z{?a{?k`T_q!T@!Q@?._qTRkT_qT `Rk(T_q T_$q T@: _ qaT@?@@ oc @9a@9a *? qT(T?qT?qTRB _qT2o?ՠSA[BcCkD+@{Ǩ__qT_q` T_qT RURya @9`@9 *|S?qT? qT?qT@>~9}Ҡ`@9s@9 *ksҗksҕd@zTb~@Rߖ: @=TДZ>x@9@9@9  @qhT! 4x`!!05h8`@9q!TTЕ}9=a @9`@9 *RR@?o6A9!296A9!2986A9!29 6A9!29@6A9!29`6A9!29A9!296A9!296A9!29(6A929:@y(6A929R?TqTa@9o@ 32o?ՠ0@@?Հ 6o@2D9a62oo@x2o?ՠ@`?o@x?ՠRR R5@?աR o?qTA ::@y R *:y @@?Ո!Qx7%@?@@ oc @9a@9a *?@q TT? qT? qT?qATB oo@?Dq T?Pq!T:@y R  :y2o@@?'6o@x22kD+@*SA[BcC{Ǩ{S[**c#18+8@T R 9`p!`P!`#`!``@p!``@P!``@#``@ vwsq!TR[B*SAcC#@{Ũ_ր@?t2?a @RcrR AR` @*qT7Ta@ `@@?7t R2`BRw*Rv?` @ R*kwj R`a`@` 2a@6h @T`@@a@?` @`@@?@=A 96 @9@9a #y 9!H9 6 @9@9A "@ 9!H9` @@?A 2?a @ 7` @@@?2?a @ @` @@?q`@@?"\P 8!|Sr ?*4?` @t{[7@?q@TyR{_@?@$Rj{S[G7D8` T!h87`6!0 L@A?5!87@6@ H?x? 2? [BSAR{èR#c @ ??@@AT!877&dRR@kTp@@9BQB<A *@9BlSB2!*?b|@j"0@?a0c@!|@j!? Rr"?տ&SA[B{è_ R_{S**[*'4@?` kT1TT@?Փ kT1@ SA[B{è_ 71@{S@?7`@?x?`t"R*ЇR 4ЇR9NSA{¨_`@?2?`RcrRAR@5RSAcr{¨RR%b*ҿATa {!|S(:({_%b*ҿATP {!|S:{_ Sy?rG@K_{ D6qT @{¨R6s@{S[6FI`T@@@@V @2FIR!R  @FI?`BkT#c,!;9R8@!|S?q T@@c;!H;!B|S;SA[B{è_R {S[6`D6`DvFI;76V@#cp&!;BR8I@?!R@@}{D@"22A9b6!2@a>IA`*R@4BSR!!Qb@_ qT@!SA* RSA[B@{Ĩsb@_qT!x!2SAR[B@{Ĩ_{SSH5RR*SA{¨_$RRR!Ri@ R!?kT#c!;_R8? @|SF FI*6<7 {S[cks5D75q!T6wBI b_T~S= SA*[BcCkDsE{̨_ֵ@@6T5@IR!:H T@#@?Ձ@9bR@9_j@9 TA *?`CkT!Q=@9U *@9A *"ZB<?q TR_khT?qT#`R_k(T?q T?$q T?I? qaT25C?!R @9rB @9a *?q`T? qT?qTB2?G?qT?qT?qAT Rsy@R @9@9 * |SqT qTqT,? @qT!@.BL1!x`@h8@9@9T *kҀ?@zT7@~@Rt: {>@U`: s @9@9A *"|SBQ_qT"R @9@9A *RRhQ|@|j`?6B9!29 ?0qT?@qT? qTB9!296B9!29 ?qTB9!296B9!29 6B9!29H6B9!296B9!296B9!296B9!29 7RB9!2B9!2B929B2lB2j25C?Յ @9"R@9r *? q`TT?q@Tt??DqT?<qIT!@Q!<@B -Axaa*?C?"LQB<_qITBQ ?A R!`A@R!p\@9qA T@9r,TuFI*56T@ @aR*dRR @@!R+ @bAkT#c"VR!;8k@!|S?,qTHT?qT?qT@H!|S ?LqT?XqTUl *5@@@@KR$q!T@9rA!T`FwnD9R qT@@R<@!)R kHT@@ZX!@C!h#l*R4wkTR^*4 _LD9R$_kTD9D96@_k!!Z!*D9RRss@kTD9"#6`@qTxCy`@ q@T(TqTqTЂ-Rc9XD9D9 *SRqaT4D9Rqcj_AqcccQqTw@}B< R ` D9kS(c5D9RZqCKc R R_qaTD9qc`@qRccc4D9RqpS@RcZCKccQ(qc_q TF9F9D9GO3)W! @**"R!R? @-- G@3T)D9D9@S|S!?@ *aSc<SpSc`*l *L)D9D9a *@*A! *D9q`RZ!*A @@GG@O@ @W@!(@*!AD9@R`<@*@H`6 R@$PR Ru,cCkD[BSAsE7@@{̨y mR|{S[cFI V@@@@MR%~@ @ykTV@R@+V@R@ yAR!RSA[B{èJSAR[B{è_{S[22t9*5v@?ՠ:@!?\*?ՠ:7`"A!@8@?"|Sb"9@? 6bb9`b9@ yb"9H`"96ab9`b9 @a"9H`"9 @?!2?ЇRRD!Rl* 4T[B*SA{è_`6@?`6@?@?5|S"\P`!|Suryt{ )2@q` @@?a @x? `6@@?a6@t?  @R{¨_{S[c;! R8Z@@`@AT[BSA{èv@$@zT{#c!R84@!z!!zϑ{!dzS*cD-!bR8u*Rn*SA{¨_{S*c&!7R8V@@?~RR` qaT@@?~RR!`@ ``@`SA@{è_{ c 3!$R8'R`~`  @{¨_$@zT{c>!R8@!z!!zN{S[c$@>`*@<`R@ `@@?@?`"@`R@@`R@@`R@RwztU`"@b"4@@BaT @@@@z4aT`:@`"@[BSA cCR{Ĩ{S[*VHcH8(R!8S4s`Q5`@4@@@ Cd2 @C!2B)RcH8Wb*RcH864@@"@AC!d!2AQ5`@@aa R`*[BSA{è_{S4|}[V@ ,aSA[B{è_*AV\`AROV@!R\AR "R!R}@@`"@x6R`"@R{SR[c`"@(`SA[BcC{Ĩ_`"@D`ӿ?2?6"R!RQ`*@@@?@?b*@!z@B(@*!`ӿ??@?t~`@?h{Rtt6!R.`&Rc`:!Raza&@`B!@!@R`:@A`&@A+|a6@`ӿ?"? `6@@?a6@ r? `6@@?@?`B@`" @a6@?"? a@ @?7@?|SlW* 4C tRrS*&a"@ R`"@ @? <A7R!|S?@qTСc!2R89 6!0 R `"|@!|@ @RRbHR~B|@xaH~ҁ@5x akLT@*`s"T?RA@?qT{СcX!OR8R@_ @!@?q TA@!@??~!_@#@q@B#@B?~RR!B|`@"_{***@@@@{_{@a@a@a @` {_{S[cks7@!D 9T@c9"_R!8! @*RR! @R@2`BI`Dg 6`@*aq THTqT! 2 qTBeRc9`D/H@_?qZtSZ#*`D/@ID@/qaT! 2a`@S*xRqTrqNQ2 @(@@*@RR[BSARcCkDsE{ƨ! 2! 2aDBI.D 7D@@? qTD 7D.0A96`@2`a @S*` e9 *` @rpQyqTH7cK`| S_6%*4_kTH`6qBQB  D KR#@c\DKkЂ8 !,@9?qTHT?qT? qT?q@T_?qT?4q!y4{Сc!$KR81A{S*[*`@44*tR|@FI?*5x SA[B@{Ĩ_x`?T@@T @B@__R` @A{S[4@_qTTb4R&@` @T@@TR _ qT_qT8  SA[B{è_֠$  @Rx@R(&@d @6`*@q`*@` @t@k$@@T@_T!?T@ _{S[cXR#R3@R`@``@``@` ` @` @@sBu_ @&@T@TSA[BcC#@{Ũ_`@kTqjAT`@Rx``@*``@R`&@ @P6*@q*@ @{S**["R*(@J4Сc8!$B%R88*@bSB(*:Q# (@KB* qTSB*OR@?SA[B@{Ũ_{R$@$@#A?T@T6 (@q (@ @# "@$@?TB@BTAK}4@`ӿ?"? {_` @kTc@b @B_k{S*[c #mp R&@R @&@ @ @!(@k!Ta@!JӿqT @FI?`@kTc8FR!$8PPQkTFRc8!R+` @>J` @|SqTb@FI?`BkTqSz TЂHRc8 @*+@R*! @AFI* @FI?`BkT@ RkTJRc8[BSAcC{ĨSA[BcC{Ĩ_{[S*ckGӔ@sFIbkJSxS_Kk@ T@ @@@!@*l@ qT* !4: @K!<rd @zq!?k Tb@B  7@@;@+@oB) R* 8KkГy*R *R4o@q?qmT2W2@* ***+)2|qR?qaC D*ןCK;#)C+Q) R9Q {KC@q{ӀRkT;@*o@%Re*: Ҡ SA[BcCkDsE{ʨ_9!@@H+@2 R@C@T @\sK @k@_`@kTct-fR!$8PPQkTfRct-*{@D?Z{S[*ckGsFI@b:_T@KSxSK`5 @@qT`@@@a@*@B 6SA[BcCkDsE{Ȩ_U 6@7*@g*arQyq!?qhTaH6qT922_q@9@9A  @9"@@9A`@9s@9A @9"@@9A`wR"R{yRRM*qmT9@6{2**%RR|qRB; D*{*@*g*"R9 *|S<S*@R;*R*)7@*g@;R{@ @_c@kTcp:~R!$8R RPPQkT~Rcp:*%DT*fqT*.@94qTRHD?ZS*: Ҁ KI{S]*c+`SA{¨_{S[M*S*`@@?ՠD!P 65@!R* 4 [B*SA{Ĩ_!R*mD*{S[ck @9@4*TC@@9`5%`Ts`@9`5%5ju8qTtsb_kBkTQ*k 8`*SA[BcCkD{Ũ__ P@_! P@ P_{S*[c*@qT`@9q`TR ~ R"Q`@84q T2 qmT @*!!`qB:SA[BcC{ɨ_VRzv kLT@*QARzab@885!9k T@T8[*G#Hc`!R{=7@Ra PGd+{BBH!@@86C@Ra @95ARR{è_aR R{ ! @{¨{!t  @{Ĩ_*B&@@"@ {C@C86RD#Ec`CR"@@@{ƨ_ARAq {SS@?ATSA{è_{ a@97b@9` @9*b@9!*b@9*a@9!**r @{¨_R{S5!ppSA{Ĩ_{S$SA{¨_{S**SA{¨SA{¨_{@9?qT!PQ " _q$0{_ R{q{_* r{ARAq {_{ *7; d2! `RRR"Y 5 @ {¨EPG0R\aRB R9( A@!yAA@!rA @{¨_*R$RRD*"! `3{S*4;2Rd/@k TR SA{è_ *`RRR;~4@@y@R PG Bc6RaR RR|{R;~RRS `G  EPG:CBRaRB R RSA{è_;2R`R@&@R^{S[*cksg6@9q! T`@9qTs ?qyR м`9R7`;7@*#* 4G@@g@QkT*c Q53[B*SAcCkDsE{ɨ_5s  kLTz54;@QZ G@b@?K@c?@Z4@Zxq`!/z5R?q@R_{@4CAc3!@4!B*@3!DbU!|R!|"T{_@kT{[RS7*@RqTsSZA*@ @"T@ @?*`5x?UZ[B*SA@{Ĩ_1aT1s{`R AZ@`a@a@!HS* @{¨_B*@ c @ ÚT\ ?*4*x?{S3[*5R* R}4 1T @"R @&[B*SA@{Ĩ_ր@?*5B*@ @"@* 1TB*@ @"@*@&@sS {S[cH!|c!ˡ!G#14SBw@ *#L4`@e T ` ` @Z  ` R{@SA[BcC _`@G `/A4{S[cR`4|@ t[B*SAcC{Ĩ_IAR8 ?*`4 kT|@ @@-j88 UR4R{S!0*@5@@ @ @ *SA{Ĩ_ֳ3@4$@9qT$@9x`qAT!#@#RT%@9he84jTA_6!R_{ `Ss&! ҠieSAR{¨_{Sa@98KSA{¨_a@9@~R{STa@98KSA{¨_a@9gR{S!? X``*SA{¨_{R#c`#SEFR'@'@SAR{Ǩ_'@{RcCR Rf@? T?!T@9qT@9x`qT @9qTqT5'qATR{¨_{S[6@syr@94rZZ@` 4SA[B{Ĩ_ `5r`{S**b4@t@i)qTj@J _q T,T_ q T_ q@T_qT7q T q Tl4R_q` T_qaT8 hj8 SA@{Ĩ_R @@94 R @@9a5! AT @9qT @9x`q @9Qq! AzITQqT! ! $ 6 @9 RRcR@T@9 qT?qTqTa4 8`@6 e R`@(676 `sQ4`@'6tR_{BAB0!3!S[4D[BSA{è_RSs0kTa@@4sB{ `Ss:!7+ҠSAR{¨_{R#c`#3 EFRA'@'@ @R{Ǩ_w@'@{ RS[6@v@4 v^^@ ` 4SA[B{Ө_`5I~`@` R_{SRu* 4R(!h*SA{è_@#@{S*5*5!@BR@iu*5!@BRGu*5 {@*SA@_{AS @R\"**SA{è_*5@BR@ u*4R"`R!RI*5!A&_{S`;2Ra@kTT"!A&RSA{¨__& __R___ր_!* !x@_k`T@_k TA !k  @_ ___ {S[?*5@TDSA@s‚Bf@}Tt #8ERaRB#R{@*SA[B ____{$R["cb*S73*sR4`@`4kaT@`aB@96b@@?`5b@"4PSA[BcC{Ĩ_s"qT{?qS["* T5R3sb@@@?5b@"5PSA[B@{Ĩ_s"qT{ `@R$@? @{¨_{@ E@ ?** @{¨_{@ 5@ ?** @{¨_{@ $@@?** @{¨_{@  @ ?** @{¨_{S[@ @?*6@T$3LRaRB#R[B*SA{è_{@ ,@@?*v4 KP @{è_@@@!PA{ @@4@0@@?*U4 KP @{è_@ { @@@4@ ? @{¨:_{S[c PGKSA[BcC{Ĩ_"H_qT$**D%R_(qT@%$RR{S@Q@@@?ր6%-cXRaRB#R}@*SA{è_*{S_qT`@*~*43R*SA{è_ր@7@ ?{@QS[*ckq)TSA*[BcCkD{ƨ_`@* q Ta@S*4@&T'B##^RaRR57RqmT@c@/@?T@95qT@qTҊ D@&@{qT@u{@$@*@5%@C?*Tc6'T'bRaRB#R+@d''~@+@}A!Ԛ| @`@|+@ k{@QS*qT`@* qTa@ 5qAT`@qSA{¨_ x" R{ *5 @{¨ @R{¨_{@QS[*c#qT`@** 44R[B*SAcC#@{ƨ_`@yBqaT`@c*7/@'8'<s~@/@}A!Ӛ|@1`.{@ QSqHT`@*R?*5@@q!T@@*SA{è_3R_qT{*`@ @5`Arq @{¨__ R{L(S3s[VR-RcWRRT5@h-`SAR[BcC{Ĩ_`@4b@qs"_cAcT@T_{ CRa A!, qT)@a A! R @{è_@ @a A!R{ Sc!A!j {¨_R! {z C 5 {_RA {RR{__Rd{ @g @{¨{cS4R[ks@@@(@@R!@K @ A9"#a?@5mT*˟qd@lT#SA[BcCkDsE{Ψ_`~@4 G@՚7C ՚;s@{#OC@s S` C@?T_T7@** <r`TK@#R{@#A9  O@OB9K S@AT@k;@?TKK_`T!T$({$ {@K9&{*R7@**[ @4@@[@|@($7|@@( T7@**[ <r[@TG@R[ˀKbK_kBЀB|@[@AA`H_{S#[4 `6@SA[B@{Ũ_S'@{S*@`@T`@kT ~@`*Ry 5RSA@{è_ut R(@y@B|_ @XA _ !`X_!(@y@y?qaTAX@y@ _!(@y@?qaTA @_!(@y@?qaTA$@_!(@y@?qaTA(@_!|?k@_{S[c*#^0@@(@!z!&šc!!A3@@&&F#iT|)@)$*?SA[BcC#@{Ũ_єzT")*2@"4"*A@ Ú@Dڥ@(B bKB|@(q`T hb8#Rc djT* h"8R_@BR!"@9_jATB*"9Q R! A@ Ú@Dڥ@(B bKB|@(q T#hb8 R j`T` h"8_@BR!"@9_j T@ 9Q R! cAc(@BRCr@ |@aT!R"@9_jTB*R"9_k!B RbDZBQ cAc(@BRCr@ |@AT!R"@9_j`T@ 9_k!B RbDZBQ {S*@/ d@ 6`*@y!|t@Ҍ<b*@y_qTBQB|@<SA*{è_R{AS[cks @\@yRt @qR @T`@y 4`"@*`"`"@c @ ښ*qT @54Q`@kbT`*@yw@|`5fqATt"B 9kAT`"?`@kB T`*@yt@|4&@y}6`@b @9{hzb @a@*!hz|&y`@hz@R#pS @9q T?qB`7#R % jT*? qAT!R*B * 9` @pS"`@yb"`y`*@y@yqaTZ@yB@ BQy`*@yqaTB|SZya@" @ XAB@ ` XR`@b @| <rT*s@ 4IR&@y~}*6`@*{{h|b @*|:&y`@*h|`"@`4t"@o9 BkT`@b @R|a <r@T*@54`*@y@yqaTZ@y!@ !Qy`*@yqaT!|SZya@" @ XAB@ ` X86`B@SA[BcCkDsE{ƨ_{s` AS[ck(@o[@xRt @pR@@T`@d@`@yD4uZ@o@uZt@ `*@y|~}Ӕ&@y6b @{{*|&y`*@b @h|`*@*h|`Z@[5:@BkT`@b @R|<rT@`5Ua*@y@y?qaT^@y@ Q<yb*@y_qaT|S^yX4:ya@ @Q `Z@SA[BcCkDsE{Ǩ_ւ(@! 9_kT`ZCz<`@_k T`*@yt@|@yqaT^@y@ D4&@yXX4:y\}6b @9{*|b&y`*@b @h|`*@h|d A!R"@9_qT@(RkT$kb8 7*&R*$k"81To@@a*@y`Z`@y`y@y?qaT^@y@ Qya*@y?qaT|S^y4a*@y:@y?qaTf@y@ Q:ya*@y?qaT|Sfya@ @Q R`@b @|V<rT*54CA!j`T qATB*RR{S*[*cksKq>KzTY4 @uR R*IS4 @*cR@ @R <r!T!L *+4 @kER Ҡ @|S;)T @s4Rs@z; @|S<Tw @? ?@Rw@z< @|S! T??@sq {!!T @w@@||35 @s@{@|s5 @k@@|kk@c@@ @SA[BcCkDsE{Ȩ_4]sQ*bY*@R @~* @Rq>rTҀ @|S7TEz7sqT @~;[4RRcR @RT @|S<T+* @77@RE7z<R@ @`P<r@T @R6Ҡ @|S! T7 7@sqz!!T @`,5 @ _1/{S[ck*sLJ0@(@G(@yeR*@{4 @`5RSA[BcCkDsE{ƨ_/0@(@,(@y"4@4Rc("! a4ZQ@ [ `  `K !|4@#@("4U*@T ~ @*R(K"q{*AqZ{_{kc AS4|@[s@0@+(@"@K 66. A8RYaRR@(#@x?kT@yA4@y*ckTD@kBTq*!!: @y!@!! ՚4w@w+ivSA[BcCkDsE{Ȩ_0Tu @y`@vˀ@yRk T@y!@BJTv.qT4*@3RRs"aA",_kTy~@R+h+&Z@AB _kT**R ՚'5 -!A?kTz~@?eR8,3Z@ A4 h`#"09|@c,kTK~@`z~@ER-^@B _kTA**R ՚@5.AA?kT{~@_RS^@ @z~@RT/tٚAAB~@h{ _kT**R ՚@5,0\AA?k@T{~@_RpXSAh{ @@xx8 !| K8|@~@`{~@RT0)b@AB _kTA**R ՚R@51aA?kT>|~@ҐR(sb@ @@@{~@~RW|2ؚA7~Bhw _kTC@**R ՚@5T3aA?k@T|~@_ORWWsAhw @@x~@<RA@ٚB@ xv kTٚ*~ x`R ՚4@@h{ @xvOA?k`T{~@ R{S[cks{@R33@*SA*[BcCkDsE{Ȩ_֓ @Rt3@z9C,tw!@A8@@('Qk @*ұ-T@ @R|g@4*G 5RX @y4 @@@9!K?k Tw@, ?kT@ yRA @y\ @yX7*7@1 T(6qTQ4+4' @ @@65!3@'%k@,qT`5*1T5 @3@| @7@H!+@ @! !@ @"@@$@ *1 4rR!K !{  skTr@@TnRK!<g@! ! kT@y@ yRZ#8@k!S4s> yU9A99P#*  @ sK{S[cks@A @@(9' RR@67?kTSA*[BcCkDsE{Ǩ_* T@ @R| 4R@T7@|5~@ @yqIT`jz 4@9_aT#־5ujzqmTr @ kT{S[cks*3޾RPӾbz"R4ž R6y}>҅RvRs"bRZRһB6RA@@\RZa_*!*`@1ATqTWR1Y727@Rʾs Lܾғ6@R*5{#kkT*vqaT@6R1T@yp607~}jv(Tjv3@yҠzv`stSA*[BcCkDsE{Ϩ_?xk,Tw{3sASa@[Rck@9@( 'o|7;6?o@kT`@*ҠLTSA*[BcCkDsE{Ȩ_րҸ @R5s@~@ @R|A521!TR@T?@y7~@< @yqT`jz43@ @9_T3@ #u5ujzqT;@* 5 @y! @y y*3 4 @ kiTj:u{ `A`@`@ @{¨_{SЀAa A!` A` SA{¨{S[cks@5@"@5R/A9B 4@@|c B@a"?7R@`A9k@ak 8A94qTUR@`TYڼ55 RSA[BcCkDsE{Ǩ_qaTRq@b"Q5kR R``@y @qT(@qT @q`@5@b"k@<4 R` qTqTqT8h8Aa@=D@y @kT*7@y57'8L<RZ8{S[ck+@B|@Rc"ˠo;?@9q T@49#Rn o@;@q T6 R8@9qT'@5RSA[BcCkD+@{Ȩ_1To@;@qT @  qT @4@{#R4T@9qTA*4w@9`5;@o@@@"@5@_q*Tǻ@j 8*`7?@{ *CR/R @{è_S@4qT/@q qT/@q R{[S A!#R 4@`@ 4`@RSA[B{Ĩ_`@b"a@-5@ A!{SwҕR-Q4ar@y`R?kT`N@5RR`@y`b@`?6`Ay*y@ b"bAR`4  RSA@{è_ R{S@0a@ `@|70@(@4s&ԚSA{¨_{S*[*&*[B*SA{è0@! A{ 0@ @@@{¨E(@*(!|@{SRJ @Rҕ`@kTR`@kTc@` @b"@a@|| SAp@l{è_*I*S>yWb @a@*!t`|>l*6Qb @a*@*!t`|>^{S(@y@b@QK ~@`"RluUa"@b @`@d@B|R|u 5`@gSA@{è_`@@48R`{S@RA4RA'R*`@b @R|Db @*|1`@Ma@R `@x `a@`@$`@``*@`@"yZySA@{˨_֕}Ӕhu`@h5a@`@?kT }Ӕhu`*@h5a@`*@?kT*{[Sc#' A@ R!( ` a2@!(@$`;RӺt4*`5 A"@ @! @@K`` @q`<1TD9i2v@}Ruu`@kHTu@kT~}Rv*6`@kT`@kTR`@k T`@7T`@6[B*SAcC#@{Ũ_y@}x @ҵRs6k7`@hw*&a@d@b @#xvR|u<rATy*@}x @ҵRS6k7`*@hw*a*@d@b @#xuR|U<rT* tC {cS A[ks7G_f?z RO@qGz!Tv@yR!4: {@SA[BcCkDsE@C _`@d@P6|:aA)"R O@w*?1T!@45@ @`6X;O@v*1aTt@;Rӹ6@*4҄ A @(@)ҕ @!R33@@\ AC@<r@[T @@"@q*Ay (@qT@?q@@7 A @: @RU; A @ @Ru; A @{ @Rr5);n@Z @@kaFTA)@ @*)@@!Q9;9{9 9 A)?{ұ?@RI5N@ @R V<r@T*55@RB;8*l5*@*|@*@y@@y?qaTA_@y@ @y*@y?qaT|S@_y@ @ 3@R @@R3@ @|%<r T*3@@5A*A4:3@+A4! @?qT[qZK!@**!z?*@y"+@y_qaTX@y!@ !y"+@y_qaT!|SXy"@A @!A B_kT @" @R|4*@52/A4 @R@/AR @Ҡ| ? @ |ST/A ?qTz_q{K*C@*{**@yA@yqaT@[@y!@ !Ay*@yqaT!|SA[y@ @ Bk@T:@ @R|<rT*i@5vt {{`4?qTqK*@*S| {{S@*@ya@yqaT`X@y!@ !ay*@yqaT!|SaXy@ @ ?@@kT@ @RS|J<rTS@*( 5?@{һ3A4 @R@3AR @Ҡ|* W @@|ST{@3A_qT!?q9K@**!yV*@y*@y_qaTX@y!@ !y*@y_qaT!|SXy@A @!A B?k T@ @R|<r T* 5V@{{4*6Rη E{{@R @|S @S@ |ST{@@{{ @?qT{@?qK@**!|*S@y*@y_qaTX@y!@ !y*@y_qaT!|SXy@A @!A W@!@k TQ @R@ @R|<rT*| 4S@ {` 4{@?qT?qK@**!|*@y*@y_qaTX@y!@ !y*@y_qaT!|SXy@A @!A W@!@kT@ @Rg|]<rTg@*; 5W@S@SxW@{&Ҵ@C҆ T ٚ @*_qT"B55Q@*!uw*@y*@y_qaTX@y!@ !y*@y_qaT!|SXy@A @!A A@k T@3@R @|<r T3@*5U@3@"yZy5@q7@9j7@` @5`@ @kBT`;tO@@3*1`Tz@,RĶTk@@qaTy47@G@7V@yy@y R~)C6y*}@` @|| Sv @Ru A(@ Q8[_@b @!(@ w@  `@R~`@|*r5b@B7**5@ R0@c(@ A@{+`K{k@R?k 3k @Rk@:QZ @ c@@k T1T @* ך$k@1 T`dSA[B@{ĨR|`>~ @Rot @ BqAT<?S@SA[B@{Ĩ_Ź`l?{S[*cks@d@P7u @Rw @ Ru`SA[BcCkDsE{Ϩ_RARd@b @R|`@`@6qT`?@4&@`72&@RR R{ Z@RR*b @R7k7@R`@b @|x@)@_kTkT*qT R@ZZ`@ya@R `@2 `a@#`@oRb @*`|DBR5d @*R  _kTc@C7`*!6*<R;_kT?kT!Zq!!Zj`T*{R_kT?kaTv5{{?kTg{S["ck<!Rr@ R<lhMRSA[BcCkD{Ũ_=Rղ8@9q@@@T @@qT'R`r @z`R7`rz`@ @RҾ@`r @z`@`rHar`R5 RqZ`r*z`R`rz`@@ҙ`rHar!R`{S[cks@\@ 6R@ A"PkH k @RS@ AR:R@ @R|Xx  ;@{ @R6<! R@@B@ _1TkH kzeҕ @RS`SA[BcCkDsE{ب_Ҽ2$@Rzs@Z1`Ts )#@RATsQҀs@ZkRo# @*|Ҡ6" @@*!@`|sq!T@ ARR%@ @R|x @;`@{җ @$Rα @*|Єhc8b4?AT_E|@he8e6BBh#8c*D_SA{¨_{S**!DD!@$T*{*S?q)T@q@T@q` T??q Teb| BRaRRRSA@{è_0qAT2@ytS5|3K@Xs@Xsx_2?k"T2@yR||"@kTR@~ DKk"@y@` 7" @@q@TqT0qTa @!|S Aha8@h`8 S6|S,R?kT2@y | K{S[c#44@y@2@y@`Tz84|c$z2@yTRSA[BcC#@{Ũ_@*!R[qT2@y*2@y(T Ě**FkT2@y |2@y!Rz84|c *z1qT߰{S[D[B*SA@{Ĩ_@!!z !RR 6ҷe@y`.@9t2@9d.@y *e4bB@9"4`V@9RqAzTQ<8qT*`T`6@9f6@9 ?Td5`&@`4aF@9~S`J@9Q *jTD5a&@4RB<{BaÚcR@9B `N@9 *C5c"@cKRRc?q0{" SC5h @* "q!Tw@as@a.A5@a.@ya3@!Xa.4@yA9b@c2a"y@cc/@Xb2ywA9b6y?@T*eФbХ:BCQRaRR;SA*@{ɨ_ւ5eФ:QRbaRBR*F|@@qT'ReФ,:RRbaRBRDxSq!T@cKc`*`"RJ9!|!!4zV``*@)`*@~) Ҁ3@RB\HB{Bb&BKB b{S@BBzBc"ˠsz "!RR.q T*SA@{è_`Ba!*@5!`! b4!`J! 4{S[@4SA[B{è_c@b@`@t4@y~4`@q@T`@c$@@ bKku*7`@0@y|`@a@a@4b@@@qT!a@4@y|A$@kT R``@@ `@`qTa@!@?qT?@qRR!_2{ @A5 /@!|S!Qa``@@94 @{è_@!Qa{S[c# RSA[BcC#@{ƨ_`@a@`)`@`@9_qT.@96! ?<qT76@94@9CzwҵQ1T@9qEz Tb"R_9S@@*ja8!@ ?,!T?kaTT``v9@9R?j T2@96KH"@9R?j`TR"b82@9 6a89@9R?jaT9`D9q!T9`@` Raha8h684AT:j$@9*j 84!aTr@9 84`z@9 8A4` X qLT|@ ƮL@qT@`9v{S[c*k R@94qYzT W7 SA[BcCkD{Ũ_֔R@94qYzaT`@4_aT!ѭ5`@(@a)(@` @9@5_!T!!/R,@(@`)@(@` R+@9@5W7``4`@ʭa@#|@S 4`@ TK5a@ ,@9`'6b@ 4@yC@qT!(@y!<S ` `4`)R){ `D `3R* @{ʨ_@l`, `D@ +`Dg@*4`lb/@`9{0!SM*5bRG*@qSA@{Ǩ_R{[0!S,h*5"R&*4@[*@5BR*@5@[B*SA{Ǩ_ր@@s{c0!S[ks/*5"R*5@@'Ay (@y_q4@34@y<S?#AyJT_TҚ~s R~@JTZ˔ TҺҔA!z?@dbSA*[BcCkDsE{˨_**qRT`,G@qT@q`kTZ_2*4`x29ZaC0 @ **qiT@qT@qRRkBT*RT~@*5 @ _2*~QkTc@*77@`4`xqT@?q T?@qR!kT{*_2 @* Y*qT@q T@qRkT*_2vp{[p!S!p"RBW* 5BR*4@[B*SA@{Ĩ_s{[@SQ40RaA`B`A,@9! 6R`RSA[B{è_Ra@ { @| @{¨x_{SC* 5@9a@9!@9@92*SA{ɨ_a@RR{S[ւ$c@z RSA[BcC{Ĩ_zu@5u@ T*T-C {[CSckCsM@9qT64R;`?R{`RҍR҉R4҅@@TGRD8`@9qT C#@@ {@3@R3@F$@T@p@@9@9 *7B<@+ 5GAT@95R@9@9 @9 @@9`@9 @9@9 @54<@y! ?(@q!TW_#qT`{@SA[BcCkDsEC _ր@G7@3@C##@T@@C򁹿j 8CB9qTG;*sssCa!:CCzCs`@9`5{S[c q TPRe0PGTGbaRB0 RV{C*SD[EcF_*B$WePRetPGTG@@fRGgVG`PeCRbaRB0 R)5~@&R@*cXxc@?@b5@?*`4#e@b B0cRaRfRG RgVG?@4#Pe@ RbaRB0fRG RgVG{S[c*k @x@@{@2N!4*1TR{B*SC[DcEkF_`@9a@9z@9 `@9 @`@Q?qT`B@9RaF@9bN@9 `J@9w @e@9``@9BQa *6*`5w@kTkT"KRB B|@@Є;e bB0_RRGaRVG R&{  5 5{ {_{#qZ{__C{S[cks`5{B*SC[DcEkFsGC_E RҼRҸR4Ҵ@@T`!st u# Ec@@ Ҁ@@W@x@@Ro"@T@pp@3@ 2cW]"@T@p@y09W x:; Ga@9{`@9 *`@9a@9|@9 `@9 @a@9``@9 a@9`@9 `@9qTqT 5@X@iT`!,? RG@`p (@$ ښa!҇҂%c0ǚǀ@ *AR 2R R!Q?@T  @ 5  q}@`xdTR#yjjTc1` aRB!a!@ B@` ga`@cOW!@hT@^`@p@sAR 2R R?@T  5  q}@`xT!(R(R  1 Te C3RbaRRGB0VG R**`*41aT{X5@9@9 @9@@@9`*_{S*`$*%*5@ `@*SA{Ĩ_{ `E`x@C``E @{¨x@ @{¨_X9A7!29B9!x9@ (@@ (_{S[**c**CRq*4q `@z`T ebB#c R+aR RRGVG{C*SD[EcF_C{S#X97C*"q*4Є9aReDRb RRGBVG*{B*SC#@C_ֳC{S#*Cq* 6Є-ebLBRaRRG RVG{B*SC#@C_{S[**+*!@9@9 @9@@9 `!R rkT$4{B*SC[D+@_֤Є'eRfRGgVGbaRB ROЄ'elbB%RaRfRG RgVG?"R@9?,qiT 5Є'e!RfRGgVGbaRB R'B@9F@9@ J@9@N@9@`bEc kTc!bFcFk5Tq AzTaD?}TaB9A6RkT_kT5Є'e#%RfRGgVG Q"|@c@9@9A @9"@@9A`k@T5Є'eh#RfRGgVGy{S_lqT R 9R 9R 9RTpQ 9R P9R @9>H d9^PBpQ? 9?$9! ?9? 9?9?9?9?9?$9?(9?,9?49?89?<9"@9 H9~S L9!{B*[D***cEkFSC&***R*q @zT{B*SC[DcEkF_**RR* 4Єh ep#wRbaRfRGBgVG RB@9F@9 J@9@N@9 `kTЄh eX wRfRGgVG{S܅Rٞ`ޅR}О`"`@J`SA{¨_` EEt:A !K``"RF9a7!29_x@ Oy Oy_k_xR_x@&{CS[`C uv"3@!T`C{ASB[C_ @aAbC@A"|`CRfRGbgVGB#aR R{RD  Rݤ @{¨_RR{S[ aj@`:@?kT:SA[B{è_֕~@`:@ @{S@`  cbB@A aB@SA{¨_{ LCb!R{_{S"%[ҀzssTSA[B{è_@@Ҝ30@!4 @0"B;C @ "B_A50@5C @$B;C`@`$BA0_ѣc %{S[txb@&TB_!Tx@'@@`%6Rٝ&c@ )*5@AR*`rA9avA9 `zA9 @a~A9`*aA9`A9 aA9@`A9 `aA9`A9 aA9@`A9 ` a@9`@9 a@9@`@9 `a@9`@9 a@9`@9 "aBA9`FA9 aJA9@`NA9 `&a"A9`&A9 a*A9@`.A9 `a2A9`6A9 a:A9`>A9 *abA9`fA9 ajA9@`nA9 `.aA9`A9 a A9@`A9 `aA9`A9 aA9`A9 2aRA9`VA9 aZA9@`^A9 `6`A9bA9 *y`@9a@9 `@9 @a@9``@9 a@9`@9 a@9`A9cA9fA9 `A9`@``A9cA9dA9 `A9`@``B9|cB9 F9`39e@93c@9 e@9e@c@9`e@9ec@9e@9ec@9cA9eA9e cA9@eA9e`gA9cA9 gA9g@cA9`gB9cB9 g B9g@cB99`ZC?mT\9E$RRGBVGB# RaR R0@*bBBaF!bbzE!Q! !?kT E2#mRfRGgVG҄aF'Ra!$ҡ|!D?!`aBJT`>*5aEcF"QKB `EB Kc|@B|@`B |@a!BR`v`j@AU? T:t`v@ RR|"`:9= aj@*`:@?k, T@9!29a:@ `A9x `9A!`3bRG` cVGťL* 5U#aD`a#`aj@`EbKa慹 Q!|@!|U#L``@@96`"g92`"'9bX9!RBBS *5a>C0#*5)* 5*#bC`aDBS!S#* 5aX9`"g97`"g9@ 7#*` 5#* 5`"g9!x`"'9<@Tm a:@!>*5`:@`:@$`:@`A9!2`96Q(*4a"H?1Tl;EBХ3B#fRGxRgVGaR ROu(@Tu"@T,'w`byuy@YbERRRR%aX97x`"'9b*Da.DA"*.@A"|?@A"|@8Rb `@2` E0`:@ N}2*@*u{ *4D* @{¨_{ E`x@!R CR_@T@d4 @{¨_RcR95 pqHT _D| A !|{?qR"s@pqHT {¨_{Sԅ"?@RP@RRRRJ*4~@SA{¨_s{S[ g9a6@05{C*SD[E_@iT*@A9DA9 aJA9@`NA9 `"bA9aA9A bA9"@aA9A`&q!TX9b6?qmTR E5ER#aR+B RB7RGVG&@qM9TsB929`j@94q Tun@9u 5Ra@9`@9 a@9@`@9 `a@9`@9 a@9@`@9 `a@9`@9 a@9@`@9 `a@9`@9 a@9`@9 >a@9`@9 a@9@`@9 `za@9`@9 a@9@`@9 `aA9`A9 a A9@`A9 `aA9`A9 aA9@`A9 `ja"A9`&A9 a*A9@`.A9 `a2A9`6A9 a:A9@`>A9 ` aA9`A9 aA9@`A9 `aA9`A9 aA9`A9 abA9`fA9 ajA9@`nA9 ` arA9`vA9 azA9@`~A9 ` `r@9av@9v~@9 `z@9 @`BTy06bA9aA9BA bA9"@aA9A`aaB9 SSE!t**ZG9_kTE_kT?k ЀzEEE E" |%E@QB @Q  Q cKKB`n@95j@9`@9@!j@9 @ `@9@aE k T;E9.RRGVGBaRB7 R R;EBB7:RRGaRVG R qLT E7CHRBaRRGB7VG R9!p9 E8cKRBІRGB7VGaR RgaRA9`VA9 B939ej@9`@9@!j@9 @ `@9@akT;.REХ@;RGVGq-TqTqT qmTj@  kkT?kjT;E<1RB#B7aR RRGVG(EkT;E0>C2RRGVGoaR>@|!_ T;Ed?3RRGVGB RB7`|#? T;E4RRGVG qTE?qT΅)1!| !pk TI7?qT QKKK?k TB kTD_TaA9`A9 aA9@`A9 `?RQAsrkiTR)@R'`R%R# R!@R`RRR7R{S[3#`ZcD$R*R @T*1T:"@4{CSD[E3@_@q/T@"@q0T@`@*&@d cD$RRARp @T@kA-T7-4 @D)?q0Tka,T@=`@!``+5v2G a@"@9 @9@ "@9@ @9@`x 9#A9"A9b #A9C@"A9b`b#A9"A9b #A9C@"A9b`b#B9"B9b #B9C@" B9b`b#B9"B9b #B9C@"B9b`b# B9"$B9b #(B9C@",B9b`bz #0B9"4B9b #8B9C@"@7aEkjTbECQjT`@dEkTeEkKT`@?kT@T`@cGkkTcGk T`"HkTkT`@kTkLT`A c7?kT* 5i>CjEC}!? @T?TgE`HkKTfEkT`H7hH ?k+T`Hk TkThH7  5?k TbzIk Tk Tb~IB 7hHB ?k TbB96bIkl Tk+ TbI 7fHB ?kk TaIkL Tk Ta"F 7BQ?k Ta*F 7_km TaCa + T?@ TbC _@ Td"C @a T!+ Tf&Ce*CBB T?T@AT?cT@ TR RЄ;E`2A RBBaR RfRGgVG@R`RRRRRR R@R`RRRRRR R@R`RRRR`8H C)cK RcxS J@ *_ RB96{* @?kT&@QqmTEqTH!K@)54HHEk TEkT_q!BzKT@TR{_"@@QqmTEqTH!K@)54_HHEk TEkT_q!BzKT@TR_E#R EE !KR! ! _k T R"R  ! *_k TEREK Zqi KLZ)l K_q! QqZRdKB| k BxSBlkqeZeKJqKZ B9c K !cJrRa1?)d%) xP I  R!,||c| B !|cl}$ !c "@TB#?k!|@d#|@A!f&˟kTԅcca!!d_cBtS! B!  {S43A)B 44TSA@{è_HRRQctSklT`*_%*!|*B96{! @ @?kaTƠ"@)7EkTEHC c7kTc** 5B kT!?aT{_֠Ơ"@)7EkkTEHC c7kTc**5B kT!?aT_֠_{C"EdD"|@@*šE_kjTEHQGЧUG\<#RBaRB R}{A_֠H?kjTQGЧUG\pb>_ kT<s>Є0.E, #sRB RBRGaRVG{BSCC_R*R{v kT&QG'UG4Ed #vRBaRB R{B_R{R[!S75`B96bzHI"bjHBpSbjH=pS"R8qhSZ^!*TbH[BSA{ĨwSA[B{Ĩ__q$@z TED!KR!# @ _#@H!a!(@{HH72H{xI{_{S"@@9B7#B;C"@D@$#Bբ7HB@SA{è_R Һ  D` @b}@`@A3@aT @ H@` rs{#R!S71`5`B96bzH"bnH)AbE bEB_k brH A?TbH@SA{ĨSA@{Ĩ_C{S[c*kChD@|| 9hE)R L 85`B96*"**@5`B97*"5@Q){C*SD[EcFkGC@C_HHdH**%R*5* 4Є(E BB#ÛRaR RfRGgVG}`Hurt{ 3"c@4|@ @{¨_c@C{c8"S[kC@{jDkE)*R׏5`B96"@*p"`ET*m*4 E [#{㣀RfRGaRgVG R5*("@*fRGgVG?E CRaR R~@.dH**%R *`5K*4`B97"@*"B^aE  aE?kT?kT`H`@@{CSD[EcFkGC@C_*t{S[*cpDaR4|@[BSAcC{Ĩ_rDj@TH6REzSKH*BkTF@T@@97!B;C` @@b !B`7HHa@` (@!{ӵ Q@T5@TR Ҍ2 @!}!@kv5` @` HHa@` (@a@ @iTaւߢaTs{S[5R[B*SA{Ĩ_RRbE@| Ŏ`tRkaH`HkR|@`j`t#u$ RRү`Z)BTRҦ`@ ``R`dHazIc~I%R/*5 CR75*`5 Ҍ`E kLTbH*4kvH * **7aE?k,T7kT" ?kkTbDA} JIh!bDB@`D @9Bx 9`D @9!x 9{S[*tDTB@9@6`vD!Tv`D`nDn`D 5trDbH5RkT@@TQAT@a@ qTQ"|@ qmT|Thc4dHQkT"%C@B@!T`zDx`Dv`Dt`Dr`rDp`Dn[B@`jDSA{ĨhSA[B@{Ĩ_*{S[+*"@9#@9& @9C "@9b@F`1` T"R rk TpqRsЀk,T*5{BSC[D+@_ bj`8_8qT?@ \q T*****%R5`R@9qT`b@9af@9bB@9 `j@9 @an@9``F@9@ bJ@9@`N@9@`7 E kT5X(EpBBh# RaRRG RVG` @Tv5X(c RBBhaRE RRGVG*R@ {S[*3*RU5**vREK*q @zT# +RaREEBKBh RRGVG~@{CSD[E3@_sE@QK  _{SR*b"@9a&@9A b*@9"@a.@9A`b2@9"a6@9Ab:@9"a>@9A aR@9T)bB@9aF@9A bJ@9"@aN@9A`(aR@9? qHTa@a@" @ @@RSA@{è_՗RջrR`E{S R[* c*Wj;aRRGRVGKERsK @qsҀ##RRGaRVGE R7{Ce~@SD[E&RcFR;@RAR {S @TSA{¨ @A"|{S*[u"c*k*EK@T{BSC[DcEkF_****qT KqlT1T`E!4Y 5<EC(RBaRfRGBhgVG R61 TB1'@T[B*SAcC{Ũ_35@|SQqT@1!T#W1T7'@@"B@@kT @D@_k!T3R*{S#[4qkT'@G P@T@@|SQqHT!SA[B@{Ǩ_!CYc@ `CXq,T#iq4T'@GA@P@T@@|SQqiT6C R{S[**c*#5'@CG@`@c[ )k}5R^ SA[BcC{Ǩ_qAT'@G` kRaR@RcZ@2wZ )uZ{ 7qTR: @{è_@'@G4{SqTTR! SA@{Ĩ_`"g9`6RWqKTT@ @` @@97^@T@7@4Z{S[*c**cS#*7q!T"g96*Sc!*7/@ @` @@97)/@IT*Sc)q!T/@W u`RR@RZ@2g^ )Z*4[B*SAcC#@{ɨ_֓5/@W@@c_)*5"g96R *`5dR {S[ck+R*qTT7@ @` @@9@77@T*h*1T 77@g@"B@@_kTT#dD@@kCT@_kTT D@@?kTRO g@W~@7@*'@?kTKg@qTCs c|@cs~@?klT9K'*G*4(~@@!@@?kTTD@@_kT@?kThT`~{D@@?kTs~{/RaR@RcZ@2*4> [B*SAcCkD+@{Ǩ_as{SS[cc#7@*7@`5Scu*4 "g9@6ScR*6u~@SA[BcC#@{ƨ_Sc%4/@RW [`ss @`{k`_kT G@|StWk!T}*4I3{[RSc#SCW@T*1!T,cC ) )*@9a@9w@9 `@9 @a@9``@9 a@9`@9 `7a@9`@9 *Cg9*@4[B*SAcC#@{Ǩ_cC )g )*5`@S`@{Sh@TB@9@A6`j@T`^@@tCN"B;CՁ D "B`r@`@SA{¨ $@!RkTQRd_֤ G@||{(&hfk(TTG@@kTT** R@_!"{bhbklT @?qT$@@(@DC$@!!|@klT_! {Ӏh` {S[w"`&@kTT`B@9@7{[BSA@{Ĩ_֠{j`a"@?qT@@9A7kC{S[Rc*kC,`jB)R@+***"R*6Bt@?,b@9f@9 *&j@9n@9 *"`EkLTq Tr*k TQR?kT$!B;C`C`!B"B;CՁ D "B*{CSD[EcFkGC@C_v 7 #$RaRfRG%gVG R"@%@R!c$RaRfRG RgVG RdЄ /RaR%)#" RB fRGgVGad΅0|@ @'@(Did8@9 @9@ @9`' @9@9$! @9@ @9$a$ @9 $@9,! (@9,@9?A a iE kkTiE k T7iE klT@@TdЄ %"'R"aRfRGB gVG R@R}Sh6dЄ %""B aR RfRG(RgVG`R& 5}{dFhFk5@ Tv 7 *RaRfRG%gVG# Rq`F%$C*RaRfRG RgVGcRlkTkTv 7 +RaRfRG%gVG# RL`F%C+R`F%aR RfRGgVG<REc!D@#@ @kTT@@D$@kCTiTdЄ %&"B R-RfRGaRgVGR%|SQqiTdЄ %'"B Rc.RfRGaRgVGRB*{tC{S[6@!@~SpdB)*c@5C)c@kTb@_kT`@d<<%"`@H*B ;RaR RRGVGN{BSC[DC_<{ E$@a|@5@|S7q*T`5$L+"Bd+FqT"B,,? "B+pDx`"B+6 @{¨_օp"B+L2$*,*"B,#,qT!!, X`_ ,_{S4[~.cks @9!@9f@9 ` @9 @` R rk`Tң'RaR%d. R`{BSC&R[DcE#RkFRsGARv֖#RaR% R.F`@9a@9f@9CR%/ `@9 @aR`* R7fR@9%*h/cRaR R+fV@9qT* `,xaRaR% R/`"@9a&@9f>@9R%00 `*@9 @a.@9``2@9 a6@9`:@9 aR R`B@9aF@9fN@9%#R0 `J@9 @aR`* RfR@9,qHT@Xfxf և`b@9%af@9dfn@90c)R `j@9 @`*{BSCaR[D RcEkFsG`r@9av@9fj@9v~@9 `z@9 @`*4q (-uc*RaR% R(1fn@9 '-q-*RaR% R1**RaR% R1S+RaR% RD2 SC+RaR% R2`@9a@9f@9+R%2 `@9 @aR`* R`@9a@9f@9+R%43 `@9 @aR`* Rr`@9a@9f@9+R%3 `@9 @aR`* Rc`@9a@9f@9+R%3 `@9 @aR`* RT`@9a@9f@9,R%$4 `@9 @a@9``@9 a@9`@9 aR R=`@9a@9f@9C,R%|4 `@9 @aR`* R.`@9a@9f@9c,R%4 `@9 @aR`* R`A9aA9fA9,R%5 ` A9 @aR`* R`A9aA9fA9,R%l5 `A9 @aR`* R`"A9a&A9f.A9,R%5 `*A9 @aR`* R`2A9a6A9f>A9,R% 6 `:A9 @aR`* R`RA9fVA9-RaR%\6 * R`A9aA9fA9C-R%6 `A9 @aA9``A9 aA9`A9 aR R`bA9afA9fnA9-R%7 `jA9 @aR`* R`rA9avA9f~A9-R%T7 `zA9 @aR`* R`BA9aFA9fNA9-R%7 `JA9 @aR`* R`A9aA9-RfA9%7 `A9 @aR`* R%fD8.R{BSCaR[D RcEkFsGu'-`b@9uaf@9f~@9.R `j@9%8 @an@9``r@9 av@9`z@9 aR RY`@9a@9f@9#/R%8 `@9 @a@9``@9 a@9`@9 aR RB`@9a@9f@9c/R%1 `@9 @aR`* R3`@9a@9f@9/R%L9 `@9 @aR`* R$`@9a@9f@9/R%9 `@9 @aR`* R`@9a@9f@9/R%9 `@9 @aR`* R`@9a@9f@9/R%<: `@9 @aR`* R`@9a@9f@90R%: `@9 @aR`* R`A9aA9fA9#0R%: ` A9 @aR`* R`A9aA9fA9C0R%,; `A9 @aR`* R`"A9a&A9f>A9c0R%|; `*A9 @a.A9``2A9 a6A9`:A9 aR R`A9aA9fA90R%; `A9 @aR`* R`A9aA9fA90R%$< `A9 @aR`* R`B9aB9fB90R%t< ` B9 @aR`* R`B9aB9fB91R%< `B9 @aR`* Rw`"B9a&B9f.B9#1R%= `*B9 @aR`* Rh`2B9a6B9f>B9C1R%d= `:B9 @aR`* RY`BB9aFB9fNB9c1R%= `JB9 @aR`* RJ`RB9aVB9f^B91R%> `ZB9 @aR`* R;`bB9afB9fnB91R%T> `jB9 @aR`* R,`B9aB9fB91R%3 `B9 @aR`* R`rB9avB9f~B91R%> `zB9 @aR`* R`B9aB9fB92R%> `B9 @aR`* R`BA9aFA9f^A9#2R%D? `JA9 @aNA9``RA9 aVA9`ZA9 aR R`bA9afA9f~A9c2R%? `jA9 @anA9``rA9 avA9`zA9 aR R`A9aA9fA92R? `A9 @aA9``A9 aA9`A9 aR R`A9aA92RfA9%L `A9 @aA9``A9 aA9`A9 aR R`A9%aA9fA9#3R `A9 @aA9``A9 aA9`A9 `b@9uaf@9fn@9#4R `j@9% @aR`* R~`r@9av@9C4Rf~@9%L `z@9 @aR`* Ro`@9%a@9f@9c4R `@9 @`*`@C#RGuc5RaR% RQ`@9a@9f@95R%< `@9 @a@9``@9 a@9`@9 aR R:`@9a@9f@95R% `@9 @a@9``@9 a@9`@9 aR R#`rA9avA9f~A9#6R% `zA9 @aR`* RaBA9`FA9C6Rb@9%gNA9< aJA9f@9@`@9'`*aR `@9@@b@9``@9@b@9`@9@ RabA9`fA96Rb&A9%gnA9 ajA9f>A9@`"A9'`*aR `*A9@@b.A9``2A9@b6A9`:A9@ RaRA9`VA97RbA9%g^A9 aZA9fA9@`A9'`*aR ` A9@@bA9``A9@bA9`A9@ R`A9aA9fA9c7R%h `A9 @aR`* R`A9aA9fA97R% `A9 @aR`* R`A9aA9fA97R% `A9 @aR`* R`A9aA9fA97R1 `A9 @aR`* R~`A9aA9fA97R%X `A9 @aR`* Ro`A9aA9fA98R% `A9 @aR`* R``B9aB9fB9#8R% ` B9 @aR`* RQ`B9fB9C8RaR%H * RF`A9%aA9fA98R `A9 @aR`* R7{BSC[DcEkFsG_`@9Cw@9#R *`@Gu`9RaR% R`@9a@9f@9:R% `@9 @a@9``@9 a@9`@9 aR Rf@9C:RaR% RD*c:RaR% R%:RaR RqT%(:RaR R@A qT*;R@A q T*C;Rk Tfjv8F5s?`B@9CaF@9RvN@9 `J@9 @#``@GuR `j@9% @aR`* R^`@9a@9>Rf@9%d  `@9 @a@9``@9 a@9`@9 aR RG`@9%a@9 f@9?R `@9 @a@9``@9 a@9`@9 `b@9wxf@9#@RaR *%* R%`j@99fn@99 sr *C@RaR% Rd %c@R aR RkTEQkMT΅0|a`j`8#A)< @9bG"@9R:@9;,@9  @9@@"@9` @9  @9@@"$@9` @9  (@9#@@C`# * *CARaR R`b@9uaf@9f~@9CR `j@987" @an@9R``r@9 av@9`z@9 aR R@f~@9cCRaR%Gӥ\ R`B@9aF@9fN@9%CR  `J@9 @aR` RƀC*k T~@DR}`aja8@9@9" @9A@ @9"`@9A@9"@9 RA&aR%dT DR% {S[tc4~.ks #(@"@a|@!_A! @!'@+!#@ CoR#@ @aR@ RP '@qTaEkT%cpR aR RB7:8RS?W '@k,T{DSE[FcGkHsI_ #@W@qXoB)\@RMT`W@*pR aR RZOS@*qR р%l{AS[u+(~.*@uRaR R`@uRaR% R`"@7 s*`B_R%f^\vRaR R`@*` @ vRaR`@ RgBqT{BSC[D+@_R__R__R_R_R_R_,C8CE{CSD[EcFkGsH`*e4wGxExW4R{C*SD[EcFkGsH_4?klT R_Bhb8q TR E@_ @_iT@BT@{S`([*c#e@eRut|T\0`SRSA[BcC#@{Ũ_֡ @@ ?s`{S[cks*FR䅹3Mt dE*RR*q d@zTuE@$R˅~@~@R raTZ4~@ZKs˵ ***%R7A_q7@B:TZKs ***%R31Tb@9a@9A b @9"@a@9A`?kTZ sK1T`R@9q!TZ Ks`EkT3@R[B*SAcCkDsE{Ǩ_֟kҕJ@5bE`4K kJTA5s!RC{CS[cFn*5cARf+@*;@5/@@9ˁ6`53@?@"kT!`b=҃z4U.fRGgVG-RaR R(;@fRGC-RgVGaR R?@fRG-RgVGaR R /@+@' ?kT3@`@@y`X9 6~@Rgs` a@@y`@@9@9A @9"@@9A`"29"<S9"\S!X99ε̵{A*SB[CcD_`5`EKKk T4?@5aE k Tt{S[c*k*s*EKK1@ Ta:@ R ,@K@**9@( T*Rq T_qDD:!T`EbE K! |@AK4ˀe@!4@"zE*`55K4 kKTK@6`EQK  K*bER@6BKB|@Zy**@T @D)9 `X96`"g9 7@Rr d)s(a@` {CSD[EcFkGsH_***%R*1T** 5C@9G@9 K@9@O@9 `p K qT K?qAz)TD( BURfRGaRgVG RD(LBcRfRGaRgVG R~@_1TC@9G@9O@9 K@9 @aE` \K  KK 5**R$Ri1! TaE "QK  KK L*@5`EbE K! |@AK4ˀ5klTCha8qT*DЄ(!B#6 XRfRGaRgVG R**A @@BT@9_qT@$@bC|@Q@T @`T @@$@A"|z@QDЄ(bRaRХt"fRGBgVG Rv***%RwY{S[*!c*kzR;xEB_k@@!_kTRR?@T@`4D@RҼq EK|qT**RRH*q @z!T**RR1TDЄ, Х<#BRG*VGgR R DЄ, H&BRG#jRVGaR R~@{BSC[DcEkF;@_`R@9(q TDЄ, *$hRІRGBVG Rab@9`f@9 aj@9@`n@9 `ar@9`v@9 az@9`~@9 @ TDЄ,  %hRaRBRG RVGϼ`"@9a&@9w>@9 `*@9 @a.@9``2@9 a6@9`:@9 `@TDЄ !4'BpRRGaRVG Rw|{BkF*cE*[DSC;@{S`(QsQ`@@uSA@{è_{ @!@|SqTqT$54P`(PY @R{¨_E!R0$R @{¨D8@?jTR.@{[`(6RSgQsR`2@`5D#`@ )qB:T1ATa@4SA[B@{Ũ_րDv2@9@9" @9A@@9"`@9A@9"@9@9A ``2@@4aB?TX96@a@@Tb@@JT`@ a/QF*QIP߲?T#_A_Z_R{S@[*c*k**a@?HT`R@p5@Bp! 0@9sB'd)309@+@/@`b@aRASA[BcCkD{Ũ_`C{S[6@9"@@95@!@9~S *6 aF@9A bJ@9"@aN@9A`?`T q!(`(D/Х)RGB)VG9RaR R{BSC[DC_a@9?qTqLT`" @95qTa@9`@9 a@9@`@9 `a@9`@9 a@9`@9 @hT QR?qTDЄ/ *9RaRRGB)VG RK`uTC{S[cks@X@iT*{C*SD[EcFkGsHC_$@26@*2R@iT*v7`EaAK?kTDЄ,)`@*~RB)aRfSG RgWG`#g9v't;@2tC`#'9dD*uDSR@TaT`#g9`7**R@T`@`55Rq)T`;@k*TDЄ,)X5B)ÁRaRfSG RgWGκlaDu@`@ "@?(q@TDЄx!+ckRfSGgWGaRB) R$`@9d@9A h@9"@l@9A`p@9"t@9Ax@9"|@9Ab@? TDЄx! -lR R aRfSGB)gWG&@DЄx!aR3#wRfSGB)gWG R@T @9$@9" (@9A@,@9"`0@9A4@9"8@9<@9A `@`D?#T&@4DЄx!.#oRfSGgWGaRB) RV@T`@5a?@`E?kTt;`@`?`@q`@ iTDЄx!/#pRfSGgWGaD"TDЄx!0pRaRB)fSG RgWG$a @IT` "@ qT(q`TDЄx!2#uRfSGgWG@c@9g@9o@9@9 k@9@9 @w@9`s@9 {@9 @@9`@9 @9 @``k@kT`E?kT`E?k+T`E_kT`EQjAT*Yc@9g@9o@9@9 k@9 @w@9`s@9 {@9 @@9`@9 @9@9 @R`@O?nu@kT@_k"TD` 1cdRfSGgWGR&ng) S:I\@V@N&@4Dx!2tRfSGgWG:?5`Ek`RҀ`C@kaTuD`'OO@aTwC'BOtDҔbя @ Rb;@ @!@#  T"@`TRb#g9 @cD\@)"64@**@T@AT*R`@@KK&a@`EK"! ~)#%RRS5@1!R**R&@ ITD</cIRfSGgWGaRB) R('@D<aR9cURfSGB)gWG R@a @IT` #@ q TqT 4 T'@D<7RR#aRB)fSG RgWGqT@@9@9@9" @9A@@9"`@9A@9"@9A@9"@9a @9#@@9a`@9#@9a@9#@9a"c[C_T?lT_ TD<6PRfSGgWG@pA9tA9A xA9"@|A9A`@9?q@9" @9A@@9"`@9A@9"@9@9A C@*D)* 4<@@R@9@9C @9@9b@@`0 @5'@+@W@9@9 *@[@9@9 @9 @@9`@9 @9@9־@9 a@@CT`Rlv; 4sDwC'u^btbTs'`@T`#g9x`#'9@R@@l;@@!p W)4)@*  3@9S 3 39J @ :73sS@ caC'h68$bD`!@@`@9d@9&Rd h@9l@9@``R#@q@ @`.@2@9|SQ?qT6'*4 @@)VC64qT*@* 5`#g9@7@bрbTuD RJCA ՚,@ ՚_,@2!K*@) 2#@) @@@B`K @@@T @@!@5@aE_kAT`4!KKD) @R 2@(T @`;@#@dE!@"@`4K*5@O@Ta CR`|`;5v3`.@|SQqhT`@}@ ~v@`&@A"|n${S @TSA{¨_aBH!QaB@A"|Z{S@Cc !9R8Bxs`@@ R|Rk@@TK6l:/x`@@aa@!QaSA@{è_R@"|! J"?q!T@b@|Rj t`@``@`ҘkA TK`6;b@` TK@6;@{Cc\!9R8wsC@#AA@!Ad_{S[@CcL?!9$R8w}s`@vTRXkRTk@AṰʭ@TK6$u{S*[*c*#*SA[B>cC$#@={ŨCRaRBd? Rf Ҙo@T?ouvSA[BcC#@{Ũo?qTD5@@Q kT @n5j@TC)k⷟_q VzTk Vz TzT@T;u_qTz-TRf2oxvR)ujB)R`@` Ra"`*`6B!J?lqHT` @R`&``:` `>``.``2`P`B``Fs a @*SA?q**[BcC#@>{Ũt{S[j n h@t*a @>cC)?qa@t`@& 6ttSA[B{è_{S*0R5AHR*@6@*SA{ʨt* R ҷnqbҕ*sK q,T*SA@{ʨ_{RARS7*4R*"RB q Tt*SA@{Ĩ_SA@x{Ĩt@9tqTt{ f `6@PK @{¨ot @{¨_{  1aT@PK @{¨\[t @{¨_ֈ{Sa JtRAR`6xBtSA{Ǩ_C@*T8t*R{SAHR*0RF*6v*x$t**@ @*SA{è7{S[*c V ! SA[BcC{٨_OSA[B<cC{٨sL4CsC 3@sH)  @qT(@qT@qcb`BBsBBs{R 6*{*s{_{- 6* {*ps{_{/ 6*{* s{_{ 6*{* s{_{S[ck+,@ VVKx6aAbA suAR-9RzR`AkJT R>SA[BcCkD+@{ƨ_tAkJTVK6*hs#c=!R8`soK{@~}`kt \q!T@x6*Qsb.@`ZaA`K@?֠4`kt@ 3`k4`Aa@``Y `bB@*@?`kt  3`k4R{SDA6Tb"@aAVK5Kx6dJA* saJA7dA?klTqTVKx6@s`F`J K"c@|}`h` LqTVKaFbJx6sBaFA 7`JAD?`&ASC R[`@G`BA 5`A?kTbA?k-TTKkT*`AkTVK6r#c=!R8r|n!KR`@!|}hab 3h!`>A`>t@cBAbFATKT x6G)*rd:@b@`Za"A`K?.`&Aa@`&`BA`BkkT```@Rbꀹl RSA@{Ȩ_R{S88@RSA@{è_`>@@`.@`B@*5`@`@Rf``@aA&*uaJ^bb@4B|@Rsl.SA@{è`"@uAK@TKx6*crqLT`Ab.KR> R`Z|~e`aZA?klT Ra@5x \AE9 * R_{S[@`:A4* RqTzT*SA[B{è_c@a.jt8bh!8a^Ac.A! a^abAcjt8c.!Jaba*A!a*7a@kkTR{S[ck@`:A5V*R-9+*k TSA*[BcCkD{Ψ_`.A7a@kk T`FA6@x6a>AbJA<qa>A`ZA?kKT@x6q`F`J(tJA`AkT`@cd>@a"A~K?@x6@*@@q@q T@a>`J`@tFx!`>A`>@x6*HqBaFA7b@C`BAd>@e"A!`Zb@`!K?`&A[@?kaTc@qTs@qTa&aBA`@!.aB?kkT`Fa@`.!h`8j58`^A `^`bAju8J`b`.A`.`*A`*}R|z{ 8Aa4,AA4;a>AbY`@ ``AK`@TKx6a*AX]q`@c R @{¨_@`Ak TcAkTc@!K$|}a!`hd ?LqTR 3`h$Ba>A`@?kmTxb6@R{ @TKx6a>A(q @{¨FƼ%RRRhe8hg8J6c'JBJcT$*@2$9C862B062C062B(62C(62B 62C 62 * 9@ C`SC62B62C62B62C62cBSB** * 9_#@9@@9H@9cJ$@9@@9c%@9JJ**@ 4DJ R) |S?kg|S|STkJi ?UqATJ R) ? kTaC(6!2C6!2C6!2D86!2D(6!2D6!2D6!2|SBtSE(6B2E6B2@ia8#Rb BJBi!8 R_֪ R  c iR   @ ` # C  % E c  @ D  d C  q!T(9@@9 9@@9 9RG%RRR*?kTc|SC9F)_ hd8hi8c Ji6J(Je@9D@9f@JE@)Jf@J** 4'*k|STJR  kTEBtSD6B2D6B2kT!R! he8!Jh%8 R_֠@  @ |S |S @  @ |S |S! R  fR D   @ |S % $|S !  qAT`@@`@@`@@R@4"A!(ZAKkয়_A"@_ qAT@B#@B, @"H@A_!_֠Aa"@_ qTA"@!H@_aT_a@_T!A$E%`-T_ց_?AT@!T{_ց_?T@_{BB RD@B@cq@z+T_{BB RD@B@cq@z+T{_{Sd@`T@d@`R@`V@l` @? qT2` ` ~@``@"耹bAB|@ š`r@`z@`&v@`"RSA{¨_?qTR*?qT2qTA!-|~ yq-T hx#hbxA!4 q0_{@hQ!<?qT@E<,qT@ !@{_{R*@TqTR{_ R{||SSs |@` ajb!Qaj"?qlT@@y`6|tBj SA@{è_{A!-SR[ yqLT3v~~Rij6x Ry[B*SA@{Ĩ_s!q!TqhT{|~ST-[|@ y?qmT!Q!<y5jxq(T|@S||s4aj`bj`!hS!!$@"$3bj ?qTaj`!@E <x7qHT|aj`!,2aj ~j6xSA[B{è__a!x""@9b5R__k`T! R@9RRf R4qFzTqZ_ք{`4R`@9c4qFzTqZ{_{bGANS[T[BSA{è_R`R@9`@9A45&R@95`@95҉he8  ki4 *5jhe84 **@5_ kT *  `@95@9*`55kয়jT*c@c *  c{c@!@9?q{¨_{S[c#qTe R[BSAcC#@{֨_*//@R c~A4L$R@9J*`F5D4/R/@d@94*>4E4/!Ug4!/Pg`5s@qT&8&8c%RE*"@ qTw R{S**S`@"@9B4(4SA{èSA{è_֠{S*'SA@{è_@@qTH@u#R@9* 4*_{$@S)!T@*SA{Ĩ_*`6`sR#RRҟjTR@3@4`7@a4@c *{S[?!`fqT|@jt84cR`|@`@tf`jt8}4j48џ1ATRSA[B{è_{*S[cks<a|7w)uSA*[BcCkDsE{ɨ_*_`6`zxQ'*qs{`G#*7G4Rt~|3jt!hQ!<?qTRfjt$02j4G@y*w7@#RR RRR5sqaTG@y+@q`T qT;R"s@`4`V@xs@qT`V@y`Rj Ta@! A4;RqaTR*j T**`Rj T7@#Rd @4`;Rkq@z T;506@ A!4;RL5!RH* *RRR||jkhQ)=?q-T@E<x7)@ATjk}c|!@BqT{@cRj!T!R?jTw@8 B! *6t@`47 ҵ/*`4G@@RR;R`k@@zT507 ;RRj@T WBB *Rq @z T"|@7d@|ӄ@Dh D|``hd`h$s@S!,S?b*w@@#@**S**!@!8* bBH6 @6 S@@B@!*{4RcR{ *=qD-*30}@!T-0* @{¨_R!R*R{S[cksaSA[BcCkDsE{ƨ_*** *>*N@TqZ@`7Z5@  T@3sq(T@-7y?qmT!yB3@TRRS5*574*v3Kk֒*6qmT { 9 kTskTR{S[cksaSA[BcCkDsE{ƨ_*****@Tq`Z@b7@3 As46q(T@-7y?qmT!yB5@(TR54*@! A5v3KkR֒*,q-Ts { 9 kaTkT*5qMT35@JHBqT`=R{S[)0SA[B{Ĩ_*`6`'RRR҆3@4`7@`4t @B! d`5`@ Aa4a@? q5!TTLaTnqqd@z`TKR{$@S[c ) )7!TSA[BcC{Ǩ_7`6` `6`7@sC#cR S3RRRlRRcAT/uK@5O@@4`R3qZJ)*`4u /@3!Bc`5t@ A`4 `4@@?`T @ qaT@D@zATT3@*RV"RT{S[ )/@:[B*SA@{ƨ_7<%`6`c{`6`/@s'3#CRҏ@K@4`ŸO@`4s `@`4+@Ec``@ At4*RR `{S*SA{è_`6`*`6`@!R`*~{S[@[B*SA@{Ĩ_ **TK6[i`6`4ȀR4@ NcȀR5Ic-2RDcR@&?cR||jb!,2j"qAT`~cj xTAT5q 4A9!R9u95`wz@RR{S[ d[B*SA{è_*P`6`[AA4}$q@zT45-R*{*y?qmTyya@!hQ!<?q-T@T`@T``@@E<qHT`@,2`ߒqTRY"@R{   @{è_`6`A4wa@|!BCAB?ATB,H`b" _$`T!@@A _"@EA!TRA_{S[) SA[B{Ĩ_`6`#RRҀ;@4`ҭ?@`4t @? qATBB&I|@! ! A? rSB SzTIR0b`BBt 2`B`bda"`A`-CEC!CE@`c{Sq`BB6Ri`A P@a"AtNcBB"L@!#L3A|@` R`A`cB ! җa!+a#R`"yNSA{¨_D{ < @{¨_9bAaA`BBx `BA"0R$@_q-TMR@!_kaT_@f$@qMTbMRG@TG@kTa$[!a$_֥BkAT@A$@?qT_DM#|hcATh#!C$@kT{ @aE9 x`9`@`E9x`9 @{¨_{RSAAK`~}[`RZ`aE9!2a9`@R R`~||@Z``~AR~|@ZaE9`!2a9`@RRa`~AR~`@B|@La RSA@{è_`E9x`9`E9x`9R{ :`AfQ` @{¨_{S[c#*4VQR9Razu!*`z5"Tq @zT[BSAcC#@{Ũ_@R$RB|S_kRן?j Taz`?q{S*[*c**4Ay`K?klT@a"`5sAyqT*Ҭ @kT@k!T@5[B*SAcC{Ĩ_{S@Kt@_J@a ?bC`A"SA@{èO{S#c\/ɀR!8fFb TKt@6bB@\f`@#ʀRc\/a@`?T#ʀRc\/`B@`@y2`ySA{¨_a @`BTb@c@"A`R@qZ@ A!QfAQ{ a5s!!`??T @{¨_Rhb8Cc<4B_AT_!a <_)$(ĚqTA Da_ք耹{ ZaZ`kMT`Ha|"hbB4aT TKP6f`ZR``ꀹ @{¨Y` !R@M @{¨_{SZQ`G`A|ha?Tb"_@SA{¨_B_TT TKP6He`Z`"@7B2""R @t[BB@3 _ qiT2 TK?kTe_*_aT R_Bhb8q TR{S**a@K@4;@`5qSA*@{Ȩ_ TK`X7R*he{S* @X!s @aVYSAk@ן{è_A?qTA?kTA?kT{ TK6xe#c!R8pea!K@!|}bhaD PqTR 3bh!_{`SRU_^<T^<b9Rb9` ySA@{è_!({Sb@R3_`A`fSA{¨_AyB c$@B|@HF|S E|Sb ~'hfBJ RBJ"h&K@_kiT@c$Bl~$%hbcJ J h"_@B RB|GC|SKD|S#xcb$kTcl~!hc! B*@AyB @ _{S[c#@ 4WQ6RzsA**4zsz3qKs|AjTSA[BcC#@{Ũ_8S-R** 4 @H6*d@Aa?k*TWK6d#c!R8dS`A?kT@"KD|}b"@T`hd$3`h$Y *RjQ1T R#@ qT_kTD|SR5k T @q@T_ք|ScQa !A$!@xa{* @Bc!A *  [#Q@* * i{ƨ_{S*7@SA{¨! TKX6LCd@R耹SA{¨<^{S[c4@"qT*_kHT@|SR5k Tu@t@qTq@T s's @zsqTz3|S`a@``@`kT TK6c[BSAcC{Ĩ_ַaz3zsQW@Bl^{S TK?kTdc#c<➀R!8cw_@? qT TK?kTxc#ŸRc<a"@#bRc<YJ@`B@bJt`@M?T M?ATa@y!2ay,Z!,`@yx`y>SA{¨#?q"ZDB@BC@5҂%aTd@@b@џkT`_xw@_c@{S[c*6YGR|RRrA"!@!T!AkmT**$qdDzT|@BTC@5!_!TqT`U@@@k@TB@*bVA@!R8]u`@yJ2`y``cLa#@"H@@b HL`<`@yqx`yftRZ`@9@p2`9`@@xc 5! ""R*Aw q TqT[BSAcC{Ĩ_~ @vZ|!`R`B`{S*bRd @9! H!29TSA{¨_{RaR     ` RR` 6R!R` 6RAR` `L@b MbM R @{¨_R*?q T{*{"{_{Ss1\R|@V~@[j48SA@{è_`{S@y@6aJ@?qTu@x`y<aJ@CA`VG*`@qT`JNSA@{Ȩ__{S*[5ck+AVK?kTbA?k-T6*?b#c!R87b]v@8K}8rTjwhc_hB\Tc#b~jwR 3j7`YkAT`YkAT jw7*n4VK`(6R-Z Ra@?kT!d>5`@6**a9`Z`VKh4*| a`Ya@vAK`kT`AkTVK4jwaR 3j7>R`A`jw *2j7VK (6*<$+`@K6*qT*qTVK?kT*"a@y R*y`[`VKh4*#SA[BcCkD+@{˨ax@^bꀹR~[ R[d:@Ra"AK?q TVK?kT*"wahSA[BcCkD+@{˨_?qT{S[*ck**+;@[!**5`WK6*$Na`AkTaAkMT`WK6*Ba#c!R8:a\v@K*|} `WKH6**$%)a`6@54jx `q`T R[ R*,jx ?PqT Hq`T`qT`Y**``jxLJ! $3j8T!P!5 PqTHqT*SA[BcCkD+@{˨_`[`_{S[*c#*@@q TC5 TK6%`c?!R8`u\R*"R\ **B҅5 RSA[BcC#@{Ψ_**4qT?qlT#Rc*}C*/*qT TK6&`o@@qTkT*CR"R 5N@N**XR{SR[5R-cRks[7w^`?A@6A?qT TK7w@ 4#@A?k+ TA7A?kTA?k- T TK6!x'L`AA*k*T@_kT(?`A_kLTkЂ_klTkT!!TK6*,`#c!R8$`[*K@|}hh i ?LqaTR# 3h(ZB@AcQ6A,(`A!Rf 5qsZA5@6*_%K@@|}A3@k{LJ! $3@k;AAqYA!Q@kT@k{R 3@k;7@4@k{x@k;@k{7**q T@6*D+_ER*"RP1?@@`4k"T 5 TK6*,_[Q U TK6|*_R7@**@k{@7_#*f7@뀹Y*`5@@?kT@K@?qqT@Ay?kTA?k T TK6*@R@!K:|}a!~4`kzRr2`k:@jT*+Y_ R@k{2@k;q,T[B*SAcCkDsE{ͨ_ @? qT@H@_R{*Sb4 *"R`@y2`y MGR`@y2`ySA{¨_&@@T__I{x@ʀ ~@I@&@AT{_{ @qTsJ@| @{¨_{B|@SR[Xk`R@qaTQ!<-B|@X|X@`R@oARo95!h- XXQB|@ XgXSA[B{ƨ_`bA94abW`J@qT`@a@"耹RXaJ@?qT`@҇ Q*B|@W`@@`8*{S[c#![BSAcC#@{ը_ TK?kTx-^c R!8^%Z@ qT TK?kTh.q^Rc <I9?-`T_TRc `R@qTW`4@` @ykT`J@q,TC ROCҩW{S[*ck*@@ qT TK?kT4/*^c5!R8"^Y`@M Mt_q @z*5q$@aT@ qT`@y2`yT`@y2`y**R *|SSA[BcCkD{Ũ_R{ :@"4@B4@! M_TRB$R`@#πRaJ@"ReJ" @ R{¨_@ya6{ @_q!T7L@X@_qT@Z TK@6aR@@0] @{¨@`@y2`y @{¨__{S[c*ksP@Y5@Row9?T#@A @k T!|Y5R ?kLTY_PqiTRBR ?kkTY 45Q ? 7SA[BcCkDsE{ͨ_6RRY54YA` 5RR4Z5Z;`WK06A*3H]@AY|kA?qTAKk@ kA`WKk"TAkL"TuK@~}ky5T @6C|S*BLJ*3&]ky ?TqTR 3k9ky*xk9 R\q"T`WK@6*4]**cky ?`qA=TR 3k9i5@RRRAk T4`5@SB6B _TqT[5R R" R**q?jTZ5AA@K5 4@RRkw 4YxSk?k5ЀR RqӀRY_kTs4YqTYk(T TK 06Y*@*BK0\Z4ZZ qmTQ35#@A?kjTYo@4 TK 06?@\#@A?kTY4 Row@qTo@wR*YAkTAkITY_kTA?kMT TK6b\c!R8Z\X!K@"|}!hbLJ$@ TqT@9K?kjT4YkT4YZ57@8Y`4qRBRkTZ4ZAkTAkTWK 6*`K@|} h`LJ$@ KdYWKB06YqYY0Z*1\Rg* 4*@qRsYv@Y_kT@ `qTs@qT*`4s@ RQs#U#* @; P-@`6*YR)5[Z P-@6Q)@*47["R*:RK R`5@!5BK@@k@T P-@6@*6[@@@@ T4YQ@ $3@O@Q@Oq TLY@x!YR@@y7*@Za5)@@qT@K@&`Ӏ@K@c##RZ##R*`7@5@@ 9BKRmRY!@5AALxs@Z@ Z P-@06R@;[R@ (ZQ (sYkT@AA|?qTAK k@kT`WK06k@8[Ҕ7{S[*Rc*k*@eC**qmTc RTR@)q,T RqT@kT TK6*:Zc4:!xR8ZV*RR*5[B*SAcCkD{Ψ_o@*cK*qT**RqT*yR"RO{S[@&@qTU RMR#@!T#@4#@skmT*B!kATsa@!5`@$Rb@a @c@z@z,TsTK6SA[B|;@{ĨZSA[B@{Ĩ_{S$@AzTbM |C@h`b@_q!SA@{è_$@qmT{ aMR"@%@E&@5& @kKT*c!kAT`@!4 @{¨j_ @{¨_{S*[cksR@7q,TSA*[BcCkDsE{Ȩ_7@_O)@ 8_kK"*{~@J@kaT @ 4'@*qT`@*"@38 ???'@qMT Z RrkT Z  !@ R !S?7@K{ 7M? '@?k,T *o!S*c{S[cRk*s@P-7)CHS@)@4@*@* @*7{@9K{5Z5 {n@5!Rr 4aM? a&@?kLT *;@~@ S*R****R*@$@qT*{S[**1**@SA[B{Ĩ{S[cks@pJ@? T!haꀹ!!`cN)ЖBZS-{7=c)k Tk@4g@^*6b@RB9BKR*$R*lsJ@_qMT@RI@`4@"R$xbBc_ aT4SA[BcCkDsE{̨_s@*N*R@*\*1 T*R?qMT`@aA|? kTaA  klTA@?kT* *6XQN@ *CρR"RQN"@Q{S*[c*ks!=*@HQ`@y6LTq @TRd`@wJ@(q T*R  R@RQ`@`V@`@P@ Қ@@9@4RQQ`@qTq Tq!T@ Qq)TyJ@ `ә&`@@@@Q4 @*C)<**S`@9!2t!*a9" RQ` @9#RaR@ )` 9@A*AAOqן`@qן *w 7uJqT*㥁R"R`@$@k Ta@y!xay 4@A?kTA?kTTK6bWc!R8ZWSꀹRhRsqTgQyRIQuҀ`@*aJ@a!=wP.9*M"|fbhbaT@5!!K@!|}@ha2@h!SA*[BcCkDsE{ߨ_R{"RS@y@!2yR@4aR@`!T^MWҁ@b TK6aR@SA,>{¨VSAR{¨RRSA{¨__{S[@H@.8R<`@qTTT=tJ`@a@yX7P@ Qq TRRRң RSA[B{è_R{S*@y07 RSA@{è_*54RRRRR~ *|S{S@@a54@4ҥ`N@qT`@y`6`@a@!?aTa@`@y2`y (Z ( R`B@Ru@R MB>0*a@ q@TSA@{è_֡MB$"*TK@6aR@?ZVa@`@y2`y (Z (@`56@4``@aZ@ Z\{S@? q`T(T?qT?qTRSA{¨_?qT?q`TSA{¨P@TTK6aR@?VaR@@ tR5SA{¨*H@J@"@bC!{S[c*k*s**3@T qTP *i[BSAcCkDsE{ƨ_@y*H!2yT*c@Nm`@y2`y@` qTqTRRR6utJvJ‚R@``@ a ***{C R{A_***{C`R{A_`R_{S[@y(6`@uB@_a@`t@?qAT@4SA[B{Ө@T Rm@ @ R`@MwRRqTj U? q`THT?q`T?qTRSA[B{Ө_?q@T[BSA{ӨbJ`A"5`J@9J5`@R[BRMSA{ӨB>{~{{S[c@ qTc0"R!`8 U`P@@ qTBRc0"x@ ҔN TRSA*[BcC{Ĩ_ֵK@y@'6D5UT RR@R@y2yKR#R* Ts@{S[@ qTc0>!R`8T`SPIR-zu@TSA[B@{Ĩ_`R@s qaT@6aR@T @{@?qTH@{_?qTH@{N@耹@y~" BB_AT_B@AA4{S[e`&@qmT`M`Gt`LSu^A\Ta6@ ![BSA{è֕~@L`Ma&@`M?kTD SA[B{è__{[SVKcks@6#T3VK?kTTRSA*[BcCkDsE{ƨ_t A4VK?kIT draC)?)|)5!R ``@aa`"c @a6@54`@qTVK_kT?qa@`Т,BBS5`@qT5`@qMT`"@qTdAqTbA_q-T _kT7*qTVK?kTbA) @Q_q`a.@a2@Aa:@ab>@"b&@b*@bB@bbF@b6@5aa>@!a&@a*@aB@aaF@VK?kTTZqBZd@B!Ra $b)`A! !QRaRqT`@?qB5@RB _@qA#R_k` Qa)@K<"lS!lS_qR!`y` `ya kTVK?kTKB! |SR@cW` ` G w2 Rz   GM R`@FEz T  &7R`6@`4 R`5q74VK@6(S `&@qLT&`R~ӨF` R|PqmTR`&~@RF` R M`M~Rh8`M `M`@F`M`&@kMT &4`6@4`@45Jd``` 2Q*pT57R4`6@5 -`LETK ` 4|R`A4`:@`4`LW5n  " `A5`>AqmTTK`G6R4Vq` MH@@a M!@!T`MH@@aM!@T`A55{zS-9t@@T{c_AT6@1@cMBџT` M@TbLT@A$@ qT?T?T?T R!@#@ qaTqAT@6R@MR`Lf?T@R%@$A&AkJT_֣@b\T_qT_qT _ qT"@gLJc$@BKB  {RSYc&@(Z kT`@Ka"@ K a@SAq{¨_bMB@_q!A$A?1@T_{[6|@SLR?@qTkTs kTSA[B{Ĩ_a~@3TK*?{c8|@[SR3KO@_q TO@s a~@3T3KO_k T@ kT`~@B|@K 5tO@[B*SAcC{Ũ_֟{S*[q@zT *|@3KO@" K!B|@KO@RKB|@4KRSA[B@{Ũ_ր{!|@S*[c*k Ks*_*S66S67*]K*_@!  [kT:7**L*c3bK[s3J~@  WKRSA[BcCkD{ƨ_`{,qן{_{S*[ AZK`d>@$?*@qiT`@`A?kTbA?kTTK6QcH !R`8P`LC!K`@! SA*[B{Ȩ_{S[ AZ5K`bZb *"RbTK86b@)XPd:@*?**SA*[B@{Ĩ_TK6Pc>!\ R`8P`YL@@A!KbQD@A!Kdf,@ZAc!K0@a R_!TKp6@) A) P_!TKAp6{C @ @@)A)B)@ xP{A__{ !@a"@a@ b@a @!5a&@4a6@?qTa@A!Ta*@#2!2d.@q!*!2d2@q!Alb6@!p*a6@?qTaB@  @{¨?qaTa@ {S*4bBSAR{¨SA{¨_{ SR#J@1`T R`@a @b @b@b" @6!l`& @l`* @x^`. @t]`2@a|S`6q@T`BkSA{¨p`SA{¨_{S @1T4R^bBRnqT!05H`8C@SA{ĨGR5R{s\|@[cSCk7@T"TSTSA[BcCkDsE{Ȩ_YR?qaTz`az`bz z 7@!? Tj`8aj`8bj 8j 8?,T w?q-TY5@`@ahTZARsR TTC||@;xS !|@?? 6?7? 7;@3;@3@? 6?73@? 73@G`3?@ 6?73@?q3@z?@ 6?7?` 7y 5@@RT3s?3@qs@ TTy 5a@@@A`Z#R{?qT? 7?qT3@? 7?qT3@?q3@z?qT?7?qaTz`z`z z 7@!? Tj`8j`8j 8j 8?,T?qaTc{`A{`C{ a{ 7@!? Tck`8Ak`8Ck 8ak 8?,TT5@`@a#RsTS# 5_Ta?qaTz`az`cz z 7@!? Tj`8aj`8cj 8j 8?,T3s?3@qs@*T5a@`@a`so?qaTcz`a{`c{ az 7@!? Tcj`8ak`8ck 8aj 8?,T?qaTz`az`cz z 7@!? Tj`8aj`8cj 8j 8?,Tw3?q3@-TY5@`@a(TBbZ_Zӂ_qTғqTA|@"T!՚h`~@3T՚pA@z:? qT!CD{`z`z C{ #,TDk`8j`8j 8Ck 8?AT~@7? qT!Cz`c{`d{ z #,Tj`8ck`8dk 8j 8?AT{ hMj `L  @{¨_{SR@@!|@!@Q|@RKt~~@dA`j R`A` `jM@RSA@{è_bZRB|5G R{S*[cksA;_kTA_kmTTK6*Mc>!R`8M`JI@SK@BQ|~}Rd;Z @R3zn;@7BG@_k@Ӏ@ [*@*ka T@@q T@ 4@qh T@3@?TqT;@ kMAT*b `@LJ! $3`cvGFG@sG@ZKF7_qTC"kMqAT@qT`@@?k!T ˚R@|RqTk;@_TqTk|2k!R`8L`H@ʚ RK|F@RA!R)|~}Z33S)b|a@ |gjMRq,TB?g@cKwc@kИF`@7?@F`C*s*qTs@qT k|2 k!R`8BL`G4K`@~}4ha6vZ`@kTSA[B{è_**4**@LJ! $3`Y`@A! A" _kTA_kT{`TK6* LСct"!R`8L`GBK@B|}hb2h"`TKh4 K_@@|kTTK6{ KR{_$@R_{S*[c#(@ 5(@?* cc!#*cc!7*q-TTK6*@ K` [` q-TTK6*K` [` **7q@zן!@TTK6* K`[`TTK6*K`[`!R5SA*[BcC#@{Ǩ_aRRcqEd*@c*?*cҀEk@qTTK6*[Ko@qTTK6*(QKM)*4*.k@`7o@6`R TTK6*h`TTK6**q@R{S! a6SA{¨@R!L%ha8"pS$RpSBj@TcJxS_kAT!? AT@a,3_{@@uRBtRBJAQ?qT"|S!(R!hb8!Jh"8*{__qZ{S[*RD`@`49*SA[B{Ũ_`A)@L@$ S_q!`@bR,Jӄb@D`!@BlD,N*@5;@C{@yy@9/9@939{SJG[*G5RD RJC*@4SA9 RA@  ! bR  AA    @ Cq)G@`Dq`TS@K@yyoA9;9sA9?9#lq-T['@`|SaL@a ~bTSA(*@`q!a RSA[B@{ƨ_`T[{S*RNDa@ R9~U`@ҁ~!NSA R{è_{S6G[*5R*D R63Cҁ@~D@3~!Aw@?kT`VK6 LIAg@?kT`VK6CI{@?qT`VK6;ISA[BcC#@{Ȩ_ցAkJT`VK6*,Ic"!R`8$I`D@K*9|}!)ky\T$qT ~j`!j {S[VKRjTB@6@[BSAh{ĨH@*AQ?qT6a@<Ha@R@?kTVK6Ha@w4?q)T@VK6@H@P@@_k`T_ qaTqTVKa@6H`@qT*@9 4*@9qTSA[B@{Ĩ_VK@6R@ H`@qTVK6[B@$!R@SA{ĨH{cWKSR[?j`TaJ@v@wR@NC@CWK6sBS-4RC@kTSA[BcC{ɨ_*@*n*4*#HO@kTS@k@T@6S@***!aH_{S[cD?:R!"`8QH`CVK@6a@? q`TkT#AH;RcD?ITSA[B{è_ց_?TVK_kT#*HB=RcD?@@{S[@y P7Rt@VK?j`T@AbJ@|?k TA!!Q?k TRRR`@y`7R@Re * 4VK@ 6_qУc$bJ@aR@cq$%Gv4VK 6aJ@#R`@y7b@@@TVK6aR@%G`@@@_ qTVK6aR@&Gb@_ qThT_qT_q@TVK6[BaR@'SA{ȨG_qRA "lq!R*@QqTSA[B{Ȩ_[BSA{Ȩ[BSA{Ȩ855_"TKR_jT{5S@TbaTSA@{è_֠BV@_{S[VKSkT(fGc b5R!"`8^G`CRjTa@akT(PG6Rc "@_ q`TkT)CGB7Rc 5H@R`@@TqTVK?kT*)/GB9Rc @SA[B@{Ĩ_{RSVK_j@T*aY#kTVKkT,* G LG LSA{¨_ R_{kS# WK[cs6aAbA,Fu@vA -8RR``AkjTvA|.;`AkjTR* @*, '@@ 3@@@1T@ 3 WKh6P)*F@$qAT WK 6*-F" qT WKh6(.F`Aa@``Y `xAkMT WK6*Fc?!R@8F@5BKR|@}7k`8\Tu@@kmTq`TR^c*M@ q`T@4`Y`R4@qA!TR7@@k` 37@k!Rr TqT*54#/zB!5 WK !7 RSA[BcCkDsE{Ψ_@5w5`R`A``@aYK  WK6;@**0FRvwv@**`4@"RLJ! $3@p@@*#R+q`@qTT)b@QaO@?T`Oa@a5`K@LJ! $3*@_@@_k@T@@@@AqTRn9 @ WKAb7`@y 87@Qq`@yhT2`y@`A`WuK@` 9Y.?E?@` @9@kTaK@R"RI`@yx`y`@y`?7*cR"R>2`y@`A`WuK@` 9[`@ybRx`y@@@5aR@!R`@qTqTqT`@4vw? qTR5R WK6/rE`LG@*A`` a#aG`K5RqTR`A@V@@A@RR"R$M{1@ER@#@_kT@!@K_@K!{S[@4spSTQ Rzvc *?qǟq_jaTSA[B@{Ũ_clS3ROqaTb@a@?k R_R{S*R>/`R (R+@qSA{è_{R *@qAT#@@qT'@`R (r?kAT+@qT/@k @{è_R4@4ZR@!AAkTe4_ւ@F TqTFLJB$@K@_kT@_kbT** c4@4ZA5_4@4"@Z_kaT_4@4Z4B@kiT_4@4!@A6{Z!@{?k_ R_{ 4@4<@?$qTZ?kTR* @{¨__qLT@AR [RA! kBT4TK76*x1YD@ TqT@s4kiT** B4@@4 A9 5 A5 A!AKqן_R4@4dA!5{4@C)RC!K@@E!c|$pS C|A!C@!  A@!|  @d@AqTaN@ @{¨ @{¨_{SVK[cksx6aA|2C[\vA5@4!R@5eq`VK ` 4aAT6C[BcCkDsE`ASA{ɨ_րVK@63CVKx63C!R4VKx6(4C`AR )`As`Aw`Y{`*Z`.Z`2Z`ZwAuAZqTa@KrS*QkT`~Aa@~*IkTVKx64CxR-RR@<RTbqǟjTRr=Rk4*qTVKx63eCRe4Rq}_xBр H7aS@o`@@ P@s@ydK@wc@`3ye@3ye@S3ye@S3ye@ S3ye@S3ye@S3y` @99`O@qT`K@C@@kx6c,5!CRqaT`@qATa[@b@Rg*4`@Rq@RqaT`@R<R{SVK[cksx6aA6B`6@4`A9@4VKx67BRn'5RVKx6aA?BSA*[BcCkDsE{ʨ_R2 4VKx68B!R4VKx68BvAuARqaT{@qT@K`@`rS@*`@`@`*@a@`.@`2@`kT`~Aa@~*kTVKx69BR-F:9Rrq{@?qT@x6*RRvB@x6O)@G@cnB5RR9R9jaTz4AVKx68_BRx4RDqTk@{@?kVK 6*>HBd@?1TG@B@G@@Bk TVK`6@@<;2BM@ S@4 @bR@@ qTVK?kTO)@ARpqaTK@ ?qT7@ !W7?qLTqTB2"yB2"yB2"yb@a@kTg@tRqR*9yY4} {S[c#@q T@6@5 RSA[BcC#@{Ũ_J@T@3tS TR4BꀹRq;@kRғ*kaTs595LT3RRS5@P@ Qq)TR#RR*RR_R{Sc[ks WKaAbATK602AR`~}R47R47 WK 7RSA[BcCkDsE{Ш_֠DA> -tA{@R7R`Ak TWK6*0A7@~@c3WK6@WKQh6*@~@R; R*`@*, `9@`@ 3`@a?qTR 3`WKh6@*b@B\T@`@ \qaT`>A`>{#?@@1T 3dqTWK'6*-@LqTWKh6(.@`Aa@``Y `HqT@ߝRrA@Q?kT7@~}7@5bh!@aZ?kHT`WK`6*D@FtA @kT`AkMTWK6*{@Сc?!R@8s@@<K*ajM~}K`@?4*4uZQRR@5*R _|Cj2T?Hq?Pq*5?@K@haRr TqT*;@;s@R!*|AjT7@Dv)V5WK.7 Ru@{@@V@5*`*[`*@`5<5@55aR 3`A``Y`RQ*@@4`.[`. RHqAzATWKbZ@_kT4**|.?@R 3wuw4*`?@ qaTP-@ 6**\?@kT@?kT@q@T4`@@?kT@@?kTP-@6X)**,?4**|@B@"RLJ! $3@@'@?qT$QP@| T@*@y87N@@!?MT qP*R"R<R"y**@LJ! $3@4@@@y`87`@@5@5a5@RQqT*A` @4@A@@A@B@@R6RR{@ \)ү@WK6*F? @y 86<R02 y;K| @ A WA?qT"R@bROO@A+A @yx yb@@5`R@@@O.O@`M_T` M@4@2 @q TqTqT!O@ C?jT;K@jT@bR@ C@@{@ @y2 y qTTK6/>bL6R!RA5W@@ !!W+ K`U?HqATRK@ 3?@ h"l( >R @y!@`86?qAT@qT@4@q!T@A! Q?qIT4!S@?MT S@2*R"R) @y?7"@|@@_k!T@Qq @yT2 yA W` @y@;K 3 y5WK6@*xq><R*\{@@h@+c|a|c|@}A#cDq{Ǩ_ R_{SR[c7|@h@0@qRTKp6 A>`@@|TСc0! bR@84>@9` @4`ꀹ Rc` @q`@7K~@?OqSA[BcC{ʨ_`2@q{S[cRk @h@ |@9`2@qRTKp6 =w @47Rv @5@Tb@c*` @4aꀹ4! qAzaT@qT`R`[`q(RT R@OU`ꀹG[_*7`2@qq@zaT@qTRSA[BcCkD{Ԩ_@R` [` {S*h@TKp6 =@a~@!|!|@qSA@{è_{S[c*h@WKp6 g=`@a@~|!|@u*4WKp6 Y= RWKp6@@`O=qSA[BcC{ɨ_a@#~8K@4k@ARaR{S*[cks`@@<|c$ТBRaRR4|RSA[BcCkDsE{ƨ_{*@` QA@(@ Ty@u(z9QU59j TA@"ҡ7TƘRaRBR|w@9KkҔK~@64`@A@KjTz"c z ~@6 R&TƘ< Ra@KW "j`T@@ "ҵTƘ R~@6\@CQ@qT CD@ @L@%!K@"@@!05 @K?kHTD% BK*@*\Q1Ta@!_F˟ hi8h"8B{ RS[cks; \H)@5 @b! K1_1@@@ (*# )@ 2@ R  @C@ 3k@&* E)G0I)8J)|RX@KRKo@lS  ~ӸhukTH@8]S!*} S}k TMK M h5 ҵ  * 4@K@v A9"ѭsB9-hm8) `R} qT q퐜 K-R}~ӹjvkTV@8]S"*} SyS~kITHKH *8qTk-h$8*;@?BHT,KcKXK @@,@,3  $q Riv8R K-RZ{S *[ B8B; ?zvkTV@8]S"*} SyS~kITHK; 9H *?@qTKcK9YK*XKh5|~ӭK cKhxkTH@8]S!*} S}kTIK*0*)I h8G@* *,@kTM@8]S!* } S} k'TH Kr{"H ,( RR(R}~ӚivkTV@8]S"*} SyS~k(TMKM *XkT)K) ,q=T? q,eS @kTH@8]S!*} S~k &THKH HR~ӘiykTM@8^S!*~ SyS}k$TVKV i9}~ӘiykTV@8]S"*} SyS~ki#TMKM i9}~ӘiykTM@8^S!*~ SyS}k)"TVKV i9}~ӘiykTV@8]S"*} SyS~k TMKM i9}~ӘiykTM@8^S!*~ SyS}kTVKV Qi9 qIT }S25qTQUһB(5R"*{"yC59~ӸhykTV@8]S"*} SzS~kITMKM *h9Z{SqT 7-5kTHqRGR瀈) ?T5ˈ@,˿B)5!@,3k )KA5*6#+T˄5jh88T9YKh8KcK *(5 RSA[BcCkDsE{ʨ_hzkTH@8]S!*} S}kTMK-M h:hukTM@8]S!* } S}k)THK@,kH h5@,3(qgRiu8(h$8(R瀈* K *c K *XKh5q R*gR*瀉C@ *9YKh:KcKhukTH@8]S!*} S} kTM K-M h5C)IKh5KcKhxkTH@8]S!*} S} k TM K-M **h8 *)IKcKKh8***LK K,c K,@kTM@8]S!* } S} k)TH Kr{"H ,( RLKc K R  K,,! RKcKXKcKXKKhRc KXK KcKXKKc KXK KcKXKKc KXK KKcKXK*QkTH@8]S!*}Sqc Kh|   aTLnSkTL@8]S!*} S~kI TLKL LR~Ӹ jykTM@8^S!*~ SyS}k TVKV j9}~ӘjykTV@8]S"*} SyS~kTMKM }~Әj9jlkTM@8^S!*~ S}kTVKV j,1T*)I*0Q**kTA@8]S# * @ ) @0 )8 )$ )? kHTD@?\@T@;@_bT?DqT?HqTRcKXK2KlRc KXK2 KcKXK2Kc KXK2 Kk*****9hh88qATQA"R\@$RH@" @@ Q lS )@)~ E)hikT?,T$@8\S *| S| k T @ @)(R @!Q@ !E@%ie8 R) K( `R|qT RX`kT?'T%@8\S *| SxS|kTKcKqT RkT?0*@L@ @ T@ hg8 R RyS* @'@)xe kT?b"T%@8\S *| SxS| kT) *qiTKcK *KcK|~ hdkT?T%@8\S *| S|kb T 3@R R@kT?T$@8\S *| S| kTq{R! R(R Xh kT?BT)@8\S#!*| SyS)}  kT Kc K kT qT KgR  q'RdS@'xh kT?T(@8\S!*| SxS} kCTKcKqTQ qT|S4q(TQ2U'A'!(R Xh kT?BT'@8\S *| SyS| kTKcKqTUKcK0@kT?bT%@8\S *| S|kT $CkT? T @8\S *| S|kTk( T?`R#_֥KcKҋR`RnKcK`@kT? T%@8\S *| S|kTKcK@kT?"T%@8\S *| S|kTcKKKcK@kT?T$@8\S *| S| kTq{R!JcK K RRE *U*qQkT?bT'@8\S *|SqgK|SQ cKAT 2Rm*}`RR \0l_{c[u@Sk*sSR`^@Hq!T`.@`5 R`.@q `b@4`n@q)T`A9`5aA9`A9bn aA9@`A9 `Z`.`*`@T`^@5`.@ 5RRSA[BcCkDsE{ƨ_`B anс@89@T`R@RR`f@ 4a@)b @! `R khT `&`* R`Zfzn@5q ShT5`1un@\x!!qBzTt5`@@˵!Rтjo8h/8B _LqhT!Tbnq@Sz{T 5@*`qBzaT{5a@@!!Kˀn@R4@R R|4.R{ "@a @@? @{¨_{! S`R"@`j@k T@~~@?` tjxSSA@{è_R_qhTR_#@9"@9b # @9C@"@9b`R_@qB  "@9_q(T!RA#  BKBR"B !K!R{ @5 D)5@a@a @{è_{S[cks{@:@?{@T***5CS**5@R qO@m[B*SAcCkDsE{Ϩ_Rl,mc{CSR3/0Fhe8pS T T37`@`TTCc36&RR+c+@a{ASB@_cR@)Rÿr!Z_kaT@BZ_qT@ZDq)T  ER#@r_kT$@4w2?k _q TqT@q_ր@Z@RrkaT@Zq T@!Z?DqTkCT{A@#Z!Z(T7A@!Z?k` AzcTA@!Z?k7?k懟@q TD54D$@Z!+BTkTA @!Z?k` AzcT@ @Z!+Tk0{__ _@cZ$+775+T@ZkiT@Z@qT"+"T$@Z_kT!|@#@#_{"*R @A! Z`Rk`T_ qhT RkT@Rk@T*R *{_Rk`T R*"R @@9 5K*` t&*R@@1@Z!Z ?<qhTq)T_@T{6`{¨_*_@aTsqT@{6`{¨_*_@aTs qT@{7*7@s  *qT$q TqT@ *{¨_@!QA6@@6!1aTkZ {s7@?qZ{¨_{ Rs* 7@qTqT*{¨_{S4|@[. |@tT[BSA{è_`/4sb7{*@7@cZkCT*5/R{_@_@@#lSBZd+"T@A!cZc@@$ _{S** qT/@$qTq@s*SA{è_qT{S*A6TSA@{è_` @Z5`@!Z{S[*C7@s Z kiTKK@RrkATu7@Z@q T"@cZkbTaK?k"B3R/v[BSA{è_ER!@rkaTK6"@!Zk(Tk T|@`ҹ{S[*7*k@! ځ@ `RSA[B{è_`{R*V*{_@{S*[@7*7@ Z3Zs<qTR-`-[BSA{è_@t{S*[c** 7*~@KK@*!6qsZ[B*SAcC{Ũ_qT3*@O@kT@.`5jx8@4R^.jx8q@T*#l*{S*K-**SA@{è{ 47* @{¨ @{¨_{ 67* @{¨ @{¨_{kz|@S[c*6*` @s!Z_@kT*- 5X[BSAcCkD{ƨ_֓@Z<qTd _{S[*,**[BSA{è{ a@!Z?<qT/!0?@ T@!Z?qT@ @{è_0{S*[m7a @3!Z~@uO@SA[B@{Ũ_@Z<qHT @T`@ZqiT`B`2{S[*,**[BSA{è{B4S*/@?q`TB* /@?qT@ZSA{è_R{S!H *P@7**@SA{èvSA@{è_{S[*[*7`@9~@u5qTR0-K#*T@9qTR-*cK*6T[B*SA@{Ĩ_R{S+*SA{¨{S[c**ks *7qLTS[B*SAcCkDsE{Ǩ_ֹRRRRkq`WzTk@* ~@!#ka8qTQBQkTk!П{ kaT*o@`*\ kT4{B|@E,<8kATk@kTqRןK48**1T1TSs{S*[**`76[B*SA@{Ũ_֓RO?q UzT?1T?1S3O@ks?kTVkT3*s{Rsq @{¨_{S*7Q*SA{¨SA{¨_{S*!Q? 1T`*7O*6@*SA{è_*kT*{S*[+*~@kkT+ 4b~@R,RSA[B@{Ĩ_sQsK R{Sp?@@*SA{Ĩ_?RT+?s hT{S[3cOO@[B*SAcC{Ũ_*ORucT*Ox |@hTkT+@5{S[*@t?@[BSA{Ĩ_?T*?a!?TT5Q{ "B`/@ @{è_/@Pq{S*7*}*7*1kT5*SA@{è_{S[C?lTSA[B{Ũ_?5@ZcT| 7RRC@**C@7qDIzT_ q@TT_qT_q T_q`T_$qaTq@s1$Tq!T*e@9`5G@ 4`4sq#*S?@@{ //@"*6 @*{è_*qTTH1TK! 8 `T_ր@ZqiT@! cZ?kT @B !Z_k(T@ @BZZ! ?k_ R{ 7e@Z@qTb&@RBZ@5 Rk@Ta @{¨_ ` @ @Z!Z $B7"H|@?TTc|@fˆT@ZT{T*R{_`_@_{S*clS*BlS5 @sK!Z! !Z @!Z3 s ZSA@{è_{S**5&@cK!Za !Z&@!Zc cZSA@{è_{S[ V* B|@@!Z *R`~@`6 @ Z Z!Z*v `7u& Z@"@!ZBZ)w"@`"SA[B@{Ĩ_{S[*cks*7y@)a"@9 Zy!ZvKR|"@Za@* Z Z!Z!RaT* 5`"@*B@Z@ Z`" 9R)47a @ct!Zc0!5Ra{*@494(a"@!Z!Q!K!Za"SA*[BcCkDsE{ƨ_@`R Z Z@@*{S[ 5a@#RR!Z6 w-5uj6SA[B@{Ĩ_{S*@5kmT Z4R@aSA"R{è SA@{è_{S*[*c5*'G@81T4SA[BcC{Ũ_ ctct35s Z'@0R1aT#**1{S***54@b~@(@*SA{Ĩ_{S*t5*S?@ RBtB0SA@{Ĩ_{S*[u|@c#V@5**@61ATs*_@s* Qq)Tv @v Z"8*yR 5 R`j63B~R44o((@R*SA[BcC#@{ƨ_ {S*'**SA@{è{S*5*`7d @KRZ4aSA{¨QSA{¨_{S[*c@7@ZnS@qT&@ZOO@**5*@5 RaO@ Zu!Za& OO@3>$qaTO@6SA[BcC{Ũ_ր"@Z  kT|@` bT ZTa5T@** Z)(Rr`V) R`R`@`R{s@qT @Zq{¨_֠{B41T@R{_{B1AT R{_֥<P ҟAT_#hd8cJc@xcx` @J<P_kLT_#hd8c @JSc|@xcx`J{*RZ{B?y'{¨_{ *t/@? qiT@s Z* @{è_{[S@R[B*SA{è_A@6@A6VN@xTr`T"?*4*ˀLP-`R_{SRRs-TRSA@{Ĩ_ҿqT@!@9?qT *@`@9@4sqT Z{SS-j48@`@9@4saTSA@{Ĩ_R_R$KqT#|S$a?qTcxShc8B @<@ B@ "*<_hcxcB {8r{_@!_C@7d@_Td@%7`@@b@B~bD@AT@DdE@@@dCd`@`@@b )T~@aT"e@@7`@E@AT@DdE@@@ee`@`@d )T~@aT$@@b~ ITE@TD_D$c6 T@b_ )TA~"@aT###@@@e@@d@ iT~@TdB@e@%f@Fd@@e#`@d6@@T@#7@DC@C@@ Tc~e@_!T`@e@6@cd@d6@@ 7@@` d@`C@D@@c@CC@F Ta~#@_!T x@@@@#7@DC@C@@ Tc~e@_T`@e@6@d@7d@`C$@D`  )T~@ @ >@@_@@_@T@!@_@ ~? T@? T@? iT ~@?T@!@_@@ @_{S[d@ATsSA[B@#@{Ũ_?qT@@s@{S[ck+ @?`TRQ%R@@kT6vd@ATs@?ր@@@SA[BcCkD+@{Ѩ_R{@B@k-T*RqTvR*+34_"{t?qT@@ts@{RBr A)SR $@)[Jcc cJkc r4@)fR,@A) B #J r Bd" 5(@c >@cJ3@c R #J0rX$RrrPE y2Rc KJc Jrc qR ݙR7r 7ϴr< k JkJk c Rrc(  J ‰ "@K k Jkek  n JJ EŘRr mˆR rPe  J &@  nJ=   J #Rèrc c Jc(  JJ . @  +$@eo 1 1 J1 Rhre  qJP 1 1J- J -,@> 1 1J1 R+r c Jc( 1 1J/ 10@8  Jgx  J %4@ 9 oJ9S  JJ /8@  6R6r>7 Z ZJZ #<@v  * J! !J8 ARþr ! !l J J hRr  _8 9J9 9J9 7JRˤr  J J9 9J9 VR6r  2 J9 9J9 Rźr ! !l J9 9J9 xRHr  _8 9J9 9J9 7МR7rw  J J9 9J9 yRvrV  2 J9 9J9 R!*1J1 DQ .Q E !*1J1  , 0*1J1 ɏRr ! !h ./*J ܜRſrc c cX# n$*J bR/`r  Df !*J .4Rr  , #*J AЏRarA ! !h "&*J BJC FRBr B cWRZr BX" D%* J c cDC d!*) J  $rRprd  ,! )SA )[BcCkD{Ũ_!`R|)r!qRrRArRAr _{S*[c@@pS+T@@"CӘbtS 4*RKkT*SA[BcC{Ĩ"sQ "Iw KqT`~SdSL}"5{S4`!@" CR!K`j"8?qT*R"R"`@`R`@`VR"@SA {èR"R"KR{* *x @{Ȩ_!`|!qAA >RAzr _±4{'3&t:BQGP&ۭeDLS[ckss"@9!#\8,0\83p\8C " \8:\8(\8b@#P\8L` )]8 Z"@\8 Z80]8>p]8C "`\81]89\8b@#\8S`b Z"\8s ZC "\8b@Z`"\8C ZZ ZH "\8A(]8Y`" Z9 Z ! ( ]8(A)P]8a Z(@]8 Z ! (`]8(A)]8a Z(]8 Z ! (]8(Aa( Z(]8)]80]8/0^8 ! (]8.p^8+^8(A)^8a4^8 Z(^86^850_8 ! ( ^8-^8(A)P^8a(@^8 Z Z ! (`^8(Aa(^8 Z ! (^8hA+^8 a Z Zk!4^8kA4_8va Z+_8 Zk!4 _8kA4P_8ua Z+@_8 Zk!4`_8kA4p_8kat Zw4_8k Z7_8pC)"7_8B7_8b Z Z7_8?4_8"7_8B7_8b Z ZC@c@k3@~{c@~StJk@ @Jc@ @@77@k@~b~Swʗ S{@@7s}S 3@s~bsʜ ʔ[~SZZ}Sl{ { {{sy9TS~S7{99 8YS~S9{ss l~S~S{4ʌʗ4 Z}S1 1t~Szs sw Zs0~S}Ssz ʌʌ ~S/~Syo Z}S ~Sy0 }S  }Ssz  ʭʭ}S1z n ~Sʌ ~Sy 0ʍ}S  ʭns J}S }Sz ʌ ʑ?@1 }S}S1z ʭʯC@ }S }Sy@oJoJ_o3s sss}S }Ssz @ JT)@L JJ Jw@gR)_ӌ ʔ  ʔʔ~S11}Sz @JJt_Ӄt ʔkʔʔn.~S~Sz@J@P|S Ps}S3~Ssz@1J5~Sʵʵ - ~S}Sz@Jn}Snkkt }Sk k~Sz?@@PJ  J~S s}Ss s}Sz C@@- J  J @}SJ  u~Sw}Sz  W}S  X T~Sw~Sz 7}S w6~S~Szw }Sw k~S ~Styw@kJ@  9Jx}S  s~Sss~S{8 S89ʼ5y~S99~Sz@J{~SU{{~SUZ?@T:SZsZ ʓt~SʔʔvVS4SzC@ ʌʔB ʭ ʜ~S|ʜʜ~S\S{\ʏ}S<ʜʜ~S{{~S{<ʌ ) ʜ}S \ʜʜyS99~S{w1 J~SwczZ#ScczSZ{{bk[|Sb{{V{v|S;Sy{ 1;~Sq[{|;~S{{||S{ʵ}S<ʜʜzSZZ~S{|^S{s~S|ʜʜYS99|S{ʭʔ ʼ}S ʜʃcZ<S*ʜCSz#cc Jc6Sc SJzJ)ʙ#}Si cy#9 9C}Sc cS9{}Sh[{\|ʜ{|S{{\}S{ \ʋ ~ B|}S | ||Sv|Sz6 ~1~Sx 9SyS9{ʵʞ ʻ~Su{{{ { SJJS{{ s|~ScC}Sc cS{ʔ^ ʜ~S\y|S99\}S{ \~ Z}S| ;S{{||S{#ʌ>}Sl #c c~Scc#Syxx~Swcccxj JScXc jS[ySXBJ JSJb|SB{B  1 ~*~SQjJJJ9JY|S99 j|SCy ^N}S N^|S[;S{{{n0s}SN"BBBBpS"SYxʢ|M|Sm~SC  M cS{xʣ}Sm ccccSZZ~Spx# ʞkʵi|S #)))y)YS99 S }Sh+kkp  kSkk0Sz01~SVv}S |S{\ ʵJʼ~S<ʜ ʜ~SZZ|}S{ s  k~SskkkykYS99 ~SvyKʋ Bt}S ʔʛt{4S[Sz{ʭ }So{|~S{{<S{|ʌcʜ}S \ʜʜvS~S{4 )ʗ~S7~SZZwSz~S9XS~S6{ 19~S1y9<9S99\S{Jʵ \}S ʜʜ[;S{{S{|s}S\ʜʜvS<S{|ʂk \|SʜʔʜZ~SZ4Z|S{ ʭʉ~S4}S <ʜ ʜXS~S{|~SJʃS|cc1y9SccYS9{ ZsZZ i|S))SZ{-ʭʭ(}S  m|Sy~SpC c c }Sc}S1B1#}Scx ~S5)ʵ)Hy j~S)~SS)j)kJsJ -~Ss y*}Sb}SJ K  JB kBc@kB}SB ) B b k@B @) @B ) @B  s@BQs_1QTSA[BcCkDsE{˨__{S*[Rc#@@@ *K@"T@SzTsQ3 H"RMb~SIbrTsfz#@SA[BB@cC{Ũ3SA[BcC#@{Ũ_B4_{S@#]b BZ+"}!@c?BZ/BB!"R`N@99`&@y9`@|S 9`@9`^@99`.@y9`@|S9`@9`n@9"9`6@y&9`@|S*9`@.9`~@929`>@y69`@|S:9`@>9`@9B9`F@yF9`"@|SJ9`"@N9SA{è_{* * @{ɨ_ |DXW{@S@[HQch@T_qTKh#*4N)1R @D."@F-" @QF)+ K<@JQP@QK J ?8qHTd@9& c ƚf_8 !@~ if8@9@y!K$Ԛ5U8B0J#TB 6* rT?kTd@8 ! !K $  $ƚ?8qHTf@94 c Ԛt_8"!@ 7R~ jf8@9@y!K$՚ 6 ?k"Tt@95 "kHTc*!K"4  V ˥$ƚkTKkBTdЄdR$|S!c$R QKECK_ c b  $PSA[BcC{Ĩ_t@9!@c"՚K5 kT hv8Wh68kTB@5?kT  K kT  hv8Wh68kTB@5?kBT Kҕif8Uh&8?kTB@)F@4˟qTD4@9T9`TBe & kiT hv8Wh68kT@9 T9B Q_8T8_8T8@9BD8IV@46Q@8U8|S qTjf8@9#*Th&x!TB U_xqaT^ U*Ux&xTB6@9D8#f07"Q 6 ~Ӗ@yju8@9>dЄ(W&07&"Q 5~ it8(7dЄJdRJ{*S[cksx"xB_@T?kT@R<@yG5kqT`@a(Ryy`@b"Ryy&xbxBhfxi&x&xfx5@aT@yGRkTHxSJyhx kTA!T4q`AzTHy@yihx J yyT?kT4qTQ)Q(R_ k/RB_kB k!qi@@zT RSA[BcCkDsE{ʨ_(xgx4=ӊihxMi(xJ=ӧh*xRЌI Q,> RQ*RRRXsxK5kTkTKӺi`8i`x!*!&K ~. :i;89y75Q!jT4Q  |sivxQ=j6x5 kATJ R,R 5`@H(hRRR R|SXsx&xfx_kbT kTq)I8KF&!V kT&@xKqT! q@z!Tn@~~i08n@9n@.By**JyS4 ?kTi@ **R$%~! +i%859?yQ!jT4%Q ! *!|S]@?"4R  @?? ??4??$?P  DR_ {S* @ `"*`&@@`&c"@!R`*@R`?6KRa "QqTcDR`? SA{¨_ր~q T40? SA{¨` _{ @`c&@# @`*@R`?cDRa@`?R @{¨_ _ |S<@_qT!@9!?iT! iT @_ց_<qiT{R,S[c_ khT5SA@[BcC{Ĩ_*_aTiT"ҡš!@_$hc8cB 0#@9!@8_8c& _870_8$@_86P_8+`_85p_8k*_8 4_8J)_8 3_8)(_8cs >_8c'_8ck1_8c Jc )c c'c?T̚` ̚e @9@_8` _80_8 @_8kP_8 `_8Jp_8s _8)_8 _8_81_8c k_8c J_8c )c _8ccceK<qTDl|C|S!cAT!@ElM $hb8B _{S[cks{ @Ә@`@ @@5`@,qaTR`W@RX@t&@@ @yR@U#@* )7|@sqȕT7@X|xa a @A5R`[4@8{Q ٚ9#??q)T6cҟaTRRk*aBRy#d*` R*``@`H` @6x Tš `@`R qT`TDa2@ ?kT`9Q!Rw ` `!R@7`R4@8{Q ٚ9#??q)Tt qT sT``@`"S`@H6`@#BRy*`@RR`?qIT`@@`@H6`@#R*``RR`??qT`@H`@`@H6`@#BRy*`RR``@P6??qT`@tV@ `@H7RҠR``@P6bV@k|\4a@*;$ @%D)K?kIT  " ? kBK*@ B0q`@H6`@**`*{K`V@K`V`V@5R`V`@ X6;4a@j|8A$@!0@`V@kTaVH 8q`BzT`@@H6`@s*s@@`{KB@<@ 4`T`@4@8{Q ٚ9#RR`aV|V@4kk\4*;'{K;@K`V@K`V{4@8{Q ٚ9#?7q)T&S6 S!Bb)N`9;Q?xqhTxqT`|R`bz@4@8{Q! ٚ9#? q)Ta!@9Q X`x C az x`@kCT!@`@HqIT`B`2`FR`reB dc"aBbRRD*@4`  X`xb z x R`cO)c <qT9K& *! `dz!xa@?kTbr@j2@ "*D D @9@ykiT4@8{Q ٚ9#@qTkT9K&5`p@`R``@lq@Tb~@`B`2|B`F R`reB dc" R;;@*@4`4@8{QB ٚ9# Q9 Q dz`x B  kT*!B dz"xkaT`DqT khT& K  QB CRkT& KQB,G4@8{QB ٚ9#4@8{QB ٚ9#`F@`6RL@RaO)*4`H<@R`q`EzT`r@e2@! !*# `~ӣb@9j@yh`8*_k T4@8{Q ٚ9#c@W[ XU#t&yROyR@W@X@t&@[ @U#@4<qHT  $* !$! ~ӡ"@9h`8K !@yk T4@8{Q ٚ9#9K*&ÚjV9K&š4/706`R `^`R``^@5R``v@e6@! !*# `~ӣb@9j@yh`8*_k)T;4@8{Q ٚ9#[4@8{Q! ٚ9#k(TbV@! ! A 9K&aV<qHT  $* !$! ~ӡ"@9h`8K !@yk T4@8{Q ٚ9#9K*&Ú9K&š06`( j )R``^@`4khTbZ@! 9K! &A aZc@`:@ aZ@K?kiT`ۨ4@8{Q! ٚ9#R`4c@cJ)K?kTc@$ c@b>@Ka"@K_kTe6@KB B k!kҠcKcV#hb8k"8BkTaV@a5ARaKQC!*54`V@Q8@R` @ 5 R`` @`4`@ 5@R`6R4@8{Q ٚ9#?q)Tc@K@@@`@`c@k Tc@`@C4p *`@7p~SSb@ @x!p_q!a@?@T`@`R`cRc;4@8{Q ٚ9#?q)T`"@T`RҶV6@52@ R 6c@U#@6@KA@"@k#T*!@#>6@:L)@ @4KA#@UKg@YK@ @@ c@K@@@`@`` @4u4b@A@`@!4* *`@7a@)*q?,q!`S  aR@ @[4{@qTq >@!@5bK_k@$XBkTA@*"@!@5˛>>@6@ k>:@?kT :*q6B|@<l|OqO{ @9@9 qaT|qT`PdM{_ք6`(@9b,@90  6|@fh`85@ 6|@cBehb85D6? T`@R@RpM@T`H 4_5*`l ,` ){S[cksC@ Ú` T`!!SA*[BcCkDsE{Ϩ_wT`!("c|@b @9`@9Ú_ qaT|qT`PL6b+@9v/@9B0V  6~@dBhb85 6~@dBhb85@6  QkT`"VR8|@9K#тaaw@@#@A@` !?T`!$$w@_k T`h#u_RcQ*4*`$v6!z?RQ@5`!l%R Ts@kZARgKA*q T*`&zs@**B{NU_@*Kk *k@@|@""TA@"BB7B "RXg@7@e M4`|&PL7@4qT{[OSRc**#*Sc*4*`$![B*SAcC#@{ͨ_֠@7/Kc;{Rc*qAz@Tc@`5`&;@ˠc{@4?1@T1T{S[*a@`7**SA[B$R{èSA[B{è_bB1ha8Cha8kT!?$AT R_Rh@@9GDq)!TDQ$}@? qT*T!ш?)TDha8Hh!8!T AD@9<IT@I T@8B( %ˈE%_ E)'T?T!ˀhd8%h$8TJ! @ DD@9$$_ D#T˿T@9! %8@9%8@9$8_8rT*˿TˈC T@9%9aT!@8(T!s| T@TT@8 4||@@9_8!*Rѥ!{t0o{Ũ_cRp@5A!!A>C2R_{@ @f_S:@fR@@f@5{@f@{__ AiT{c [bkšS+ssT~{6|z ?qTAkb8jb8j"8@k"8BAT˔ T`HT`ۚTSA[BcCkD+@{ƨ__@!@4 @!@@!@/ {SqTqTqT! qSA{¨_) < *Ҟ q*@T2R {[*c*k9:SklTR ztcW *57A {@*SA[BcCkD _Y54ztc@* 5ztc@*@43R{S[*RkTSA*[B@{Ĩ_ցzs `57Rz3s{S* @YG@WGR~ `@h4`@ `SA@{è_**eR_{ !@@*bRD|ckTc5!B4`~)=I`@R PR @{¨_R RR PR_@RP_htqT @6 G@Ga @`@?kBTGSA[B{è_{S[5R{S3[c#e R @kTaRPR@x~hxq-T!@1 5@*!! SA[BcC#@{Ũ_s{S[ck*s\@g4 *!Q?1Ta @R`@q~hu41TkTR` @*Q k T` @K kTR`@h{1a TqKa8@ !@ @5g@`@?qTd @* BR?4 R_ PRSA[BcCkDsE{Ǩ_*`@*CR @4R`R`@@XFv@  `@@`R`@ @*KkAT!@ 5g@`@?qaTWd @* BR?`5`@*CR @ 5`@@$Fa@!7 7@ `@@``@ @*1!T`@h{`5g@qT`A)?k`TqR`@~h5t@ t@  `@@@a@ !a<`@ ;d @d`@*R ?`4a@*!! yc*R`@*R @a@!4*! fg! RAQ{R3SFG[*cR@5aR3P[B*SA{Ȩ_ք @*/@*"RҀ?4!RP@R*#RҠ  @F*4RP/@*#{@S[c8ks@!}!<!||c!˦7 T**RҠ{ @ _kbT~@c< T@3JR PSA[BcCkDsE{Ȩ_ !l3@haqT7@ @*;_q@zT{@;@4@@9qT6s@5 @s@ 3@!@ @9@4kTpqT! R@R ҤR RklT9 G`za@C@9C59zaC@b@95!9B8_k`T_pqaT9b@88{S|}c>|[ksc ˥kRPR2z**@OERj384;@a*5`C@RqЁ|@j5D@ D RSA[BcCkDsE{̨_֠k@57@9qIzTqT`@8`4kT7@bT`@9@5~D5TUf54z_4qTT@9(q!T!iT@95sB!@!˂9cR@9q@zTk!Ta@94_k`T?kTqaT99V5*s4R*49b@8b4_kT?9@95RP_pqT@9_q@8"85S *JcK!RRO@@3*4{s*B{s4 skT^{S[5R` @kbTR a@ !ht?qT ?`4SA[B{è_{rd[a|@cc(BT+Sn *@z-TK B!|@B(6c s QkLTQq`K !|@W SA[B@{Ĩ_*{R Rccp R{Ψ_{RS@Tc(T$ÚbBUHd855*@6SA@{èw $Ús"Ú3T`Q%FҠ ss&Ú&T!?@zTs*@6b @6] @*6QUhd8{[|S**cks?qTRs s5Rs a~! kC T! Wk uzS7*ҿkTsKRsOkT~eC3R RkT!_$8 *SA[BcCkDsE{˨_*qT@C{9** 9 "qT@C{9 qT@yc<@C{9x@9c@Ck98k 8#@9(@9hc8c cC4H86'9!`{[|Sc**k+qTRs s5Rs ~ tStS>r|#*c4****i*@K@R@~nA`4`SA[BcCkD+@{ƨ_5R*AT_$hc8c@{ * *{_{*RZs{¨_{@,7@{{_{*S!zEx6Rf@SA{è_{ *ҾE @{¨_!!zE{S*]@SA{è_a!@9"hb8B(7_{ `a?T?9 @{¨_"@9hb8"/6!@"cB`hT_D@DD @DD @!D{S[WR8@@bA7 @TSA[B@{Ĩ_c@*f@sbd @ & _@@-?bLh T_k @{¨_ֿT_kT҇O "KhT`TGk _ '  @T$'_)T''@' '@!`'8ҁ%# @?iT @( @@-?bLT_k_{  AT_kTˇ!3 )Tҁ+!@ @ kT*-A8AL  @T_Tф_ 뢑DhTT@9` sABBҿaT A@?BT`_c{ @9A !!@ 0`B @!45{¨*_RJ!@)ф_aT_և@j`? 렐G"T ATc|@ca` @` _c|@?cTb@e c @ FT{{_@@R{R !˧@|ӄ@g@@T@@@@?TITDфcbA@aX6a @!{¨BB@&R4 @{¨_{S@@ @T _ s ss`KTIR@@SA{è_ Tss2 sss$@ITa{S@9{ @SA{è_{ b ACcB@T @{¨__{"`@T@! A  @T{_ք@B!`iT_{SB@b>@J@F@SA@{è$SA@{è_{S  SA{¨ SA{¨_B_qTA!:_C"8B_qTA!,;_C"A9@" @9q TTLqTqTqT_qTqTqATR@RR RRR R{*RS*bB~@$a$BK`B|@`B `SA{¨_{S*4R[c*kZZ+s8 4 Q@qHT@[`xa ֻ@*a*5`*`8! *` `8s 4` `8@K?kjTR b b8@!5@ 4Rs@*a @5`4R`8s *****a *@5R[B*SAcCkD+@{ƨ_**~``8s *a x*4**@kjT`8a!!hb8(64Rs@kT`8a!!hb8/6R@kT`8a!!hb86@kjT@k*Tab `8a8b8!kTB%hb8kaT}@kTab `8a8b8!kMTB%hb8kaT_@q@k``8|!k s &``8|!"kb *@;{S[*c*k9+9@;@** 5xSA[BcCkD+@{ƨ_ցjy8z@*! qz{S[*c8*k@:@**`4jx8y@*! ҹ4ySA[BcCkD{Ũ_{*R\BQKqT@<{_ր%8{S**a8? qATb D|@b8qTcQsh$8=s8hd8A 9!R7BsQ*BRj38BKq T@< SA@{è_s38{S[RckBB*@@9?q THT?q TT 4?q TY9_=uBzB@@95aR*aB!KM?qT"QB_qhT?q@9"(qT"0*?pq TT?q T?lqT@9uBeB?xqA TR@@95@d<` ?xqT?qTqT*f*bR R`78`BKq T@<`  `68SA[BcCkD{Ũ_R!RuBAR@9?pq`T?tqT**aB!K*rTR|*RuB*r`T|aR|aBz!Rx*`y BRuB9y n*lI@@9qT@<` R]*qT*5@ =Rf`!8 @@9N?{ !@9?xq R4R2@@95` @9qTRR&R$R"` A @{è_{S*[O B43*RV*SA*[B@{Ũ_3*ROG*qSzTRbfhe8#he8d4C4kT|@hg8g6c8g6cckTT*K_RR@#hb8h"8B5_T$hc8h#8cd5_C@9B5#hb8h"8B5_@95%hd8e84_aT9_$hc8hc8c@k@zaT__aTR&hd8hd8`k@zT_!@9_kAT_b4!@9_kAT_4"@9b5 _!{*c@9?kTџiT{__`TC@9c5@_B{ < @{¨_Dh`84kTce@95_@9C5_֟kTBD@95C{h`85{_@9A48_@{@8{__@T&@R qTE˿TD}B@_T_h#c h#8cTc@ T_T_$hch#c D˟hTCCc|B!%hc8h#8c{K#g i'8{_T#T{{_"aT_dh`8$h 8_aTRhd8 hd8`kT_{@4* "}@K kT{_@4!aT_d@8kTR_{S}*s~` SA{¨_{ H*s~` @{¨_{ s~H` @{¨_{SssTSA{¨_{SВtsaTSA@{è_֠_e!RR'hc8*D45q!R*R_A Q?<qT$6qchd8jR_{*S[c 4&w:uh5xZGoZB yfZB yҀN]Z By`"RҀb +'`*RSA[BcC{Ũ_FG>yB 6{SC[U60c*#ҡ@ЖеFҵUҹRjt8k`8Y&Ԛ`7s BTSA[BcC#@{Ǩ_sy8@!4J!DAJ J@_ր _{@R88RR{a8{CC#KCOCDG/(D ,H%| S Rc0A !    cRDRg|| ScC9 c c+aT@_f|| S ÌcC9*c5@R|c|Se+`@9aT@ |!| S$D 9a5@!@A9ӐR)(RFRR? HT"ȚES,S | S0E l    || S8D  || S 8D| |S B8b|B| SCBc88{*S*[*c*k+06(qxzS 6sz3 6QR5*qTK6QwR4BqTQR"R9_k REKj T4BT94bTR9BqTT R*9 5R@R*c!qTqQK!*R76QRR QaBqEQ x2 @!$Ěh`8*`h&8cBBT9!qeTqQK!*RBT9BT9!Q_kMTK@Q|@`6_qR@* BqETqSA$[BcCkD+@{˨_?bThc8&9!?BT#9!{S*[*5=|@*w 6kT|@qBRd Kk+TkaK![BSA@{Ĩ__BTE9BKkKTkaKǟ_q!aQKss d RiT@8j"8B_BTE9B{S[cks7gT@|@T 7Y ;@@9@57@BT9`BT8`KSA[BcCkDsE{˨_qTBT`9sR ?q T?qT"QB_$qTR$2A@9@?q@TT?q T?q T?qaT@ 7,G};@6K22222BRa;Q@9"QB_$q T@9?q T@9Q!?$qHTRFR#_qT,*g}<*BQA@9 Q$q)Tq@@90Q!?qT## a$6ZqTA@9?qaTZ RA@9?qT?qT?q+T?`q`+TbTR`9A@9`.4ITa9s OqT7,*}@*#?qT,}<R!Q?TqT;@AXaxbA! ָ 7*RBT9!Q?qLTq`QaQs RcÀK "T7,*}@*b9s*RBQ_q TaQq!sZ#?qT,}<?BT 9!<7<*}@***{{@*#qT<}<7<}@@9@qTHT4qTTq@T$qT1T&RR*3#qT<*}<*qTqAT2#I)  LRhg8ADJ @-ia8*ij8-$8 95`T 9AT{?9**0@ R*[R2**R'2@ @9{qAT# Rhk8 ? ?@ |@!?1T)A  @T-8kT*** ?9@T`A@9ha8Z_@aTUia8G8@ @9qTTq T0qbR&#x***#qT??@`"R*BRR#!!=<qbaT<7<*}@b*#?qT<}<7<*}@b#?qT<}<Ta942RA@9?qaTZ22AR0qT\7<*}@****{{@ *ZRq Tx_hqTqTqT|7,*}@F<@B<@qB#?qT<}<#?qT,}<7,*}@*B|@#?qT,}<{SҒSA@{Ũ_{SC~EF T`QSA@{Ǩ_{#KCODOCi{ʨ_{Sc"M{@YSA{Ĩ_{ C#KOCDC{Ȩ_{ c")#Ҝ*`4#4{@* @_{CC#KCOCDG{ɨ_B9E$ŚcC8$T_BB9#DChc88# @!HChc89!_{RS`@94@@9qSA{è_R{S=`@94@@9qSA{è_R@9fqaTd@9`@9hd8d6qTcR*҇Rd@9e@9hd8jTd6Q\QqkcTA#__qRB_q@Rc RBR{S*_SA@{Ĩ_*@?T"@94!!? T_(qTR@9q@T{{_{"@a!D@9C@9!hd8a6ccqTqTqTvvAABvC_8qBB#@8q!A{_z{Sa џBT#_8bBChc86_8Chc87S`SA{¨џTSaSA{¨_*{S[R@r@ykT&@y@?TqT2@A6@SA[B{è_vAa@` BTBRa@zs!!zw{SҀz@ykT&@y@?TqT2@A6@SA@{è_֓@s`@@6` @b@a@? qTRa @b@ z!!!z!La@@9?qAT{S[R@sZ@ykT[B@SA{è_vA)4a@*!` B)kTBKRB wa@fzs!!dz@9?qT{[Sb@ykTSA@[B{è_֔"@sN` @6`@@4b@4a@**? qTRLa@b@ d! !!d!Ka@!Y{@ைRɨr_kT =3R{_ @yqT 8> R{[*!S*R 5RR SA[B@{Ũ_6t6q @aT3R*    z _{#c*8FS[*AR!  R 8* Ra 9R`99a9Ra99!`9`"[c`:`Jc`b[[BrSAcC F#@{ƨ:{SBAAM Jj TA5 >1M` @AbM!ASA{èa M 4{ #qAF?T @ R{¨_֓aM!a ?q-T ?1 aR@R_{S*[c_lqLT[B*SARcC {ŨDa!@9`@9 *qTa @9`@9 * qaT`@9qT`@9qTrA 4wb#`AK@?kTa@9`@9 *qTqTSA[BcC{Ũ_֡R *@R9v"`9`Js:B>ҁ!9r4~@/cC*SA[B{ŨM 4a:#!K@MkTw"F*R*R?֓jGaMjGm  Mq_{S` R[99R9 R9 R9@R9d R 99"9&9R*9 5.4`ZARa9Ra9|sa8|c8a8`85е$@ R.%*q T R`9`R`9 R` 999$  4 Ra"sb`8 R`88R H$`5еR&8v9Rj68 R" 9`R 9R 9R 9 R 9R 9 9@mTSA[B@{Ĩ_@ZR.9R29|F69:9|>9B9R R`9@Rs`8 |`8a8 Ms_8{S[Ta@9?qTSA[B@{Ĩ_t@9?Dq TT? qTT4?q`T + ?0qT?<qT?qTa  ?q TT?qT?q T?pq!T ?q ThT?q TT QqT s4? q T?Dqa a ~q-T*R! !p9a j58~@qT*R! !x8~@9y95~qMT*R! !~@a 7a @979a 7Ҹu9@7е5*a 48{S?@`LR`jr?kaT`aR 79Nw96`Iw96@a`SA{ĨASA@{Ĩ_{?qS`R[`@zck!TqT`@9qT`@9q!T` @9qTwc[@!P:N_kTSA[BcCkD{ƨ_$x`kT`rҳ5vBcf[@ 4M?q T?q`T?qATR ! qSkGBR4RA!s * R`r9`v9R`z9~9DG}c`BZb9B@9F@9@ B@9Z,C "HQcZc<_LqTa @9`@9 Z<@_ k TNqT`@9 ?qAT q TR` 4aB#K@!A4?k`T1 Ta2#a@9`@9K@ Z4@ T`&@9qT`R@9wRqT@9qA T[BabSA @{Ũ*`xGg`b@9ebff@9*dV@9b^@9 `R@9[BZ `Z@9SAZ@9 @9BZ@<{Ũ<B<DqT`b@9df@9 Z<q)TRѿ"$T`a^@9cV@9*G Q`Z@9[B `R@9@!Z `rSAcZ{Ũc<!<SA[B@{Ũ_`RGykTZAR,?qR_R{R*bSBGy_kSZs>Rs]ҁ!XZa.@<@??qB9B9@RF9{S*9ҁ`!4a2@9Z`6@9 *Zq@<@BH`<@ L"3AT5zBqT@RzSA[BcCkD{Ũy"5F<@GyykTRz!l=54a}!A!š? T<8Rz!D5` a ysqTuc@yNAcZB<_ #kT_#kTsaDy Ta2Ey`y!Dy a yh?q<@NwATa"Dya"yARzaJ6a?Da?@a?TTQNAJ`C``!p AbaseB@AcGy`GyBˣNA4A|cc8A@ @4*7c`TDT>";"`aR!!Q?q)TJA`T,"NA h%"SA[BcCkD{Ũ_sNAaDy?T,a`Dy!Dy `yb@yaLBZB<`@yZ<QqTD`lMITl `GykbT {a B a!Ck T!D{&!`!p A~`xBq`T{{_ q CzAT{!D{ _{cw[*ASsk`4`yBR^`y4BRVa ytpBRLA?T}ҀuhBR;C6bGy_q)TR|`GyR`y`xs AsRy05"Aw !@E|SD\PC > 3> Ȥ ؤ   2 G Y j |  L L M M 7 M 1M AM QM ԩ ݩ ۫ ݊ % P [ U 0 :5  lH BZ  % ]* L ". (3 $ 2It ')5 : ` |T'H8%@H`PXP' L(0  [       k     * + 9 @ L _ i r }  3 8 ۫   ! N " % > . > 3 ~ 9  t >>H?<  NPa N N N NPp N@@B'@B@0u@ @ P@D)5:@ 0uP  'a'ȯ N'P''a:' N@B@BP0u::a Neȯ:8a  ':'0u N'P''::a:@B@Ba::hB Ne:8hB  ''a NP'':a'@B@B0u N':: Ne0u'8:  ''a N0u'': N'@B@Ba N':. Nea'8.  ''a N0u''::X@B@B N>X:' Ne NX8'W W CH W W W W W W W %  S  > p> W CH W W W W W W W W W W W .A $ 1 i t ^ - 9 5 { > G R ] b g n s z F  9 K m   P R SO0R0T0W0r r r rW#W#U i bjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-!2':g***V**q*****u $*5@LXco8(H@ @ '@B@x}uu@x}e  @ @    @Vr<a0fLP??MFi0y`ppp@@@@@@@@@(          @ @       @   8=ppppp3RepppY]apkpm @ @`00 @ BEHTKNQ(s*K>;/~{^ ,1IT:2)mn!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@ !1Aa  0@`@@A@!  @a`10  @ #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      LL\\ \0\H`` &(*,M.&( *, .I02" 46{L@DH|LS`|h>gW_X[}a0d[}`kk |X|\0|X|\00'11`L|h}ie`>0`W XX_'H|L|L0| `H|L|L|h|h\0|h|\g0|\ | \r0 |\|h۸|hL|h#|#\H|L|LS0M2H|L|L|`|h|h M~b0MM|`|h(g|`lH|L|L~bW_X[}a0d[}`cak_00L2H|L|L|`00MeV Y_|\0|\L|d}h|`}U_|XX[}a1|Xd[}`'H|L|L|`L_$H|L|L|T(g00N@DS|h>gW_[X}a;1gX}`~bk|h>g Nۖ|P|P|h~g|@O7HDA@N@|T|L|LKBh1'1`OH(F`N(~(F@|T|X|\A|L|LA*1N|DHDH|L|L$H|LAAH|L|LAՒո1|D1'1N@|TDA'1NH|L| LEAҮҞ1N2H|L|L(D@|@T|X|\A1 O|h>gW_[Xa1gX`0&(T*,Z.0<2468&(*,.02468&(R* ,.02468l6 86868,8,8E,8E,888888888`88}`88,88,8}`888888b8]a888888888B,88888]C888888B,88=a88888888B,8888@88888888686868686856 86 86868,8,8 ,8 ,8@88-)8 88,*8886*8V8#"6868"685 68+ 68,6 86 86868,8,8,8,8@88D)6868686868C6 8&( *,.0\22468&(4;*|,.02(:468&(*B,.602t<468>&(*2, . 02468&( **(,.024 46^38:A<>@BDFHu-boot*EHCI Host ControllerU-Boot*XHCI Host Controller  * *__of_translate_addressfdt_fixup_memory_banksdo_bootvx_fdtdo_bootelfraw_accessdo_env_exportdo_get_tftpubi_remove_volget_button_cmdusb_setup_descriptorlists_bind_fdti2c_chip_of_to_platmmc_probe__put_mtd_deviceallocate_partitionwrite_bbtnand_transfer_oob__macronix_30lfxg18ac_rw_otpboard_nand_initspi_flash_std_readself_check_aibytes_str_to_intcheck_avubi_open_volumeubi_eba_initubi_self_check_all_ffwl_get_wlemvmdio_xsmi_readmvpp2_bm_bufs_addcomphy_sata_power_upscsi_scan_ehci_create_int_queuexhci_get_endpoint_intervalxhci_setup_addressable_virt_devxhci_ctrl_txenv_exportget_fs_inforead_blockubifs_read_nodetake_gc_lnumvalidate_sbvalidate_masterubifs_scanubifs_tnc_read_nodedo_kill_orphansreplay_budyaffs_init_raw_objsyaffs_block_bitscmd_yaffs_devconfigyaffs_get_block_infoyaffs_del_dir_contentsyaffs_wr_chunk_tags_nandyaffs_get_block_infoyaffs_verify_diryaffs_get_block_infoyaffs_get_block_infonandmtd2_write_chunk_tagsfs_devreadgzwriteeth_initializedm_mdio_post_probeget_relfiledo_env_importprocess_button_cmdsdevice_unbindi2c_set_chip_offset_lenadd_mtd_deviceverify_bbt_descrnand_scan_tailpxa_ecc_initspi_flash_erase_dmlate_analysisubi_mtd_param_parsecheck_attaching_infoubi_resize_volumeubi_io_read_vid_hdrubi_wl_get_pebubi_dump_aebmvmdio_smi_readmvpp2_bm_pool_usephy_device_createcomphy_probecomphy_cp110_initpinctrl_config_one_spi_get_bus_and_csdo_scsi_scan_onexhci_address_devicexhci_get_input_control_ctxrecord_transfer_resultenv_importalloc_double_indirect_blockext4fs_put_metadataget_fatentdo_readpageubifs_read_node_wbufinit_constants_sbubifs_read_superblockscan_for_masterubifs_scanned_corruptionread_znodeget_cs_sqnumvalidate_refyaffs_verify_chunk_bit_idyaffs_find_by_nameyaffs_get_block_infoyaffs_verify_obj_in_direth_initmmc_get_op_condnand_select_chippxa3xx_nand_probe_dtspi_nor_read_idvalidate_vid_hdrself_check_in_wl_treedm_spi_claim_busubifs_finddirmmc_hwpart_confignand_fill_oobpxa3xx_nand_probeself_check_vid_hdrubi_wl_put_pebmvpp2_phy_connectubifs_lsyaffs_alloc_raw_tnodemmc_read_blocksnand_flash_detect_jedecself_check_peb_vid_hdrdo_workmvpp2_txq_initcrypto_comp_decompressmmc_breadnand_flash_detect_onfivalidate_ec_hdrubi_do_workermvpp2_rxq_initubifs_decompressdump_chmmc_poll_for_busynand_detectself_check_ec_hdrmvpp2_openubifs_dump_nodenand_reset_data_interfaceself_check_peb_ec_hdrmvpp2_rx_errorubi_io_writespi_nor_fsr_readyself_check_not_badmvpp2_txq_cleanubi_io_readgop_port_enablespi_nor_wait_till_ready_with_timeoutmvpp2_egress_disablealloc_simpledevice_chld_unbindmmc_select_mode_and_widthcreate_bbtpxa3xx_nand_init_timingsspi_flash_write_dmcheck_corruptionubi_initinit_volumesubi_io_read_ec_hdrubi_wl_initubi_dump_avmvpp2_port_probecomphy_utmi_power_uppinctrl_select_state_fullspi_get_bus_and_cs_xhci_alloc_devicexhci_scratchpad_allocabort_tdenv_set_defaultext4fs_log_journalubifs_readinit_constants_earlyubifs_read_masterread_pnodeubifs_start_scanubifs_recover_log_lebreplay_log_lebyaffs_init_raw_tnodes_and_objsyaffs_rename_objyaffs_get_block_infoyaffs_get_block_infommc_get_capabilitiesnand_scan_bbtnand_cmdfunc_extendedspi_flash_read_dmscan_pebubi_detach_mtd_devprocess_lvolself_check_volumeubi_io_mark_badubi_dump_vtbl_recordmvpp2_bm_pool_createcomphy_utmi_phy_initxhci_update_hub_devicexhci_alloc_container_ctxreset_epdo_loadubifs_sizeubifs_check_nodemount_ubifsubifs_read_nnodeubifs_scan_a_nodeubifs_dump_pnodeubifs_recover_lebubifs_replay_journalyaffs_deinit_raw_objsyaffs_do_file_wrpxa3xx_nand_scanearly_erase_pebuif_initubi_read_volume_tableubi_create_volumeubi_io_is_badubi_wl_scrub_pebubi_dump_vid_hdrmvpp2_bm_pools_initcomphy_dedicated_phys_initxhci_configure_endpointsxhci_mallocxhci_bulk_txfs_lnubifs_is_mappedubifs_mountcheck_lpt_crctry_read_nodeubifs_recover_master_nodeubifs_validate_entryyaffs_free_objsd_select_mode_and_widthpxa3xx_nand_waitfuncspi_nor_parse_bfptubi_early_get_pebautoresizevtbl_checkdo_sync_erasewear_leveling_workerubi_dump_ec_hdrmvpp2_aggr_txq_initcomphy_cp110_sfi_rx_trainingspi_find_chip_selectxhci_segment_allocxhci_wait_for_eventfs_writefree_orphanscheck_lpt_typeubifs_update_one_lpinsert_old_idxubifs_dump_znodeyaffs_deinit_raw_tnodes_and_objsyaffs_change_obj_namefdt_find_or_add_subnodedrain_fifospi_nor_parse_sfdpvalidate_vid_hdrio_initself_vtbl_checktorture_pebself_check_ecubi_dump_flashmvpp2_initxhci_ring_allocxhci_queue_commandfs_read_lmb_checkubifs_leb_unmapvalidate_inodeubifs_change_one_lpyaffs_free_raw_objyaffs_wr_data_objgpio_hog_of_to_platadd_to_listubi_attach_mtd_devnor_erase_preparesync_erasegop_port_initxhci_ring_freeubifs_igetubifs_calc_lpt_geomyaffs_add_obj_to_dirmmc_start_initnand_dt_initprepare_set_commandubi_add_to_avubi_io_sync_eraseerase_workerphy_info_parsespi_claim_busxhci_inval_cachefilldiryaffs_alloc_raw_objyaffs_put_chunk_in_filenand_waitnand_cmdfuncubi_compare_lebsself_check_writeself_check_in_pqmvpp2_probespi_set_speed_modexhci_flush_cacheubifs_printdirubifs_leb_readyaffs_free_raw_tnodeyaffs_get_block_info(((((AAAAAABBBBBB[addr [initrd[:size]] [fdt]] - boot Linux flat or compressed 'Image' stored at 'addr' The argument 'initrd' is optional and specifies the address of an initrd in memory. The optional parameter ':size' allows specifying the size of a RAW initrd. Currently only booting from gz, bz2, lzma and lz4 compression types are supported. In order to boot from any of these compressed images, user have to set kernel_comp_addr_r and kernel_comp_size environment variables beforehand. Since booting a Linux kernel requires a flat device-tree, a third argument providing the address of the device-tree blob is required. To boot a kernel with a device-tree blob but without an initrd image, use a '-' for the initrd argument. [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead For the new multi component uImage format (FIT) addresses must be extended to include component or configuration unit name: addr: - direct component image specification addr# - configuration specification Use iminfo command to get the list of existing component images and configurations. Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OSUY e0 0x%lx. Please increase the size in get_page_table_size()PTE %p (%llx) is not a block. Some driver code wants to modify dcache settings for an range not covered in mem_map.PTE %p (%llx) for addr=%llx should be a tablePage table pointer not setup.Emergency page table not setup.FDT creation failed!FDT and ATAGS support not compiled in (fake run for tracing) Starting kernel ...%s /memory## WARNING: fixup memory failed! Bad Linux ARM64 Image magic! Image lacks image_size field, assuming 16MiB arch_numberTLB addrirq_spsp start Early malloc usage: %lx / %x (%08x) elr: %016lx lr : %016lx (reloc) elr: %016lx lr : %016lx x%-2d: %016lx x%-2d: %016lx Code: Bad mode in "Synchronous Abort" handler, esr 0x%08lx Resetting CPU ... Bad mode in "Irq" handler, esr 0x%08lx Bad mode in "Fiq" handler, esr 0x%08lx Bad mode in "Error" handler, esr 0x%08lx "Synchronous Abort" handler, esr 0x%08lx, far 0x%lxresetting ... mikrotik,rb5009marvell,armada7040-dbCannot find PCA9555: %d Failed to read IO expander value via I2C Failed to set IO expander via I2C ERROR: %s image overlaps OS image (OS=%lx..%lx) Ramdisk image is corrupt or invalid RDCould not find a valid device tree Loadable(s) is corrupt or invalid Wrong Image Type for %s command ## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x ERROR %dE: can't get kernel image! Can't get image type! Can't get image compression! Can't get image OS! Can't get image ARCH! Can't get image load address! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Can't get entry point property! Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover Failed to prep arm64 kernel (err=%d) Moving Image from 0x%lx to 0x%lx, end=%lx initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) Resetting the board... bootmRTEMS! FIT images not supported for '%s' - must reset board to recover! ## Transferring control to RTEMS (at address %08lx) ... filesize Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated NetBSD## Transferring control to NetBSD stage-2 loader (at address %08lx) ... QNXPlan 9confaddr## Transferring control to Plan 9 (at address %08lx) ... %s: %s Base path too long (%s%s) Retrieving file: %s get%s: returning err=%d boot/pxe_utils.cExpected string literal: %.*s Expected string: %.*s outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02x.dtb./localcmdNo kernel given, skipping %s kernel_addr_rSkipping %s for failure retrieving kernel malloc fail (FIT address) ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT Skipping fdtdir %s for failure retrieving dts fdt_addrfdtcontroladdrExpected include path: %.*s Couldn't retrieve %s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s pxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%spxe_label_overrideMissing override pxe label: %s Missing default: %s Error parsing config file menutitledefaultpromptlabelkernellinuxlocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedUnknown OSUnknown ArchitectureUnknown ImageXIPLoading %s %s Uncompressing %sUnimplemented compression type %d Unknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x architecturecompressionoperating systemimage typebzip2gziplzmalzozstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot Imagefdt_legacylegacy Image with Flat Device Tree spkgimageRenesas SPKG ImagesfsplStarFive SPL ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdoseEnea OSEplan9rtemsTrusted Execution EnvironmentU-BootvxworksVxWorksqnxopensbiRISC-V OpenSBIefiEFI FirmwareELF ImageInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vbootm_lowbootm_sizebootm_mapsize## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... loadablesThe given image format is not supported (corrupt?) %d Bytes = Bad magic number Bad header crc Bad data crc Bad image type Empty Script Could not find config %s /imagesCould not find script in %s No FIT subimage unit name Can't find '%s' FIT subimage Not a image image Bad Data Hash Could not find script subimage data Wrong image format for "source" command loadaddr#size-cells%s: Bad cell count for %s %s: %s: %s fdt_root: %s serial#serial-numberWARNING: could not set serial-number %s. fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not set bootargs %s. 2024.10-OpenWrt-r28959-29397011ccu-boot,versionWARNING: could not set u-boot,version %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. /aliasesethernetethaddreth%daddrlocal-mac-addressrangesThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dERROR: - must RESET the board to recover. ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) no-mapimage is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconf - must RESET the board to recover. Unsupported %s address size descriptiondatadata-offsetdata-positiondata-size%s %s algo: invalid/unsupported key-name-hint (required)padding%s %s padding: %s %s %s value: unavailable HashsignatureSign%s Description: %s Type: %s %s Compression: %s %s Data Start: %s Data Size: %s Architecture: %s %s OS: %s %s Load Address: %s Load Address: 0x%08lx %s Entry Point: %sFIT description: Can't find images parent node '%s' (%s) %s Image %u (%s) /configurations%s Default Configuration: '%s' %s Configuration %u (%s) %s Kernel: %s Init Ramdisk: %s %s Firmware: %s %s FDT: %s %s FPGA: %s %s Loadables: Corrupted or truncated treeCan't get hash value propertyUnsupported hash algorithmBad hash value lenBad hash valueCan't get hash algo propertyuboot-ignore-skipped + error! %s for '%s' hash node in '%s' image node Can't get image data/sizeerror! %s in '%s' image node ## Checking hash(es) for FIT Image at %08lx ... Hash(es) for Image %u (%s): unknown## Loading %s from FIT Image at %08lx ... Bad FIT %s image format! (err=%d) Could not find configuration node Using '%s' configuration Could not find subimage node type '%s' Trying '%s' %s subimage Verifying Hash Integrity ... No %s %s %s Image Could not find %s subimage data! Can't get %s subimage load address! Error: %s overwritten Loading %s from 0x%08lx to 0x%08lx Error decompressing %s WARNING: 'compression' nodes for ramdisks are deprecated, please fix your .its file! Subimage data is not a FDTconfig with overlays but CONFIG_OF_LIBFDT_OVERLAY not set ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX Perform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsbootcmd ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC FIT image found Bad FIT image format! Bad hash in FIT image! Unknown image format! Trying to execute a command out of order Automatic boot of image at addr 0x%08lX ... iminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]print monitor, compiler and linker versionERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s ## Executing script at %08lx sourcerun script from memory%-12s= 0x%0*lx %-12s= 0x%.*llx boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit eth%iaddrcurrent eth = %s %-12s= (not set) %-12s= %pM IP addr = %s fdt_blobnew_fdtfdt_sizedevicetree = %s serial addr width shift clockbdinfoprint Board Info structurechanged to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u blkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigurebootikernel_comp_addr_rkernel_comp_sizekernel_comp_addr_r or kernel_comp_size is not provided! kernel_comp_addr_r is outside of DRAM range! boot Linux kernel 'Image' format from memory%-15s Button '%s' not found (err=%d) buttonmanage buttons Get button state button list Show a list of buttonsflushOFFInstruction Cache is %s Data (writethrough) Cache is %s dcacheenable or disable data cache[on, off, flush] - enable, disable, or flush data (writethrough) cacheicacheenable or disable instruction cache[on, off, flush] - enable, disable, or flush instruction cacheList of available devices |-- %s (%s%s) | |-- %s coninfoprint console devices and information-e-sUnknown parameter: %s Driver model low level accesscompatdevresdriversstaticuclass-necho args to console[-n] [args..] - echo args to console; -n suppresses newlineInvalid ELF image cmd/elf.ctftpAutomatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified bootdev## VxWorks boot device not specified bootfilehost:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... bootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s) exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext4writecreate a file in the root directory [sizebytes] [file offset] - create a file in / directoryusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizefdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%sWorking FDT set to %lx fdtaddrControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s moNew length 0x%X < existing length 0x%X, aborting. No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structfstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start. - Find file 'filename' from 'dev' on 'interface' determine its size, and store in the 'filesize' variable.Bank %s: -aGPIO device %s probe error %i GPIO: '%s' not found cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %u) value is unknown (ret=%d) Warning: no access to GPIO output value Warning: value of pin is still %d query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsNo I2C bus selected Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Error: Not supported by the driver Valid chip addresses: %02XCurrent bus is %d Setting bus to %d Failure changing bus number (%d) Bus %d: %s (active %d) %02x: %s, offset len %x, flags %x Invalid bus %d: err=%d readingError %s the chip: %d %04x: %02xwritingCRC32 for %08lx ... %08lx ==> %08lx: %02lx %04lx ? I2C sub-systemcrc32mmmwnmprobeolenUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .q, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=LED '%s' not found (err=%d) LED '%s': LED '%s' operation failed (err=%d) manage LEDs on|off|toggle Change LED state led Get LED state led list show a list of LEDstoggleblink %s ## Total Size = 0x%08x = %d Bytes Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'Base Address: 0x%08lx The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same %08x %0lx %04xZero length ??? halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data infinite loop on address range[.b, .w, .l, .q] address number_of_objectsprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmemory write (fill)[.b, .w, .l, .q] address value [count]memory modify (constant address)[.b, .w, .l, .q] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]%2u %2u-%2u = %5u %sFDXHDX100halfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %sMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x MDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)No MMC device available OK, force rescanno mmc device at slot %x set dsr %s YesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s card capabilitieshost capabilitiesRd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: HC WP Group Size: User Capacity: WRREL Boot Capacity: RPMB Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state SD doesn't support partitioning userenhwrrelgpPartition configuration: User Enhanced Start: User Enhanced Size: No enhanced user data area User partition write reliability: %s GP%i Capacity: No GP%i partition GP%i write reliability: %s Partitioning successful, power-cycle to make effective Failed! #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device get mmc type error! MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s It is not an eMMC device boot areas protected MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc hwpartition - does hardware partitioning arguments (sizes in 512-byte blocks): USER - <{on|off}> : sets user data area attributes GP - <{gp1|gp2|gp3|gp4}> <{on|off}> : general purpose partition MODE - <{check|set|complete}> : mode, complete set partitioning completed WARNING: Partitioning is a write-once setting once it is set to complete. Power cycling is required to initialize partitions after set to complete. mmc setdsr - set DSR register value wperasehwpartitionsetdsr0x%08x: %02x - 0x%012llx-0x%012llx : "%s" MTD device %s not found, ret %ld .dontskipbadOffset not aligned with a block (0x%x) Size not a multiple of a block (0x%x) Erasing 0x%08llx ... 0x%08llx (%d eraseblock(s)) Failed to get bad block at 0x%08llx Skipping bad block at 0x%08llx ReadingWriting [raw] [oob] [dontskipff]ReadWrite.raw.oob.dontskipffOffset not aligned with a page (0x%x) Size not on a page boundary (0x%x), rounding to 0x%llx Could not map/allocate the user buffer %s %lld byte(s) (%d page(s)) at offset 0x%08llx%s%s%s %s %lld byte(s) at offset 0x%08llx Failure while %s at offset 0x%llx Dump %d data bytes from 0x%08llx: Dump %d OOB bytes from page at 0x%08llx: Dump %lld data bytes from 0x%llx: %s on %s failed with error %d unavailableList of MTD devices: * %s - device: %s - parent: %s - driver: %s - path: %s - type: ROM NOR flash Data flash UBI volume MLC NAND flash Unknown - block size: 0x%x bytes - min I/O: 0x%x bytes - OOB size: %u bytes - OOB available: %u bytes - ECC strength: %u bits - ECC step size: %u bytes - bitflip threshold: %u bits No MTD device found Only NAND-based devices can have bad blocks MTD device %s bad blocks list: 0x%08llx MTD utilsmtdparts support missing. Offset exceeds device limit '%s' is not a number Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx Device %d: %sbootdevice ** No boot device ** ** Device %d not available .jffs2.e.iUnknown nand load suffix '%s' Loading from %s, offset 0x%lx ** Read error Fit image detected... ** Unknown image type ** Bad FIT image format %dx %s, sector size %u KiB Page size %8d b OOB size %8d b Erase size %8d b ecc strength %8d bits ecc step size %8d b subpagesize %8d b options 0x%08x bbt options 0x%08x nand_writesizenand_oobsizenand_erasesize (bbt reserved)quiet no devices available Device %d bad blocks: 0x%08llx%s scrubclean-y.spread.part.chip NAND %s: Warning: scrub option will erase all factory set bad blocks! There is no reliable way to recover them. Use this command only for testing purposes if you are sure of what you are doing! Really scrub this NAND flash? scrub aborted No memory for page buffer Error (%d) reading page %08lx Page %08lx dump: OOB: %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x .raw.noverifysize adjusted to 0x%llx (%d bad blocks) %s: error at offset %llx, ret %d Unknown nand command suffix '%s'. %zu bytes %s: %s markbadblock 0x%08lx NOT marked as bad! ERROR %d block 0x%08lx successfully marked as bad biterrToo many pages in one erase block bit position 0 to 7 is allowed Error (%d) nand_erase_nand page %08llx Flip data at 0x%lx with xor 0x%02x (bit=%d) to value=0x%02x Error (%d) write page %08lx nbootboot from NAND device[partition] | [[[loadAddr] dev] offset]NAND sub-systemInvalid address/size rootpathdnsipdomainactiveeth%d : %s %pM %s ping failed; host %s is not alive host %s is alive Could not find device %s Driver does not implement stats dump! %s: %llu dhcpautoloaden1cmd/net.cen2NET sub-systemlist - list available devices stats - dump statistics for specified device statspingsend ICMP ECHO_REQUEST to network hostpingAddressboot image via network using DHCP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpputTFTP put command, for uploading files to a serverAddress Size [[hostIPaddr:]filename]tftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocol%s=%s ## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d cmd/nvedit.c## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed edit: setenv## Resetting to default environment runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintsaveenvsave environment variables to persistent storage-bootableUnknown option %s %s%x0x%xSupported partition tables%c %s: ** Bad device specification %s %s ** Unknown partition type '%s' disk partition related commandsuuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition table part list [flags] - set environment variable to the list of partitions flags can be -bootable (list only bootable partitions) part start - set environment variable to the start of the partition (in blocks) part can be either partition number or partition name part size - set environment variable to the size of the partition (in blocks) part can be either partition number or partition name part number - set environment variable to the partition number using the partition name part must be specified as partition name part set type - set partition type for a device part types - list supported partition table typesParentDriver| %-*.*s| %-*.*s| %s Ops get_pins_count not supported by %s Ops get_pin_name error (%d) by %s Ops get_pin_muxing error (%d) by %s in %s %-*s: %-*s pin-controller device not selected %s not found Can't get the pin-controller: %s! Pin-controller device is not set! dev: %s pinmuxshow pin-controller muxinglist - list UCLASS_PINCTRL devices pinmux dev [pincontroller-name] - select pin-controller device pinmux status [-a | pin-name] - print pin-controller muxing [for all | for pin-name] -ipv6cmd/pxe.cpxefile_addr_rInvalid pxefile address: %s Out of memory pxeuuidConfig file '%s' found Config file not found pxeget and boot from pxe filesget [-ipv6] - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] [-ipv6] - boot from the pxe file at pxefile_addr_r default-arm-mvebu-mvebu_armada-8kdefault-arm-mvebudefault-armmallocWrittenFailed to initialize SPI flash at %u:%u (error %d) No SPI flash selected. Please run `sf probe' updateERROR: attempting %s past flash size (%#x) ERROR: flash area is locked Updating, %zu%% %lu B/sSPI flash failed in %s step %zu bytes written, %zu bytes skipped in %ld.%lds, speed %ld B/s SF: %zu bytes @ %#x %s: SF: %zu bytes @ %#x Erased: protectstart sector is not a valid number len is not a valid number unlocksfSPI flash sub-system Reset SCSI scsiscsibootboot from SCSI deviceloadAddr dev:partSCSI sub-systemreset - reset SCSI controller scsi info - show available SCSI devices scsi scan - (re-)scan SCSI bus scsi device [dev] - show or set current device scsi part [dev] - print partition table of one or all SCSI devices scsi read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' scsi write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr' Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** Hex conversion error on %c Invalid bitlen %d generic_%d:%dspi_generic_drvError %d during SPI transaction sspiSPI utility command[:][.][@] - Send and receive bits - Identifies the SPI bus - Identifies the chip select - Identifies the SPI mode to use - Identifies the SPI bus frequency in Hz - Number of bits to send (base 10) - Hexadecimal string that gets sent-pSpecify a filename or set the ${bootfile} environment variable ext2fatInvalid filesystem: %s Error reading config file sysbootcommand to get and boot from syslinux files[-p] [addr] [filename] - load and parse syslinux menu file 'filename' from ext2, fat or any filesystem on 'dev' on 'interface' to address 'addr' time: %lu minutes, %lu.%03lu seconds run commands and summarize execution timecommand [args...] truedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-zVolume %s not found! UBI volume update was not initiated Couldnt or partially wrote data size > volume size! Aborting! Cannot start volume update Failed to read leb %lld (%d) cmd/ubi.cFailed to write leb %lld (%d) updatingdamaged volume, update marker is setNo size specified -> Using max size (%lld) Read %zu bytes from volume %s to %p read from corrupted volume %dNO MEM read err %x UBI partition '%s' already selected Partition %s not found! %s,%sUBI init error %d Please check, if the correct MTD partition is used (size big enough?) dynamicSettCleardetachError, no UBI device selected! Device %d: %s, MTD partition %s UBI: MTD device name: "%s" UBI: MTD device size: %llu MiB UBI: physical eraseblock size: %d bytes (%d KiB) UBI: logical eraseblock size: %d bytes UBI: number of good PEBs: %d UBI: number of bad PEBs: %d UBI: smallest flash I/O unit: %d UBI: VID header offset: %d (aligned %d) UBI: data offset: %d UBI: max. allowed volumes: %d UBI: wear-leveling threshold: %d UBI: number of internal volumes: %d UBI: number of user volumes: %d UBI: available PEBs: %d UBI: total number of reserved PEBs: %d UBI: number of PEBs reserved for bad PEB handling: %d UBI: max/mean erase counter: %d/%d -numericError, no volume name passed create--skipcheckIncorrect type No space left in UBI device! Name too long! verify_mkvol_req failed %d Creating %s volume %s of size %lld removeRemove UBI volume %s (id %d) It's read-only mode Error changing Vol tabel record err=%x UBI: reserve more %d PEBs ubi%d error: %s: cannot remove volume %s, error %d %sing skip_check on volume %s Please see usage %lld bytes written to volume %s ubiubi commandsdetach - detach ubi from a mtd partition ubi part [part] [offset] - Show or set current partition (with optional VID header offset) ubi info [l[ayout]] - Display volume and ubi layout information ubi list [flags] - print the list of volumes ubi list [flags] - set environment variable to the list of volumes (flags can be -numeric) ubi check volumename - check if volumename exists ubi create[vol] volume [size] [type] [id] [--skipcheck] - create volume name with size ('-' for maximum available size) ubi write[vol] address volume size - Write volume from address with size ubi write.part address volume size [fullsize] - Write part of a volume from address ubi read[vol] address volume [size] - Read volume to address with size ubi remove[vol] volume - Remove volume ubi skipcheck volume on/off - Set or clear skip_check flag in volume header [Legends] volume: character name size: specified in bytes type: s[tatic] or d[ynamic] (default=dynamic)UBIFS not mounted, use ubifsmount to mount volume first! ** File not found %s ** UBIFS not mounted, use ubifs mount to mount volume first! No UBIFS volume mounted! ubifsloadload file from an UBIFS filesystem [bytes] - load file 'filename' to address 'addr'ubifslslist files in a directory[directory] - list files in a 'directory' (default '/')ubifsumountunmount UBIFS volume - unmount current volumeubifsmount - mount 'volume-name' volumeUncompressed err :%d Uncompressed size: %zd = 0x%zX unlz4lz4 uncompress a memory regionsrcaddr dstaddr dstsize NOTE: Specify the destination size that is sufficiently larger than the source size. Uncompressed size: %lu = 0x%lX gzwriteunzip and write memory to block device length [wbuf=1M [offs=0 [outsize=0]]] wbuf is the size in bytes (hex) of write buffer and should be padded to erase size for SSDs offs is the output start offset in bytes (hex) outsize is the size of the expected output (hex bytes) and is required for files with uncompressed lengths 4 GiB or larger unzipunzip a memory regionsrcaddr dstaddr [dstsize]Uncompressed size: %ld = %#lX lzmadeclzma uncompress a memory regionSee InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudioHuman Interface, Subclass: NoneBoot KeyboardMouseMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d 12 Mb/s+- %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dmsusbstarting USB... resetting USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part ## Copying '%s' subimage from FIT image at %08lx ... Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-imageBad arguments: ydevconfig mount_pt mtd_dev start_block end_block Bad arguments: ymount mount_pt Mounting yaffs2 mount point %s Bad arguments: yumount mount_pt Unmounting yaffs2 mount point %s Bad arguments: yls [-l] dir -lBad arguments: yrd file_name Reading file %s Bad arguments: ywr file_name value n_values Writing value (%lx) %lx times to %s... Bad arguments: yrdm file_name addr Bad arguments: ywrm file_name addr size Bad arguments: ymkdir dir_name Bad arguments: yrmdir dir_name Bad arguments: yrm name Bad arguments: ymv old_path new_path ymvYAFFS mvold_path new_path moves/rename files within a yaffs mount pointyrmYAFFS rmpath removes a yaffs fileyrmdirYAFFS rmdirdirname removes a yaffs directoryymkdirYAFFS mkdirdir create a yaffs directoryywrmwrite file from memory to yaffsfilename offset size writes memory to yaffs fileyrdmread file to memory from yaffsfilename offset reads yaffs file into memoryywrwrite file to yaffsfilename value num_vlues write values to yaffs fileyrdpath read file from yaffsylsyaffs ls[-l] dirnameyumountunmount yaffsmtpoint unmounts a yaffs2 mount pointymountmtpoint mounts a yaffs2 mount pointydevconfigconfigure yaffs mount pointmtpoint mtd_id start_block end_block configures a yaffs2 mount pointydevlslist yaffs mount pointsytrace[new_mask] show/set yaffs trace maskDevice "%s" not supported by U-Boot image Device "%s" is inactive Erasing 0x%x - 0x%x:...Error! Done! Writing %d bytes from 0x%lx to offset 0 ... Failed to probe SPI Flash Erasing %d bytes (%d blocks) at offset 0 ...Writing %d bytes from 0x%lx to offset 0 ...Error: SATA device not found Error: SATA 0 not found No SD/MMC/eMMC card found %s(%d) init failed Error: MMC 0 not found Error - failed to obtain block descriptor Error - written %#lx blocks Error: usb_init failed Error: USB storage device not found Error: USB 0 not found flash-image.binBurning U-Boot image "%s" from "%s" to "%s" Error: Read not supported on device "%s" Error: Failed to read file %s from %s ERROR: Bad MAGIC 0x%08x != 0x%08x Error: Bad Prolog checksum. 0x%x != 0x%x Error: Bad Image checksum. 0x%x != 0x%x Image checksum...OK! Error: Image header verification failed Error: Write not supported on device %s Error: Unknown source "%s" Error: Unknown destination "%s" bubtBurn a u-boot image to flash[file-name] [destination [source]] -file-name The image file name to burn. Default = flash-image.bin -destination Flash to burn to [spi, nand, mmc, sata]. Default = spi -source The source to load image from [tftp, usb, mmc, sata]. Default = tftp Examples: bubt - Burn flash-image.bin from tftp to active boot device bubt flash-image-new.bin nand - Burn flash-image-new.bin from tftp to NAND flash bubt backup-flash-image.bin mmc usb - Burn backup-flash-image.bin from usb to MMC No CLI available%.*s%*s syntax error ERROR : xmalloc failed ERROR : xrealloc failed ** Abort *?[\%u%s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS\$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodonebootdelaykernel-offsetkernaddrrootdisk-offsetrootaddrHit any key to stop autoboot: %2d  0%2d BTN '%s'> %s common/button_cmd.cbutton_cmd_%d_nameNo button labelled '%s' button_cmd_%dNo command set for button '%s' DRAM: baudrate (effective Net: load-environmentMMC: NAND: %lu MiB Core: %d devices, %d uclasses, devicetree: %sWarning: Device tree includes old 'u-boot,dm-' tags: please fix by 2023.07! Model: %s NULL device name! mdio_register: non unique device name '%s' %x - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY extended status read failed, assuming no 1000BASE-X PHY 1000BT statusPHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T 1000BASE-X PHY AN duplexPHY duplexPHY AN adv duplex read failed, assuming half duplex unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) %s: invalid max packet size unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dusb_ignorelistusb_ignorelist parse error in "%s" usb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) Error: Cannot find high speed parent of usb-1 device cannot reset port %i!? usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times usb_hubusb-hub Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry usb_storage_blkusb_mass_storageusb-mass-storageEnter choice: y Y yes YES stdinstdoutstderrpre-reloc realloc() is not supportedalloc space exhausted common/malloc_simple.cCRC32 for %08lx ... %08lx ==> %08lx md5sha1crc16-ccittbootsecure## Error: Secure boot command not specified ## Error: "%s" returned (code %d) Problem No valid hush parser to use, cli will not initialized! %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d INVALIDEMERGALERTCRITERRWARNINGNOTICEINFODEBUGCONTENTIOcoredriver-modeldevice-treebloblistacpieventexpo%s.%s,%s:%d-%*s()loadxy_timeoutUnknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available ## Unknown partition table type %x Partition Map for %s device %d -- Partition Type: %s Whole Disk** Bad HW partition specification %s %s ** UBI** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") Could not find "%s" partition Couldn't find partition %s %s hdusbdmmcsdxx%s%c%dblk_partitionFATFAT32** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %08x-%02x Extd Boot%3d %-10lu %-10lu %08x-%02x %02x%s%s Part Start Sector Num Sectors UUID Type DOSPart Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %pUl guid: %pUl EFI%s:%d(none) IDE device %d: Device %d: unknown device %s.%ssatanvmenvmxipefiloadervirtiopvblockblkmaprkmtdlinux,codebutton_gpiogpio-keysgpio-keys-polledcompatibledrivers/core/lists.c/clocks/firmware/reserved-memoryrootroot_drivernopdrivers/core/device-remove.cnot-boundchild unbinducdevice '%s' failed to unbind simple_bussimple-bussimple-mfd %-10.10s %3d [ %c ] %-20.20s | `-- |-- uclass %d: %s %-3i %c %s @ %08lx, seq %d(out of memory) Class Index Probed Driver Name ----------------------------------------------------------- Driver Compatible %-20.20s%-20.20s %s Driver uid uclass Devices %-25.25s %-3.3d %-20.20s %-51.51s%-25.25s Driver Address %-25.25s %p little-endianbig-endiannative-endiansysconbootph-allbootph-some-rambootph-pre-rambootph-pre-sramu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplu-boot,dm-vpl/configphy-modephy-connection-typephy-handlephy-deviceinternalrev-miirev-rmiirgmii-idrgmii-rxidrgmii-txidrtbismiixlgmiimocaqsgmiitrgmii100base-x1000base-x2500base-xrxaui10gbase-r25gbase-rusxgmii10gbase-krqusgmii1000base-kxinputoutput-highoutput-low%s: missing gpio-hog state. %s: wrong gpios property, 2 values needed %d line-namegpio-hoggpio_hog%s: %s: error: gpio %s%d not reserved get_valueset_valueset_dir_flags%s.%s%d#gpio-cells%s%d: %s: %d [%c]%s%soutputunusedngpiosmvebu%d_gpio_mvebumarvell,orion-gpiohvcsmcarm,psci-0.2psci-sysresetarm,psci-1.0arm,psciu-boot,i2c-transaction-bytesgeneric_%xi2c_generic_chip_drvclock-frequencydrivers/i2c/i2c-uclass.cu-boot,i2c-offset-leni2c-chipi2c_genericcell-indexu-boot,i2c-slave-addri2c_mvtwsimarvell,mv64xxx-i2cmarvell,mv78230-i2callwinner,sun4i-a10-i2callwinner,sun6i-a31-i2cdefault-stategpio_ledgpio_led_wrapgpio-ledsError enabling VMMC supply : %d Unknown modeStatus Error: 0x%08x drivers/mmc/mmc.cTimeout waiting card ready MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd eMMC >= 4.4 required for enhanced user data area Card does not support partitioning Card does not define HC WP group size User data enhanced area not HC WP group size aligned GP%i partition not HC WP group size aligned Card does not support enhanced attribute Total enhanced size exceeds maximum (%u > %u) Card does not support host controlled partition write reliability settings Card already partitioned vmmc-supplyvqmmc-supplyCard did not respond to voltage select! : %d MMC: no card present unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d Man %06x Snr %04x%04x%c%c%c%c%c%c%s - probe failed: %d MMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)MMC Device %d not found eMMC%s: %d (%s)mmc_blk Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed Removing MTD device #%d (%s) with use count %d Warning: MTD name "%s" is not unique! drivers/mtd/mtdcore.cBUG at %s:%d/%s()! BUG!%s: unlock failed, writes may not work mtdidsmtdparts"%s" partitions still in use, can't delete them mtdparts=Wrong mtdparts: %s MTD name too long: %s Could not find a valid device for %s Could not parse device %s Failed parsing MTD partitions from mtdparts! Failed parsing MTD %s OF partitions! Minimum partition size 4kiB, %lldB requested No closing ')' found in partition name Empty partition name No partitions allowed after a fill-up Unexpected character '%c' in mtdparts 0x%08llx@0x%08llxmemory allocation error while creating partitions for "%s" mtd: partition "%s" is out of reach -- disabled mtd: partition "%s" extends beyond the end of device "%s" -- size truncated to %#llx drivers/mtd/mtdpart.cWARNING at %s:%d/%s()! mtd: partition "%s" doesn't start on an erase block boundary -- force read-only mtd: partition "%s" doesn't end on an erase block -- force read-only Not enough space to save partitions meta-data Partition size must be a multiple of %d Error when deleting partition "%s" (%d) fixed-partitionsread-onlyMTDnand%ddrivers/mtd/nand/raw/nand_bbt.cNo space left to write bad block table nand_bbt: can't scan flash and build the RAM-based BBT ToshibaSamsungFujitsuNationalRenesasST MicroHynixMicronAMD/SpansionMacronixEonSanDiskIntelATOUnknownTC58NVG0S3E 1G 3.3V 8-bitTC58NVG2S0F 4G 3.3V 8-bitTC58NVG2S0H 4G 3.3V 8-bitTC58NVG3S0F 8G 3.3V 8-bitTC58NVG5D2 32G 3.3V 8-bitTC58NVG6D2 64G 3.3V 8-bitSDTNQGAMA 64G 3.3V 8-bitSDTNRGAMA 64G 3.3V 8-bitH27UBG8T2BTR-BC 32G 3.3V 8-bitH27UCG8T2ATR-BC 64G 3.3V 8-bitH27QCG8T2E5R-BCF 64G 3.3V 8-bitNAND 4MiB 5V 8-bitNAND 4MiB 3,3V 8-bitNAND 8MiB 3,3V 8-bitNAND 16MiB 1,8V 8-bitNAND 16MiB 3,3V 8-bitNAND 16MiB 1,8V 16-bitNAND 16MiB 3,3V 16-bitNAND 32MiB 1,8V 8-bitNAND 32MiB 3,3V 8-bitNAND 32MiB 1,8V 16-bitNAND 32MiB 3,3V 16-bitNAND 64MiB 1,8V 8-bitNAND 64MiB 3,3V 8-bitNAND 64MiB 1,8V 16-bitNAND 64MiB 3,3V 16-bitNAND 128MiB 1,8V 8-bitNAND 128MiB 3,3V 8-bitNAND 128MiB 1,8V 16-bitNAND 128MiB 3,3V 16-bitNAND 256MiB 3,3V 8-bitNAND 256MiB 1,8V 8-bitNAND 256MiB 1,8V 16-bitNAND 256MiB 3,3V 16-bitNAND 512MiB 1,8V 8-bitNAND 512MiB 3,3V 8-bitNAND 512MiB 1,8V 16-bitNAND 512MiB 3,3V 16-bitNAND 1GiB 1,8V 8-bitNAND 1GiB 3,3V 8-bitNAND 1GiB 1,8V 16-bitNAND 1GiB 3,3V 16-bitNAND 2GiB 1,8V 8-bitNAND 2GiB 3,3V 8-bitNAND 2GiB 1,8V 16-bitNAND 2GiB 3,3V 16-bitNAND 4GiB 1,8V 8-bitNAND 4GiB 3,3V 8-bitNAND 4GiB 1,8V 16-bitNAND 4GiB 3,3V 16-bitNAND 8GiB 1,8V 8-bitNAND 8GiB 3,3V 8-bitNAND 8GiB 1,8V 16-bitNAND 8GiB 3,3V 16-bitNAND 16GiB 1,8V 8-bitNAND 16GiB 3,3V 8-bitNAND 16GiB 1,8V 16-bitNAND 16GiB 3,3V 16-bitNAND 32GiB 1,8V 8-bitNAND 32GiB 3,3V 8-bitNAND 32GiB 1,8V 16-bitNAND 32GiB 3,3V 16-bitNAND 64GiB 1,8V 8-bitNAND 64GiB 3,3V 8-bitNAND 64GiB 1,8V 16-bitNAND 64GiB 3,3V 16-bitbad blockbbt reservedAttempt to erase non block-aligned data Size of erase exceeds limit Skipping %s at 0x%08llx %s: MTD get bad block failed: %d %s: MTD Erase failure: %d %s: MTD writeoob failure: %d Erasing at 0x%llx -- %3d%% complete. Cleanmarker written at 0x%llx.Attempt to write non page-aligned data Attempt to write outside the flash area Size of write exceeds partition or device limit NAND write to offset %llx failed %d Skip bad block 0x%08llx Attempt to read non page-aligned data Attempt to read outside the flash area Size of read exceeds partition or device limit NAND read from offset %llx failed %d Skipping bad block 0x%08llx drivers/mtd/nand/raw/nand_base.cnand_base: Failed to configure data interface to SDR timing mode 0 ONFIEPPSJEDECnand_base: Could not find valid JEDEC parameter page; aborting nand_base: Could not find valid ONFI parameter page; aborting nand-bus-widthnand-on-flash-bbtnand-ecc-modesofthwhw_syndromehw_oob_firstsoft_bchnand-ecc-algohammingnand-ecc-strengthnand-ecc-step-sizenand_base: must set both strength and step size in DT nand-ecc-maximizenand_base: Invalid ECC page accessors setup MX30LF1G18ACMX30LF2G18ACMX30LF4G18AC%s %s: failed to perform OTP IO: %i drivers/mtd/nand/raw/nand_macronix.cudevice *)(NULL%s %s: failed to leave OTP mode after %s Invalid OOB size valueCould not get ECC info%s %s: Timeout on RDDREQ while draining the FIFO drivers/mtd/nand/raw/pxa3xx_nand.c%s %s: Ready timeout!!! num-cspxa3xx driver supports single CS only marvell,nand-enable-arbitermarvell,nand-keep-configmarvell,system-controller%s %s: alloc nand resource failed pxa3xx_nand-0%s %s: There is no chip on cs %d! %s %s: Error: timings not found %s %s: Failed to set timings: %d %s %s: ECC strength %d at page size %d is not supported %s %s: unsupported page size on this variant %s %s: failed to scan nand at cs %d %s %s: non-supported command %x %s %s: Wait timeout!!! Failed to initialize %s. (error %d) marvell,armada370-nand-controllermarvell,armada-8k-nand-controllermarvell,mvebu-ac5-pxa3xx-nanddrivers/mtd/spi/sf-uclass.cspi_flash@%d:%djedec_spi_norspi_flashSF: Failed to set up slave drivers/mtd/spi/sf_probe.cjedec,spi-norw25p80w25p16w25p32w25x05w25x40w25x16w25q16dww25x32w25q20clw25q20bww25q20eww25q32w25q32dww25q16jvw25q32jvw25q32jwmw25q256jwmw25x64w25q64dww25q64jvw25q128fww25q128jvw25q128jww25q256fww25q256jww25q512jvw25q512nwqw25q512nwmw25q512jvqw25q01jvw25q01jvfimw25q02jvw25q80w25q80blw25q16clw25q32bvw25q64cvw25q128w25q256w25m512jww25m512jvw25h02jv%s %s: Erase operation failed. drivers/mtd/spi/spi-nor-core.c%s %s: Program operation failed. %s %s: Attempted to modify a protected sector. %s %s: flash operation timed out %s %s: unrecognized JEDEC id bytes: %02x, %02x, %02x m25p,fast-read%s %s: failed to read SFDP parameter headers %s %s: 16-bit opcodes not supported %s %s: non-uniform erase sector maps are not supported yet. %s %s: Failed to parse optional parameter table: %04x SF: Detected %s with page size , erase size , total drivers/mtd/ubi/attach.cubi%d error: %s: inconsistent vol_id ubi%d error: %s: inconsistent vol_type ubi%d error: %s: inconsistent used_ebs ubi%d error: %s: inconsistent data_pad ubi%d error: %s: inconsistent VID header at PEB %d ubi%d error: %s: unsupported on-flash UBI format ubi%d error: %s: VID of PEB %d header is bad, but it was OK earlier, err %d ubi%d error: %s: two LEBs with same sequence number %llu ubi%d error: %s: erase counter overflow at PEB %d, EC %d ubi%d error: %s: no free eraseblocks ubi%d error: %s: 'ubi_io_read_ec_hdr()' returned unknown code %d ubi%d error: %s: this UBI version is %d, image version is %d ubi%d error: %s: erase counter overflow, max is %d ubi%d error: %s: bad image sequence number %d in PEB %d, expected %d ubi%d error: %s: PEB %d contains corrupted VID header, and the data does not contain all 0xFF ubi%d error: %s: this may be a non-UBI PEB or a severe VID header corruption which requires manual inspection hexdump of PEB %d offset %d, length %dubi%d error: %s: 'ubi_io_read_vid_hdr()' returned unknown code %d ubi%d: "delete" compatible internal volume %d:%d found, will remove it ubi%d: read-only compatible internal volume %d:%d found, switch to read-only mode ubi%d: "preserve" compatible internal volume %d:%d found ubi%d error: %s: incompatible internal volume %d:%d found ubi%d: scanning is finished ubi%d error: %s: %d PEBs are corrupted and preserved Corrupted PEBs are:ubi%d error: %s: too many corrupted PEBs, refusing ubi%d: empty MTD device detected ubi%d error: %s: MTD device is not UBI-formatted and possibly contains non-UBI data - refusing it ubi%d error: %s: bad is_empty flag ubi%d error: %s: negative values ubi%d error: %s: bad vol_id ubi%d error: %s: highest_vol_id is %d, but vol_id %d is there ubi%d error: %s: bad vol_type ubi%d error: %s: bad data_pad ubi%d error: %s: bad ai->min_ec (%d), %d found ubi%d error: %s: bad ai->max_ec (%d), %d found ubi%d error: %s: too high PEB number %d, total PEBs %d ubi%d error: %s: bad lnum or used_ebs ubi%d error: %s: non-zero used_ebs ubi%d error: %s: incorrect highest_lnum or lnum ubi%d error: %s: bad leb_count, %d objects in the tree ubi%d error: %s: bad highest_lnum ubi%d error: %s: bad ai->vols_found %d, should be %d ubi%d error: %s: VID header is not OK (%d) ubi%d error: %s: bad sqnum %llu ubi%d error: %s: bad vol_id %d ubi%d error: %s: bad compat %d ubi%d error: %s: bad lnum %d ubi%d error: %s: bad used_ebs %d ubi%d error: %s: bad data_pad %d ubi%d error: %s: bad highest_lnum %d ubi%d error: %s: bad last_data_size %d ubi%d error: %s: PEB %d is not referred ubi%d error: %s: bad attaching information about LEB %d ubi%d error: %s: bad attaching information about volume %d ubi%d error: %s: mtd%d is already attached to ubi%d drivers/mtd/ubi/build.cubi%d error: %s: refuse attaching mtd%d - it is already emulated on top of UBI ubi%d error: %s: already exists ubi%d: attaching mtd%d ubi%d error: %s: multiple regions, not implemented ubi%d error: %s: min. I/O unit (%d) is not power of 2 ubi%d error: %s: bad write buffer size %d for %d min. I/O unit ubi%d error: %s: unaligned VID header shift %d ubi%d error: %s: bad VID header (%d) or data offsets (%d) ubi%d: MTD device %d is write-protected, attach in read-only mode ubi%d error: %s: failed to attach mtd%d, error %d ubi%d error: %s: cannot clean auto-resize flag for volume %d ubi%d error: %s: cannot auto-resize volume %d ubi%d: volume %d ("%s") re-sized from %d to %d LEBs ubi%dubi%d error: %s: cannot add volume %d ubi%d error: %s: cannot initialize UBI %s, error %d ubi%d error: %s: cannot spawn "%s", error %d ubi%d: attached mtd%d (name "%s", size %llu MiB) ubi%d: PEB size: %d bytes (%d KiB), LEB size: %d bytes ubi%d: min./max. I/O unit sizes: %d/%d, sub-page size %d ubi%d: VID header offset: %d (aligned %d), data offset: %d ubi%d: good PEBs: %d, bad PEBs: %d, corrupted PEBs: %d ubi%d: user volume: %d, internal volumes: %d, max. volumes count: %d ubi%d: max/mean erase counter: %d/%d, WL threshold: %d, image sequence number: %u ubi%d: available PEBs: %d, total reserved PEBs: %d, PEBs reserved for bad PEB handling: %d ubi%d error: %s: only %d UBI devices may be created ubi%d error: %s: %s reference count %d, destroy anyway ubi%d: detaching mtd%d ubi%d: mtd%d is detached UBI error: too many MTD devices, maximum is %d UBI error: cannot open mtd %s, error %d UBI error: cannot attach mtd%d UBI error: cannot initialize UBI, error %d UBI error: too many parameters, max. is %d UBI error: parameter "%s" is too long, max. is %d UBI error: too many arguments at "%s" UBI error: incorrect bytes count: "%s" UBI error: bad value for max_beb_per1024 parameter: %sUBI error: bad value for ubi_num parameter: %subi%d error: %s: bad CRC at record %u: %#08x, not %#08x drivers/mtd/ubi/vtbl.cubi%d error: %s: bad data_pad, has to be %d ubi%d error: %s: too large reserved_pebs %d, good PEBs %d ubi%d error: %s: volumes %d and %d have the same name "%s" ubi%d error: %s: volume table check failed: record %d, error %d ubi%d error: %s: self-check failed ubi%d error: %s: the layout volume was not found ubi%d error: %s: too many LEBs (%d) in layout volume ubi%d: volume table was restored ubi%d error: %s: both volume tables are corrupted ubi%d error: %s: more than one auto-resize volume (%d and %d) layout volumeubi%d error: %s: not enough PEBs, required %d, available %d ubi%d error: %s: %d PEBs are corrupted and not used ubi%d error: %s: found %d volumes while attaching, maximum is %d + %d ubi%d error: %s: too large volume ID %d found ubi%d: finish volume %d removal ubi%d error: %s: bad attaching information, error %d ubi%d error: %s: no volume info, but volume exists drivers/mtd/ubi/vmt.cubi%d error: %s: bad alignment ubi%d error: %s: alignment is not multiple of min I/O unit ubi%d error: %s: bad data_pad, has to be %lld ubi%d error: %s: update marker and corrupted simultaneously ubi%d error: %s: too large reserved_pebs ubi%d error: %s: bad usable_leb_size, has to be %lld ubi%d error: %s: too long volume name, max is %d ubi%d error: %s: bad name_len %lld ubi%d error: %s: corrupted dynamic volume ubi%d error: %s: bad used_ebs ubi%d error: %s: bad last_eb_bytes ubi%d error: %s: bad used_bytes ubi%d error: %s: bad skip_check ubi%d error: %s: volume info is different ubi%d error: %s: self-check failed for volume %d ubi%d error: %s: volume %d already exists ubi%d error: %s: volume "%s" exists (ID %d) ubi%d error: %s: not enough PEBs, only %d available ubi%d error: %s: cannot create volume %d, error %d ubi%d error: %s: out of volume IDs ubi%d error: %s: too small size %d, %d LEBs contain data ubi%d error: %s: not enough PEBs: requested %d, available %d ubi%d error: %s: cannot open device %d, volume %d, error %d drivers/mtd/ubi/kapi.cubi%d: force data checking ubi%d: recover PEB %d, move data to PEB %d ubi%d: data was successfully recovered ubi%d: try again ubi%d: try another PEB ubi%d error: %s: LEB:%i:%i is PEB:%i instead of %i! drivers/mtd/ubi/eba.cubi%d error: %s: no enough physical eraseblocks (%d, need %d) ubi%d error: %s: node with incompatible UBI version found: this UBI version is %d, image version is %d drivers/mtd/ubi/io.cubi%d error: %s: bad VID header offset %d, expected %d ubi%d error: %s: bad data offset %d, expected %d ubi%d error: %s: bad erase counter %lld ubi%d error: %s: bad EC header ubi%d error: %s: bad magic %#08x, must be %#08x ubi%d error: %s: self-check failed for PEB %d ubi%d error: %s: bad copy_flag ubi%d error: %s: bad compat ubi%d error: %s: zero used_ebs ubi%d error: %s: zero data_size ubi%d error: %s: bad data_size ubi%d error: %s: too high lnum ubi%d error: %s: non-zero data CRC ubi%d error: %s: non-zero data_size ubi%d error: %s: zero data_size of copy ubi%d error: %s: bad VID header ubi%d error: %s: bad VID header magic %#08x at PEB %d, must be %#08x ubi%d error: %s: error %d while checking if PEB %d is bad (ECC error)ubi%d: fixable bit-flip detected at PEB %d ubi%d error: %s: error %d%s while reading %d bytes from PEB %d:%d, read %zd bytes ubi%d error: %s: bad CRC, calculated %#08x, read %#08x ubi%d error: %s: read-only mode ubi%d error: %s: cannot mark PEB %d bad, error %d ubi%d error: %s: validation failed for PEB %d ubi%d error: %s: cannot allocate memory to check for 0xFFs ubi%d error: %s: err %d while reading %d bytes from PEB %d:%d, read %zd bytes ubi%d error: %s: flash region at PEB %d:%d, length %d does not contain all 0xFF bytes ubi%d: hex dump of the %d-%d region ubi%d error: %s: bad VID header CRC at PEB %d, calculated %#08x, read %#08x ubi%d error: %s: cannot write %d bytes to PEB %d:%d (emulated) ubi%d error: %s: cannot allocate memory to check writes ubi%d error: %s: self-check failed for PEB %d:%d, len %d ubi%d: data differ at position %d ubi%d: hex dump of the original buffer from %d to %d ubi%d: hex dump of the read buffer from %d to %d ubi%d error: %s: error %d while writing %d bytes to PEB %d:%d, written %zd bytes ubi%d error: %s: cannot erase PEB %d, error %d ubi%d error: %s: cannot erase PEB %d ubi%d error: %s: cannot erase PEB %d (emulated) ubi%d error: %s: cannot invalidate PEB %d, write returned %d ubi%d: run torture test for PEB %d ubi%d error: %s: erased PEB %d, but a non-0xFF byte found ubi%d error: %s: pattern %x checking failed for PEB %d ubi%d: PEB %d passed torture test, do not mark it as bad ubi%d error: %s: read problems on freshly erased PEB %d, must be bad ubi%d error: %s: work failed with error code %d drivers/mtd/ubi/wl.cubi%d error: %s: self-check failed for PEB %d, EC %d, Protect queue ubi%d error: %s: self-check failed for PEB %d, EC %d, RB-tree %p ubi%d error: %s: %s: work failed with error code %d ubi%d error: %s: read EC is %lld, should be %d ubi%d error: %s: erase counter overflow at PEB %d, EC %llu ubi%d error: %s: failed to erase PEB %d, error %d ubi%d error: %s: bad physical eraseblock %d detected ubi%d error: %s: no reserved/available physical eraseblocks ubi%d: mark PEB %d as bad ubi%d: %d PEBs left in the reserve ubi%d error: %s: error %d while reading VID header from PEB %d ubi%d error: %s: too many erroneous eraseblocks (%d) ubi%d: scrubbed PEB %d (LEB %d:%d), data moved to PEB %d ubi%d error: %s: error %d while moving PEB %d to PEB %d ubi%d error: %s: error %d while moving PEB %d (LEB %d:%d) to PEB %d ubi%d error: %s: PEB %d not found ubi%d: schedule PEB %d for scrubbing ubi_bgt%ddubi%d error: %s: new PEB %d does not contain all 0xFF bytes ubi%d: reserved more %d PEBs for bad PEB handling drivers/mtd/ubi/debug.cubi%d: dumping %d bytes of data from PEB %d, offset %d Erase counter header dump: magic %#08x version %d ec %llu vid_hdr_offset %d data_offset %d image_seq %d hdr_crc %#08x erase counter header hexdump: Volume identifier header dump: magic %08x version %d vol_type %d copy_flag %d compat %d vol_id %d lnum %d data_size %d used_ebs %d data_pad %d sqnum %llu hdr_crc %08x Volume identifier header hexdump: Volume information dump: vol_id %d reserved_pebs %d alignment %d data_pad %d vol_type %d name_len %d usable_leb_size %d used_ebs %d used_bytes %lld last_eb_bytes %d corrupted %d upd_marker %d skip_check %d name %s 1st 5 characters of name: %c%c%c%c%c Volume table record %d dump: name NULL crc %#08x Volume attaching information dump: vol_id %d highest_lnum %d leb_count %d compat %d vol_type %d used_ebs %d last_data_size %d data_pad %d eraseblock attaching information dump: ec %d pnum %d lnum %d scrub %d sqnum %llu drivers/net/mvmdio.cXSMI bus read not valid mvmdiomarvell,orion-mdiomarvell,xmdioCannot find eth driver mvpp2-%d%s: Wrong port mode (%d) drivers/net/mvpp2.c%s %s: Tx stop timed out, status=0x%08x timeout: packet not sent from aggregated to phys TXQ timeout: packet not sent %s %s: bad rx status %08x (crc error), size=%zu %s %s: bad rx status %08x (overrun error), size=%zu %s %s: bad rx status %08x (resource error), size=%zu %s %s: port %d: cleaning queue %d timed out %s %s: mvpp2_prs_mac_da_accept BC failed %s %s: mvpp2_prs_mac_da_accept MC failed %s %s: mvpp2_prs_def_flow failed %s %s: cannot allocate Rx queues %s %s: cannot allocate Tx queues %s %s: Marking phy as invalid, link will not be checked %s %s: cannot connect to phy %s: No link fixed-link%s %s: incorrect phy mode %s %s: missing port-id value phy-reset-gpiosmarvell,sfp-tx-disable-gpiogop-port-idillegal port number %dRequested port mode (%d) not supported %s %s: invalid queue size parameter %s %s: BM pool %d is not %d bytes aligned %s %s: failed to create BM pool %d, size %d %s %s: failed to initialize controller %s %s: mixing pool types is forbidden %s %s: cannot allocate %d buffers for pool %d %s %s: pool %d: %d of %d allocated %s %s: failed to init port %d mvpp2_basemarvell,armada-375-pp2marvell,armada-7k-pp22mvpp2(null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYWaiting for PHY realtime linkmarvell,reg-initMarvell 88E1680Marvell 88E1310Marvell 88E151xMarvell 88E1240Marvell 88E1149SMarvell 88E1145Marvell 88E1121RMarvell 88E1118RMarvell 88E1118Marvell 88E1111SMarvell 88E1011SComphy-%d: %-13s Comphy-%d: %-13s %-10s marvell,comphy-a3700marvell,comphy-cp110%s %s: comphy: No compatible DT node found drivers/phy/marvell/comphy_core.cComphy chip #%d: marvell,armada80401.25 Gbps2.5 Gbps3.125 Gbps5.125 Gpbs6 Gbps10.3125 GbpsUNCONNECTEDPEX0PEX1PEX2PEX3SATA0SATA1SGMII0SGMII1SGMII2USB3USB3_HOST0USB3_HOST1USB3_DEVICERXAUI0RXAUI1SFI0SFI1APIGNOREmvebu_comphymarvell,mvebu-comphyComphy %d isn't configured to SFI drivers/phy/marvell/comphy_cp110.cmarvell,mvebu-utmi-2.6.0UTMI PHY PLL address is invalid UTMI PHY base address is invalid utmi-portUTMI PHY port type is invalid Impedance calibration is not done PLL calibration is not done PLL is not ready Failed to initialize UTMI PHY %d UTMI PHY %d initialized to USB Device USB Host%d max-lanescomphy max lanes is wrong mux-bitcountcomphy mux bit count is wrong mux-lane-orderphy-typeno phy type for lane %d, setting lane as unconnected phy-speedphy-invertclk-srcend_pointmarvell,armada-8k-ahciSATA node not found in FDT SATA address not found in FDT PLL is not locked - Failed to initialize lane %d gpio-controllerpinconfigpinctrl-namespinctrl-%d%s %s: %s: uclass_get_device_by_phandle_id: err=%d drivers/pinctrl/pinctrl-uclass.c%s %s: could not find pctldev %s %s: %s: pinctrl_config_one: err=%d marvell,ap806-pinctrlmarvell,armada-8k-cpm-pinctrlmarvell,armada-7k-pinctrlmarvell,pinsmarvell,functionpin-funcpin-countmax-funcbank-namereverse-regmvebu_pinctrlmarvell,mvebu-pinctrlmarvell,armada-8k-cps-pinctrlregulator-min-microvoltregulator-max-microvoltregulator-init-microvoltregulator-min-microampregulator-max-microampregulator-always-onregulator-boot-onregulator-ramp-delayregulator-force-boot-offregulator-state-memregulator-off-in-suspendregulator-suspend-microvoltregulator-nameregulatorstdout-pathNo serial driver found## Baudrate %d bps not supported ## Baudrate may not be deleted reg-offsetreg-shiftreg-io-width ns16550_serialns16550ns16550aingenic,jz4780-uartnvidia,tegra20-uartsnps,dw-apb-uart%s %s: Cannot set speed (err=%d) drivers/spi/spi-uclass.c%s %s: Cannot set mode (err=%d) spi-max-frequency%s %s: Invalid cs %d (err=%d) Invalid bus %d (err=%d) %s %s: Invalid chip select %d:%d (err=%d) %s %s: Warning: SPI speed fallback to %u kHz spi-cpolspi-cphaspi-cs-highspi-3wirespi-half-duplexspi-tx-bus-widthspi-rx-bus-widthspi_generic*** spi_xfer: Time out during SPI transfer mvebu_spimarvell,orion-spimarvell,armada-375-spimarvell,armada-380-spimarvell,armada-xp-spimiscid%dlun%dnamdrivers/scsi/scsi.cscsi_blkscanning bus for devices... unable to unbind devices (%dE) unbRx: failed to receive: %d Waiting for Ethernet connection... unable to connect. r8152 Unknown Device r8152_ethusb,device-classusb,interface-classgeneric_bus_%x_dev_%xusb_dev_generic_drvscanning bus %s for devices... No USB Device found %d USB Device(s) found Bus %s: Port not available. probe failed, error %d companionFailed to get companion (ret=%d) No USB controllers found usb_dev_genericEHCI fail timeout STS_ASS reset out of buffer pointers (%zu bytes left) EHCI failed: timeout when disabling periodic list EHCI failed: timeout when enabling periodic list EHCI failed to shut down host controller. %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue Timeout poll on interrupt endpoint unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error EHCI fail to reset USB EHCI %x.%02x marvell,armada-3700-ehcimarvell,ac5-ehciehci_mvebumarvell,orion-ehciHost not halted after %u microseconds. non-bulk pipe (type=%lu)non-interrupt pipe (type=%lu)Evaluate ContextConfigure Endpointdrivers/usb/host/xhci.cERROR: %s command returned completion code %d. Could not allocate xHCI USB device data structures non-control pipe (type=%lu)The request port(%d) exceeds maximum port number unknown value DT_STRING %x unknown value %x unknown feature %x Unknown request Setup ERROR: address device command for slot %d. Device not responding to set address. ERROR: Incompatible devicefor address device command. ERROR: unexpected command completion code 0x%x. Failed to configure xHCI endpoint Register %x NbrPorts %d Starting the controller USB XHCI %x.%02x  drivers/usb/host/xhci-mem.cVirt dev for slot[%d] already allocated Failed to allocate virtual device Failed to allocate out context for virt dev Failed to allocate in context for virt dev unable to allocate DCBA drivers/usb/host/xhci-ring.cWARN urb submitted to disabled ep WARN waiting for error on ep to be cleared WARN endpoint is halted ERROR unknown endpoint state for ep Unexpected XHCI event TRB, skipping... (%08x %08x %08x %08x) XHCI timeout on event type %d... Resetting EP %d... abort_td: Expected a TRB_TRANSFER TRB first vbus-supplyFailed to turn ON the VBUS regulator xhci_mvebumarvell,armada3700-xhcimarvell,armada-380-xhcimarvell,armada-8k-xhcienv_buf [%u bytes] too small for value of "%s" ## Error: illegal character '=' in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d %pMmissing environment variable: %s autostart*** Warning - %s, using default environment env/common.cbad CRCCannot import environment: errno = %d import failed${...}${Loading Environment from %s... not initialized Failed (%d) Saving Environment to %s... not possible ^%s$Error compiling regex: %s eth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,.callbacksspi_flash_probe_bus_cs() failedErasing SPI flash...Writing to SPI flash...malloc() failedspi_flash_read() failedSPIFlash** Reading file would overwrite reserved memory ** fs/fs.c** Unable to write file %s ** %s/ %s %8lld %s %d file(s), %d dir(s) ** Unable to create link %s -> %s ** Can't set block device ** No boot file defined ** Failed to load '%s' %llu bytes read in %lu ms (%llu bytes written in %lu msSupported filesystemsext4ubifsunsupported** Can not find directory. ** part_offset is %lu total_sector is %llu error: overflow occurs No Memory %s: Device read error! invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** Block full, trying previous All blocks full: Allocate new Directory uses extents Directory exceeds limit no block left to assign no inode left to assign Badly aligned ext2_dirent Invalid path It is a Directory file found, deleting Failed to iterate over directory %s < ? > %10u %s Error in ext4fs_log_gdt Error in getting the block group descriptor table error in File System init Unsupported feature metadata_csum found, not writing. hash tree directory No memory Not enough space on partition !!! Error in copying content ** Cannot support non-zero offset ** ** Error ext4fs_write() ** Invalid input arguments %s buffer ptr is NULL _get_node: malloc failed Journal Recovery Completed Journal Scan Completed Recovery required update journal finished Invalid FAT entry: %#08x fs/fat/fat.cFAT sector size mismatch (fs=%u, dev=%lu) FAT cluster size not set FAT cluster size too big (cs=%u, max=%u) UNo current device Interface: %s No valid FAT fs found Filesystem: FAT%d "%s" Invalid FAT entry Error reading cluster %02X%02X-%02X%02X%s: Error, no memory for malloc! Symlink recursion, aborting %s/%sUBIFS error (ubi%d:%d pid %d): %s: invalid compression type %d fs/ubifs/ubifs.cUBIFS error (ubi%d:%d pid %d): %s: compression type %d is not compiled in UBIFS error (ubi%d:%d pid %d): %s: %s compression is not compiled in UBIFS error (ubi%d:%d pid %d): %s: cannot decompress %d bytes, compressor %s, error %d UBIFS error (ubi%d:%d pid %d): %s: bad data node (block %u, inode %lu) other %s: Error in ubifs_iget(), ino=%lld ret=%p! %.3s %.3s %.2d %.2d:%.2d:%.2d %d %9lld %24.24s UBIFS error (ubi%d:%d pid %d): %s: cannot find next direntry, error %d %s: Error reading inode %ld! ubifs: Error offset must be a multiple of %d ubifs: Error offset (%lld) > file-size (%lld) %s: Error, malloc fails! UBIFS error (ubi%d:%d pid %d): %s: cannot read page %lu of inode %lu, error %d Error reading file '%s' Loading file '%s' to addr 0x%08lx... Done Unmounting UBIFS volume %s! zlibdeflateUBIFS error (ubi%d:%d pid %d): %s: sequence number overflow %llu, end of life fs/ubifs/io.cUBIFS error (ubi%d:%d pid %d): %s: reading %d bytes from LEB %d:%d failed, error %d UBIFS error (ubi%d:%d pid %d): %s: unmap LEB %d failed, error %d UBIFS error (ubi%d:%d pid %d): %s: ubi_is_mapped failed for LEB %d, error %d UBIFS error (ubi%d:%d pid %d): %s: bad magic %#08x, expected %#08x UBIFS error (ubi%d:%d pid %d): %s: bad node type %d UBIFS error (ubi%d:%d pid %d): %s: bad CRC: calculated %#08x, read %#08x UBIFS error (ubi%d:%d pid %d): %s: bad node length %d UBIFS error (ubi%d:%d pid %d): %s: bad node at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: bad node type (%d but expected %d) UBIFS error (ubi%d:%d pid %d): %s: expected node type %d UBIFS error (ubi%d:%d pid %d): %s: bad node length %d, expected %d UBIFS error (ubi%d:%d pid %d): %s: bad node at LEB %d:%d, LEB mapping status %d UBIFS error (ubi%d:%d pid %d): %s: orphan list not empty at unmount fs/ubifs/super.cUBIFS error (ubi%d:%d pid %d): %s: inode is too large (%lld) UBIFS error (ubi%d:%d pid %d): %s: inode %lu validation failed, error %d UBIFS error (ubi%d:%d pid %d): %s: failed to read inode %lu, error %d UBI volumeUBIFS error (pid: %d): cannot open "%s", error %d UBIFS: only ro mode in U-Boot allowed. UBIFS error (ubi%d:%d pid %d): %s: too small LEBs (%d bytes), min. is %d bytes UBIFS error (ubi%d:%d pid %d): %s: too few LEBs (%d), min. is %d UBIFS error (ubi%d:%d pid %d): %s: bad min. I/O size %d UBIFS error (ubi%d:%d pid %d): %s: bad write buffer size %d for %d min. I/O unit UBIFS error (ubi%d:%d pid %d): %s: can't format empty UBI volume: read-only %s UBIFS error (ubi%d:%d pid %d): %s: cannot mount read-write - read-only media UBIFS error (ubi%d:%d pid %d): %s: 'compressor "%s" is not compiled in UBIFS error (ubi%d:%d pid %d): %s: too small LEB size %d, at least %d needed UBIFS error (ubi%d:%d pid %d): %s: too small log %d LEBs, required min. %d LEBs ubifs_bgt%d_%dUBIFS error (ubi%d:%d pid %d): %s: no LEB for GC Error reading superblock on volume '%s' errno=%d! No UBIFS filesystem found! UBIFS error (ubi%d:%d pid %d): %s: on-flash format version is w%d/r%d, but software only supports up to version w%d/r%d fs/ubifs/sb.cUBIFS error (ubi%d:%d pid %d): %s: on-flash format version %d is not supported UBIFS error (ubi%d:%d pid %d): %s: unsupported key format UBIFS error (ubi%d:%d pid %d): %s: min. I/O unit mismatch: %d in superblock, %d real UBIFS error (ubi%d:%d pid %d): %s: LEB size mismatch: %d in superblock, %d real UBIFS error (ubi%d:%d pid %d): %s: bad LEB count: %d in superblock, %d on UBI volume, %d minimum required UBIFS error (ubi%d:%d pid %d): %s: max. LEB count %d less than LEB count %d UBIFS error (ubi%d:%d pid %d): %s: too small journal (%lld bytes), must be at least %lld bytes UBIFS error (ubi%d:%d pid %d): %s: too large journal size (%lld bytes), only %lld bytes available in the main area UBIFS error (ubi%d:%d pid %d): %s: bad superblock, error %d UBIFS error (ubi%d:%d pid %d): %s: unexpected node type %d master LEB %d:%d fs/ubifs/master.cUBIFS error (ubi%d:%d pid %d): %s: bad leb_cnt on master node UBIFS error (ubi%d:%d pid %d): %s: bad master node at offset %d error %d UBIFS error (ubi%d:%d pid %d): %s: too few LPT LEBs fs/ubifs/lpt.cUBIFS error (ubi%d:%d pid %d): %s: LPT ltab too big UBIFS error (ubi%d:%d pid %d): %s: invalid crc in LPT node: crc %hx calc %hx UBIFS error (ubi%d:%d pid %d): %s: invalid type (%d) in LPT node type %d UBIFS error (ubi%d:%d pid %d): %s: error %d reading nnode at %d:%d UBIFS error (ubi%d:%d pid %d): %s: error %d reading pnode at %d:%d UBIFS error (ubi%d:%d pid %d): %s: calc num: %d UBIFS error (ubi%d:%d pid %d): %s: bad pad node at LEB %d:%d fs/ubifs/scan.cUBIFS error (ubi%d:%d pid %d): %s: bad padding length %d - %d UBIFS error (ubi%d:%d pid %d): %s: cannot read %d bytes from LEB %d:%d, error %d UBIFS error (ubi%d:%d pid %d): %s: corruption at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: first %d bytes from LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: garbage UBIFS error (ubi%d:%d pid %d): %s: bad node UBIFS error (ubi%d:%d pid %d): %s: unknown UBIFS error (ubi%d:%d pid %d): %s: empty space starts at non-aligned offset %d UBIFS error (ubi%d:%d pid %d): %s: corrupt empty space at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: LEB %d scanning failed UBIFS error (ubi%d:%d pid %d): %s: LEB %d scanning failed, error %d UBIFS error (ubi%d:%d pid %d): %s: cannot change properties of LEB %d, error %d fs/ubifs/lprops.cUBIFS error (ubi%d:%d pid %d): %s: cannot update properties of LEB %d, error %d UBIFS error (ubi%d:%d pid %d): %s: old idx added twice! fs/ubifs/tnc.cUBIFS error (ubi%d:%d pid %d): %s: cannot read node type %d from LEB %d:%d, error %d UBIFS error (ubi%d:%d pid %d): %s: current fanout %d, branch count %d fs/ubifs/tnc_misc.cUBIFS error (ubi%d:%d pid %d): %s: max levels %d, znode level %d UBIFS error (ubi%d:%d pid %d): %s: bad branch %d UBIFS error (ubi%d:%d pid %d): %s: bad key type at slot %d: %d UBIFS error (ubi%d:%d pid %d): %s: bad target node (type %d) length (%d) UBIFS error (ubi%d:%d pid %d): %s: have to be %d UBIFS error (ubi%d:%d pid %d): %s: have to be in range of %d-%d UBIFS error (ubi%d:%d pid %d): %s: bad key order (keys %d and %d) UBIFS error (ubi%d:%d pid %d): %s: keys %d and %d are not hashed but equivalent UBIFS error (ubi%d:%d pid %d): %s: bad indexing node at LEB %d:%d, error %d UBIFS error (ubi%d:%d pid %d): %s: bad key in node at LEB %d:%d inode(%lu, %s)(%lu, %s, %#08x)(%lu, %s, %u)truncate(bad key type: %#08x, %#08x)bad key format %dunknown nodeR5unknown/invalid name hashsimpleunknown/invalid formatNot a node, first %zu bytes:fs/ubifs/debug.c magic %#x crc %#x node_type %d (%s) group_type %d (%s) sqnum %llu len %u pad_len %u key_hash %d (%s) key_fmt %d (%s) flags %#x big_lpt %u space_fixup %u min_io_size %u leb_size %u leb_cnt %u max_leb_cnt %u max_bud_bytes %llu log_lebs %u lpt_lebs %u orph_lebs %u jhead_cnt %u fanout %u lsave_cnt %u default_compr %u rp_size %llu rp_uid %u rp_gid %u fmt_version %u time_gran %u UUID %pUB highest_inum %llu commit number %llu log_lnum %u root_lnum %u root_offs %u root_len %u gc_lnum %u ihead_lnum %u ihead_offs %u index_size %llu lpt_lnum %u lpt_offs %u nhead_lnum %u nhead_offs %u ltab_lnum %u ltab_offs %u lsave_lnum %u lsave_offs %u lscan_lnum %u empty_lebs %u idx_lebs %u total_free %llu total_dirty %llu total_used %llu total_dead %llu total_dark %llu lnum %u offs %u jhead %u key %s creat_sqnum %llu size %llu nlink %u atime %lld.%u mtime %lld.%u ctime %lld.%u uid %u gid %u mode %u xattr_cnt %u xattr_size %u xattr_names %u compr_type %#x data len %u inum %llu type %d nlen %d name (bad name length, not printing, bad or corrupted node) size %u compr_typ %d data size %d data: inum %u old_size %llu new_size %llu child_cnt %d level %d Branches: %d: LEB %d:%d len %d key %s last node flag %llu %d orphan inode numbers: ino %llu node type %d was not recognized znode %p, LEB %d:%d len %d parent %p iip %d level %d child_cnt %d flags %lx zbranches: %d: znode %p LEB %d:%d len %d key %s %d: LNC %p LEB %d:%d len %d key %s (pid %d) dumping pnode: address %zx parent %zx cnext %zx flags %lu iip %d level %d num %d %d: free %d dirty %d flags %d lnum %d not categorizeddirtyfreefreeable0 (GC)1 (base)2 (data)commit restingbackground commit requestedcommit requiredBACKGROUND commit runningcommit running and requiredbroken commitinode nodedata nodedirentry nodexentry nodetruncate nodepadding nodesuperblock nodemaster nodereference nodeindexing nodecommit start nodeorphan nodeno node groupin node grouplast of node groupdirentryxentryUBIFS error (ubi%d:%d pid %d): %s: orphaned twice fs/ubifs/orphan.cUBIFS error (ubi%d:%d pid %d): %s: invalid node type %d in orphan area at %d:%d UBIFS error (ubi%d:%d pid %d): %s: out of order commit number %llu in orphan node at %d:%d UBIFS error (ubi%d:%d pid %d): %s: failed to recover master node fs/ubifs/recovery.cUBIFS error (ubi%d:%d pid %d): %s: dumping first master node UBIFS error (ubi%d:%d pid %d): %s: dumping second master node UBIFS error (ubi%d:%d pid %d): %s: unexpected return value %d UBIFS error (ubi%d:%d pid %d): %s: corrupt empty space LEB %d:%d, corruption starts at %d UBIFS error (ubi%d:%d pid %d): %s: corruption %d UBIFS error (ubi%d:%d pid %d): %s: Not a valid node UBIFS error (ubi%d:%d pid %d): %s: Node a CS node, type is %d UBIFS error (ubi%d:%d pid %d): %s: CS node cmt_no %llu != current cmt_no %llu UBIFS error (ubi%d:%d pid %d): %s: failed to get CS sqnum UBIFS error (ubi%d:%d pid %d): %s: unrecoverable log corruption in LEB %d directory entryextended attribute entryUBIFS error (ubi%d:%d pid %d): %s: bad %s node fs/ubifs/replay.cUBIFS error (ubi%d:%d pid %d): %s: bad key type %d UBIFS error (ubi%d:%d pid %d): %s: bad index head LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: first log node at LEB %d:%d is not CS node UBIFS error (ubi%d:%d pid %d): %s: first CS node at LEB %d:%d has wrong commit number %llu expected %llu UBIFS error (ubi%d:%d pid %d): %s: first node is not at zero offset UBIFS error (ubi%d:%d pid %d): %s: file system's life ended UBIFS error (ubi%d:%d pid %d): %s: bad sqnum %llu, commit sqnum %llu UBIFS error (ubi%d:%d pid %d): %s: bud at LEB %d:%d was already referred UBIFS error (ubi%d:%d pid %d): %s: unexpected node in log UBIFS error (ubi%d:%d pid %d): %s: log error detected while replaying the log at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: no UBIFS nodes found at the log head LEB %d:%d, possibly corrupted UBIFS error (ubi%d:%d pid %d): %s: bad truncation node UBIFS error (ubi%d:%d pid %d): %s: unexpected node type %d in bud LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: bad node is at LEB %d:%d fs/yaffs2/yaffs_allocator.cyaffs: yaffs: Could not allocate Tnodes yaffs: Could not add tnodes to management list yaffs: Tnodes added yaffs: Could not allocate more objects yaffs: Chunk Id (%d:%d) invalid fs/yaffs2/yaffs_bitmap.cyaffs: BlockBits block %d is not valid yaffs trace mask: %08x using inband tags no NAND devices available fs/yaffs2/yaffs_uboot_glue.cFailed to allocate memory Flash device invalid Bad start/end Mount point name already used Region overlaps with partition %s Configures yaffs mount %s: dev %d start block %d, end block %d %s using inband tags, %-10s %5d 0x%05x 0x%05x %snot mounted free 0x%x Error opening file: %d. %s File not found Error mounting %s, return value: %d, %s Error umounting %s, return value: %d, %s Copy %s to 0x%p... [DONE] Error opening file: %d, %s regular filesymlinkopendir failed, %s %-25s %7ld %5d %s yaffs_mkdir returning error: %d, %s yaffs_rmdir returning error: %d, %s yaffs_unlink returning error: %d, %s No errorNo such entryBad handleOut of memoryWrong permissionsFaultBusyName existsNot on same deviceNo such deviceNot a directoryNot permitted on a directoryInvalid parameterToo many open filesDevice fullRead only file systemRange errorName too longNot emptySymlink loopyaffs: checking blocks %d to %d yaffs: **>> yaffs: get_block_info block %d is not valid fs/yaffs2/yaffs_getblockinfo.hyaffs: erasing checkpt block %d yaffs: allocating checkpt block: erased %d reserved %d avail %d next %d yaffs: allocating checkpt block %d yaffs: out of checkpt blocks yaffs: checkpoint wite buffer nand %d(%d:%d) objid %d chId %d yaffs: checkpt blocks_avail = %d yaffs: find next checkpt block: start: blocks %d next %d yaffs: find next checkpt block: search: block %d oid %d seq %d eccr %d yaffs: found checkpt block %d yaffs: found no more checkpt blocks yaffs: checkpoint byte count %d yaffs: checkpoint invalidate of %d blocks yaffs: yaffs: Mounting %s zzfs/yaffs2/yaffs_guts.cyaffs: FreeObject %p inode %p yaffs: Out of temp buffers yaffs: Releasing unmanaged temp buffer yaffs: yaffs: Block struck out yaffs: Chunk %d not erased yaffs: soft delete chunk %d yaffs: Chunk %d not found zero instead yaffs: yaffs: no more tnodes yaffs: tragedy: Trying to add an object to a null pointer directory yaffs: tragedy: Trying to add an object to a non-directory needs retiringyaffs: yaffs_block_became_dirty block %d state %d %s yaffs: **>> Erasure failed %d yaffs: >>Block %d erasure supposedly OK, but chunk %d not erased yaffs: yaffs: Failed to mark bad and erase block %d yaffs: yaffs: Failed to write bad block marker to block %d yaffs: **>> Block %d retired yaffs: Erased block %d yaffs: Deleting invalid chunk %d yaffs: line %d delete of chunk %d yaffs: yaffs tragedy:attempt to put data chunk into a non-file yaffs: yaffs tragedy: existing chunk < 0 in scan yaffs: yaffs tragedy: no more erased blocks yaffs: Allocated block %d, seq %d, %d left yaffs: yaffs tragedy: no more erased blocks, but there should have been %d yaffs: Allocating reserve yaffs: !!!!!!!!! Allocator out !!!!!!!!!!!!!!!!! yaffs: **>> yaffs chunk %d was not erased yaffs: **>> Block %d needs retiring yaffs: **>> yaffs write required %d attempts lost+foundobjyaffs: tragedy: yaffs_find_by_name: null pointer directory yaffs: tragedy: yaffs_find_by_name: non-directory yaffs: tragedy: yaffs_change_obj_name: new_dir is not a directory yaffs: yaffs: Deleting empty file %d bgyaffs: GC Selected block %d with %d free, prioritised:%d yaffs: GC none: finder %d skip %d threshold %d dirtiest %d using %d oldest %d%s yaffs: yaffs: GC n_erased_blocks %d aggressive %d yaffs: Collecting block %d, in use %d, shrink %d, whole_block %d yaffs: Collecting block %d that has no chunks in use yaffs: Collecting chunk in block %d, %d %d %d yaffs: gc: page in gc mismatch: %d %d %d %d yaffs: page %d in gc has no object: %d %d %d yaffs: yaffs: About to finally delete object %d yaffs: gc did not increase free chunks before %d after %d yaffs: yaffs: GC !!!no reclaim!!! n_erased_blocks %d after try %d block %d yaffs: Writing %d bytes to chunk!!!!!!!!! yaffs: yaffs tragedy: no space during cache write yaffs: AddrToChunk of offset %lld gives chunk %d start %d yaffs: Found daft chunk_id %d for %d no aliassilly old nameyaffs: Added object %d to dirty directories unlinkedyaffs: yaffs: immediate deletion of file %d yaffs: Remove object %d from dirty directories yaffs: Deleting lost_found object %d yaffs: yaffs: yaffs_guts_initialise() yaffs: yaffs: Need a device yaffs: device already mounted yaffs: NAND geometry problems: chunk size %d, type is yaffs%s, inband_tags %d yaffs: InitialiseNAND failed yaffs: device function(s) missing or wrong yaffs: chunk group too large yaffs: yaffs: restored from checkpoint yaffs: Hanging object %d moved to lost and found yaffs: yaffs: yaffs_guts_initialise() aborted. yaffs: yaffs: yaffs_guts_initialise() done. yaffs: Writing chunk %d tags %d %d yaffs: Writing with no tags fs/yaffs2/yaffs_nand.cyaffs: packed tags obj %d chunk %d byte %d seq %d yaffs: ext.tags eccres %d blkbad %d chused %d obj %d chunk%d byte %d del %d ser %d seq %d yaffs: **>>Block %d marked for retirement yaffs: **>> yaffs chunk %d is not valid yaffs: **>>yaffs ecc error fix performed on chunk %d:0 yaffs: **>>yaffs ecc error unfixed on chunk %d:0 yaffs: **>>yaffs ecc error fix performed on chunk %d:1 yaffs: **>>yaffs ecc error unfixed on chunk %d:1 yaffs: **>>mtd ecc error fix performed on chunk %d:0 yaffs: **>>mtd ecc error unfixed on chunk %d:0 yaffs: **>>mtd ecc error fix performed on chunk %d:1 yaffs: **>>mtd ecc error unfixed on chunk %d:1 yaffs: Block %d has undefined state %d yaffs: Block %d has bad run-state %s yaffs: Block %d has illegal values pages_in_used %d soft_del_pages %d yaffs: Block %d has inconsistent values pages_in_use %d counted chunk bits %d yaffs: Block %d is in state %d after gc, should be erased yaffs: Block summary yaffs: %d blocks have illegal states yaffs: Too many allocating blocks yaffs: %s %d blocks yaffs: Checkpoint block count wrong dev %d count %d yaffs: Erased block count wrong dev %d count %d yaffs: Too many collecting blocks %d (max is 1) yaffs: Verifying object header tags %p obj %p oh %p yaffs: Obj %d header type is illegal value 0x%x yaffs: Obj %d header mismatch obj_id %d yaffs: Obj %d header mismatch parent_id %d obj->parent is NULL yaffs: Obj %d header mismatch parent_id %d parent_obj_id %d yaffs: Obj %d header name is NULL yaffs: Obj %d header name is 0xff yaffs: Object %d chunk_id %d NAND mismatch chunk %d tags (%d:%d) fs/yaffs2/yaffs_verify.cyaffs: Directory has wrong type: %d yaffs: Object in directory list has wrong parent %p ,out of range,marked as deletedyaffs: Obj %d has chunk_id %d %s %s yaffs: Obj %d has parent pointer %p which does not look like an object yaffs: Obj %d's parent is not a directory (type %d) yaffs: Obj %d has illegaltype %d yaffs: No object to verify yaffs: Object does not have parent yaffs: Parent is not directory yaffs: Object in directory %d times yaffs: Freechunks verification failure %d %d %d Needs scanScanningEmptyAllocatingFullDirtyCheckpointCollectingDeadyaffs: yaffs1_scan starts intstartblk %d intendblk %d... yaffs: Block scanning block %d state %d seq %d yaffs: block %d is bad yaffs: Block empty yaffs: Allocating from %d %d yaffs: Shadow fixer: %d shadows %d yaffs: yaffs tragedy: attempting to use non-directory as a directory in scan. Put in lost+found. yaffs: yaffs1_scan ends yaffs: GC refresh count %d selected block %d with seq_number %d yaffs: save entry: is_checkpointed %d yaffs: skipping checkpoint write yaffs: write checkpoint validity yaffs: write checkpoint device yaffs: write checkpoint objects yaffs: Checkpoint write object %d parent %d type %d chunk %d obj addr %p yaffs: save exit: is_checkpointed %d yaffs: restore entry: is_checkpointed %d yaffs: skipping checkpoint read yaffs: read checkpoint validity yaffs: read checkpoint device yaffs: read checkpoint objects yaffs: struct size %d instead of %d ok %d yaffs: Checkpoint read object %d parent %d type %d chunk %d yaffs: Checkpoint read object %d type %d chunk %d does not match existing object type %d yaffs: Checkpoint read object %d parent %d type %d chunk %d Parent type, %d, not directory yaffs: Checkpoint read tnodes %d records, last %d. ok %d yaffs: read checkpoint checksum %d yaffs: restore exit: is_checkpointed %d yaffs: yaffs2_scan_backwards starts intstartblk %d intendblk %d... yaffs: yaffs2_scan_backwards() could not allocate block index! yaffs: Block scanning block %d has bad sequence number %d yaffs: %d blocks to be sorted... yaffs: ...done yaffs: %d blocks to scan yaffs: Partially written block %d detected. gc will fix this. yaffs: Unfixed ECC in chunk(%d:%d), chunk ignored yaffs: Chunk (%d:%d) with bad tags:obj = %d, chunk_id = %d, n_bytes = %d, ignored yaffs: yaffs tragedy: Could not make object for object %d at chunk %d during scan yaffs: yaffs tragedy: Bad object type, %d != %d, for object %d at chunk %d during scan yaffs: yaffs2_scan_backwards ends yaffs: nandmtd2_write_chunk_tags chunk %d data %p tags %p fs/yaffs2/yaffs_mtdif2.cyaffs: nandmtd2_read_chunk_tags chunk %d data %p tags %p yaffs: nandmtd2_MarkNANDBlockBad %d yaffs: nandmtd2_QueryNANDBlock %d yaffs: block is bad yaffs: block is bad seq %d state %d ** Invalid Block Device Descriptor (NULL) fs/fs_internal.c ** %s read error ** ** %s read error - block * %s read error - last part linux,phandleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGS#address-cellsinitcall failed at call %p (err=%d) list passed to list_sort() too long for efficiency invalid distance too far backinvalid distance codeinvalid literal/length codeunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkError: Bad gzipped data Error: gunzip out of data in header %lu/%lu %lu bytes, crc 0x%08x uncompressed %lu of %lu crcs == 0x%08x/0x%08x %s: size %lu not a multiple of %lu %s: start offset %lu not a multiple of %lu Error: gunzip out of data in headersize of %lx doesn't match trailer low bits %x %s: uncompressed size %lu exceeds device size Error: inflateInit2() returned %d %s: weird termination with result %d Error: inflate() returned %d abort No valid device tree binary found at %p okayseparatefitembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-init## ERROR: unsupported match method: 0x%02x Env export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! , Build: %s%llu Hz%s%lu.%ld %cHz%s%u Bytes%s %ciB%s %0*lx### ERROR ### Please RESET the board ### %s.cnt = 0x%lx / max = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x This will not be a case any time lmb_dump_all: ERROR: Failed to allocate 0x%lx bytes below 0x%lx. RE is too long (code overflow)RE is too long (data overflow)unknown cmd (%d) at %d Jump offset is too bigNo closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d U-Boot.armv8bootp_archInvalid pxeuuid: %s bootp_vciHost Name*** WARNING: %s is too long (%d - max: %d) - truncated Root PathNIS Domain Name*** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again Error: eth device name "%s" has a space! Error: %s address %pM illegal value Warning: %s failed to set MAC address Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Warning: %s (eth%d) using random MAC address - %pM ethactethrotatenonet/eth-uclass.cethprimeeth%d: %s [PRIME]%s %s: couldn't allocate mii_bus net/mdio-uclass.creset-delay-usreset-post-delay-us%s %s: couldn't get reset-gpios: %d device-name%s%daddr%saddreth%dmacskipethmacskipnetretryyesonce ICMP Host Redirect to %pI4 *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Cannot autoload with TFTPGET Abort Bytes transferred = %u (%x hex) %d.%d.%d.%dnvlanUsing %s device done octetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedblksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... TFTP error: '%s' (%d) Not retrying... Retry count exceeded %s; starting again T TFTP server diedfromtftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' TFTP %s server %pI4; our IP address is %pI4; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Save address: 0x%lx Save size: 0x%lx Saving: *Load address: 0x%lx Loading: *SunMonTueWedThuFriSatbootdelay=5baudrate=115200loadaddr=0x800000mtdids=mtdparts=boot_devices=ubi usb netbootcmd=for b in ${boot_devices}; do if test ${b} = ubi; then run ubiboot; fi; if test ${b} = usb; then run usbboot; fi; if test ${b} = net; then run netboot; fi; done;button_cmd_0=run recovery_bootcmdbutton_cmd_0_name=resetnetboot=echo Booting from Network; dhcp; tftpboot ${loadaddr} ${openwrt_initramfs}; bootm ${loadaddr};openwrt_initramfs=openwrt-mvebu-cortexa72-mikrotik_rb5009-initramfs-uImage.itbrecovery_boot_devices=usb netrecovery_bootcmd=led green:sfp on; led blue:hdr1 on; led blue:hdr2 on; for b in ${recovery_boot_devices}; do if test ${b} = usb; then run usbboot; fi; if test ${b} = net; then run netboot; fi; done;ubiboot=echo Booting from NAND (UBI); ubi part ubi; setenv loadimagecmd ${ubiloadimage}; ubi read ${loadaddr} kernel; bootm ${loadaddr};usbboot=echo Booting from USB Storage; usb start; load usb 0:1 ${loadaddr} ${openwrt_initramfs}; bootm ${loadaddr};scriptaddr=0x6d00000pxefile_addr_r=0x6e00000fdt_addr_r=0x6f00000kernel_addr_r=0x7000000ramdisk_addr_r=0xa000000fdtfile=marvell/armada-7040-rb5009.dtb0123456789ABCDEFcompat Dump list of drivers with compatibility strings dm devres Dump list of device resources for each device dm drivers Dump list of drivers with uclass and instances dm static Dump list of drivers with static platform data dm tree [-s][-e][name] Dump tree of driver model devices (-s=sort) dm uclass [-e][name] Dump list of instances for each uclassarocsdxbimdefault [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...]  addr [-c] [-q] [] - Set the [control] fdt location to fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.0123456789abcdefbus [muxtype:muxaddr:muxchannel] - show I2C bus info i2c crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length [-s] - write memory to I2C; the -s option selects bulk write in a single transaction i2c flags chip [flags] - set or get chip flags i2c olen chip [offset_length] - set or get chip offset length i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedaddr part [dest] - extract from legacy image at and copy to addr uname [dest] - extract subimage from FIT image at and copy to LZO  JanFebMarAprMayJunJulAugSepOctNovDec- generic operations on memory technology devices mtd list mtd read[.raw][.oob] [ []] mtd dump[.raw][.oob] [ []] mtd write[.raw][.oob][.dontskipff] [ []] mtd erase[.dontskipbad] [ []] Specific functions: mtd bad With: : NAND partition/chip name (or corresponding DM device name or OF path) : user address from/to which data will be retrieved/stored : offset in in bytes (default: start of the part) * must be block-aligned for erase * must be page-aligned otherwise : length of the operation in bytes (default: the entire device) * must be a multiple of a block for erase * must be a multiple of a page otherwise (special case: default is a page with dump) The .dontskipff option forces writing empty pages, don't use it if unsure. #(-27][:[]|#[]] - Run script starting at addr - A FIT config name or subimage name may be specified with : or # (like bootm). If the image or config name is omitted, the default is used. !R\248>Ž ; Ch.A .A > Cث.A .A > CP.A .A > C8.A .A Z/ C|.A .A > C.A .A /W C.A .A V C.A .A ? C.A .A C\.A .A  C.A .A V CL.A .A V C.A .A V CT.A .A V C.A .A C.A .A C C.A .A F C.A .A V C.A .A 3 C.A .A W C.A .A @ C.A .A C.A .A Uw C$.A .A C C.A .A Xw C(.A .A m C.A .A l C.A .A ? C.A .A ) C .A .A ^w C.A .A jw C .A .A ) C%.A .A C.A .A C C.A .A )H C.A .A Xw C.A .A  C(.A .A ) Cl@.A .A CA.A .A  CK.A .A @C@K.A .A ChJ.A .A Ŋ CH.A .A ̊ CPE.A .A ӊ @ChD.A .A ~ @C8.A .A O CB.A .A @CC.A .A CL.A .A ? CU.A .A ) CR.A .A ? CT.A .A  CY.A .A > CtW.A .A / A  tftp8usb\Xmmcx@HsataܞP@spiHnandP5 j 8o t  ! y }     I )$P7;@'p l7 l lT")L <      ( ( 8 8 H H X X h h x x     ( ( 8 8 H H X X h h x x     ( ( 8 8 H H X X h h x x     ( ( 8 8 H H X X h h x x     ( ( 8 8 H H X X h h x x     ( ( 8 8 H H X X h h x x     ( ( 8 8 H H X X h h x x     ( ( 8 8 H H X X h h x x   l4H44 333V  l3832x ~    # # #  #  1tbBBbt0 8     ,  ! * E. 6 < @ H ѐv@b ܐ&v| ܐ&v Ӑ&v ה2vV ( ޔvV ( EޔvW@ @( EޔvP@ @( הt  (5 ޔt (T BJ@ @ 8t k          3@ s@ C@ S@ 5 @! u @7 E @N U @e 6@@{ v@@ F@@ V@@ x@ 9@ y@ r@ I@ t@ Y@ q@e @e @{ @{ @{ @ @ @ @ @   4  K c {        / D Y o        1 @G :@] *@t J@  < , L  > .( N0PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~N()*+,-./0123456789:;<=>?&#7 #7 1tbBVMMVBbt0F8 8 8 ,8 ,8 ,8 ,8  9 09 (P<dPd_( ((s+n a< #a<  a< - (  d0,`sdIHHHHDHEHFHGHŒdFHܰŠwtFHGH ŠtDHCHŠ< II (*uI'uI$u%t,@ uI  uH (N @sIIH@ @va  bHrI b.!/%q$ @ qHIHH&:XluI  tI1$4`rI hjlnntI(uIqIqI 虁qILuI  tI ԶuHǯ蚁qI,왁qIpIHʘȘ̘ΈpI CȘ ̘ΈpI@ 3@qH@0HLNNqI LNNqIq4$@qH@HLNNqILNNqIq`34eI  tIA$40@sIIH@ @vaTdbHrI b.!/%q$ @ qHIHH 6a $3aH  aIH#HagB ĄsIqr ĄsI0P$+3:<paHp2D0 @HBBpI@ 08K aHHHH 0v< F@sH@@sII IH@ ,uI2Fq@sIO0&bI"rI%%006,u<`sI !%0w!"#$.s!%$Ig.u"&IIII <uIF&rIC"r%% 00@s@I7SH@fd'0Fc;-40++%&0"s% ,'@820$6rFw @FDwD_D '@ Tܥ/@I ӡ ӥ'1 7 ӥ'1 7"s%00drh#1@s:H@,u!%  vd@Hb!H@3ŠtI0Šss(ŠtI&Švt 7Ţs#@s3@ ŠtAHŠvbHH ŠtHH H(@s:H@,u!%  P:3ŠtI0Šss(ŠtI&Švt 7Ţs#@s3@ ŠtAHŠvbHH ŠtHH H(tvnfbIdq`b_`aYAI IYsI Ћ?HЛQK@c0H I GA@cH@g?i32(@30I*Hi30@v.@!H~trIvkI oZ P ؄Ԉ$WH3ajGWaHA $I aI8H+aH/aH)aII Ha $%8I1aI H)'#HfbIdqĄsIqr ĄsI0 Xdy8;IZ~0efaI>aI<aI cI I2qIH0HaHډJ`I1HHH0eI2H>HJ @HBBpI@ < cI 0K`aIpaHp aHԉr 0+Šw(ŠdHHHdH Šd@HAHHŤdDHd@HĀsĂ Šd@HAHBHŠl:؆ aH @aH 2468,u!%  @sH@@sII IH@N`,uI)Fq@sIO0&bI"rI%%006,u2`sI !%'wIg.u"&IIII6buIF&rIC"r%% 00@s@I7SH@fd'0Fc;-40++%&0"s% ,'@820$6rFw @FDwD_D '@ Tܥ/@I ӡ ӥ'1 7 ӥ'1 7"s%00drh#1@s:H@N3ŠtI0Šss(ŠtI&Švt 7Ţs#@s3@ ŠtAHŠvbHH ŠtHH H("@x]1`rII,br&pI/Hb$p`$`#,u!% I`uIPH` H`8҄ 3ŠtI0Šss(ŠtI&Švt 7Ţs#@s3@ ŠtAHŠvbHH ŠtHH H(" q rIIH @sH@@sII IH@`,uI)Fq@sIO0&bI"rI%%006,u2`sI !%'wIg.u"&IIIIjuIF&rIC"r%% 00@s@I7SH@fd'0Fc;-40++%&0"s% ,'@820$6rFw @FDwD_D '@P Tܥ/@I ӡ ӥ'1 7 ӥ'1 7"s%00drh#1I(*.s!%"#/#-!sIsH@" 4 vIF@s:H@6dI%uGkG`uIcG a<`uIHaN!ŠsI1H I c~FuFkFIdI ŠsH0dTDԚ0)  @ @  (DD *    @  0< ds{{\| dltd)J  \\;4ltp\.J td@d4ltd4J  (04ltdU U x* * 3 .A .J \S S S  h- Cdl^ ^ L: CS: .A : C: ; > Chr6 .A l6 Chr6 .A &A @CȮ.A OA ; @C(0<   @C,6  ܅ C? @ C@ @ C` < C< < M_ CQ_ `_ B> CJ> .A 0 CX_ _ V C^ _ /= Cx6= S= . C? @C> HY @C4> > M ChJU o (=݊ @CB < A C0A .A A CxA A B CB B -C Cp6C NC C CC C _ @Cke D CD D E CE E LE CB RE H C6C NC * CضL M C<M M `M C@hM .A _ @C3 3 + C(|T T R CZ 6 @C6 7 H CV = C= = a5 @Ch5 5 ( C 1 4W CH:W _W w CX X 3N C46N MN A CQ \ CD\ h\ IZ C[ w[ Y CG[ w[ C"^ A^ C,B N % C-  C|S` b` ( C`j j 1 Cb b V C )` `  C41r @r q Cq r b @'CY| V CX_ _ " @C/V |  Cd+ . ( C?N ] V C<_ ` l7 C<r7 7 l @CO Ƌ CA @CHR  @ChD ω (=k CVo ` @C6 .A ] C] ] 3 CX%R3 k3 ~ @C8 (=O C$O O ي CB .A 2 C0ch x 7 Cc@ V R @CC (= CZ @C  N9 C6C R sl CHyl l 8 C8  Ce  Ch  5W @Ck C? J C?R l @Ck . A @CkF Ct  CԀ( K Ch . C 9 Cd  Cx è Ъ C8֪ G C8  ְ Cް V 7 C`7 .A  C + r Cy y C 5 C$< H ع CP ߹ C̛ a Cll e Cdĸ շ Cٷ C\  C C  C̙ + h Cm V S q X l D> }ȝ  O U up T] LT| 20 8P w 8  6p t rH Ph r ?p { L   1 G W9 q Q TP ( C hȧ b- G 0xm7 lX @@= ( 4 Yh5 Z `2 9 J - p J : ( px 9  E m@ З s: ~I  7 B lP'  C } hp@ O ;@H D> $( g F 0q v a v % X{ v h w , H H> J $st,mU hjl gJ @**,..  h~/ ` Am/ A]/ A L/ @A ;/ Alh+/ A/ AH / 0AT. A`. Ap. Ah Hw< ( ( d Di Le c ! -T+ 2l H 6d,x 8w ?l`( C ؝ > 3>      (  0 Ȥ 8 ؤ @  H  P  X  ` 2 h G p Y x j |     L L M M Ȟ 7 О M ؞ 1M AM QM ԩ ݩ ۫    ݊  %  @ P P [ p U    0 :5   l H  8   P % h *  . 3 Ƞ $ Р 2ؠ I   t  '   )( 5 0 8 @ :H  P ` X |` p x T' H  8 % @ H   `ȡ С ء P X   P'     L (( 00 8 @ P  `  p [      Т  k      * 0 + @ 9 P @ ` L p _ i r }  3 8 ۫      !  N " ( % 0 > 8 . @ > H 3 P ~ X 9 `  h  p  x        t   ( ȩ >ة > H? <X W p W CH W W Ю W W W  W 0 W H % `  x S  > p> Я W CH W W  W W 0 W @ W P W ` W p W W W .A $ 1 i t Ȱ ^ а - ذ 9 5 { > G R  ]  b   g ( n 0 s 8 z @  H  P  X  `  h  p  x      F  9 K m  i(  b0  p Cx h .A .A > C ث .A .A > C P .A .A  >  C 8( .A 0 .A @ Z/ P CX |` .A h .A x > C  .A .A W C  .A .A  V C( 0 .A 8 .A H ? X C` h .A p .A  C \ .A .A  C  .A .A V C L .A  .A ( V 8 C@ H .A P .A ` V p Cx T .A .A V C  .A .A  C  .A .A  C  C ( .A 0 .A @ F P CX ` .A h .A x V C  .A .A 3 C  .A .A W C  .A  .A 0  @ CH P .A X .A h  x C  .A .A Uw C $ .A .A C C  .A .A  Xw C( (0 .A 8 .A H  m X C` h .A p .A l C  .A .A ? C  .A .A ) C   .A  .A ( ^w 8 C@ H .A P .A ` jw p Cx   .A .A ) C % .A .A  C  .A .A   C C( 0 .A 8 .A @ H )H X C` h .A p .A x  Xw C  .A .A   C ( .A .A  ) C l@ .A  .A (  8 C@ AH .A P .A `  p Cx K .A .A  C @K .A .A  C hJ .A .A  Ŋ  C H( .A 0 .A @ ̊ P CX PE` .A h .A x ӊ C hD .A .A ~ C 8 .A .A O C B .A  .A  0 C8 C@ .A H .A X  h Cp Lx .A .A ? C U .A .A ) C R .A .A ?  C T .A ( .A 8  H CP YX .A ` .A p > C tW .A .A  / A   8 \ X x( @0 H@ ܞH PP @h p H  P 5 j o t !  y 0 } H  `  x          I     ) $  P7 ;( 0 @8 @ 'H P X ` ph x l7    l  l T" ) L <            (  0  8 ( @ ( H 8 P 8 X H ` H h X p X x h h x x                      (  0  8 ( @ ( H 8 P 8 X H ` H h X p X x h h x x                      (  0  8 ( @ ( H 8 P 8 X H ` H h X p X x h h x x                      (  0  8 ( @ ( H 8 P 8 X H ` H h X p X x h h x x                      (  0  8 ( @ ( H 8 P 8 X H ` H h X p X x h h x x                      (  0  8 ( @ ( H 8 P 8 X H ` H h X p X x h h x x                      (  0  8 ( @ ( H 8 P 8 X H ` H h X p X x h h x x                      (  0  8 ( @ ( H 8 P 8 X H ` H h X p X x h h x x               0  @ P l4X H4` 4h  x  3 3 3 V  l3 83 2 x ~        P  x     8      0  H  `  x       !  * .  6 < 8 @ H H x b |    8  h    5 ( T X t      H  x      8 ! h 7 N e { (  X       H  x     e 8 e h { { {  (  X       H  x     4   8 K h c  {     (  X         / H D x Y  o     8  h        (  X 1  G  ]  t   H  x        8  h ( 7 7 7 7 7 8 7 8 8 8 8 8 88 8 P8 8 h8 8 8  9 8 09 X9 - x9 9 9  8: d0 O (O d0O T8O D@O ԚHO 0hO pO O (O O DO DO P hP <P  P dsP P {P {P \|P P P  P P dP P lP tP dQ )J Q  Q  (Q 0Q 8Q \@Q \HQ ;PQ XQ 4pQ lxQ tQ p\Q .J Q tQ Q dQ Q @Q Q dQ Q 4Q lR tR dR 4J (R 0R 8R  @R HR (PR XR 0`R hR 4R lR tR dR U R U R xS * S * (S PS 3 XS .A hS .J xS S \S S S S S S T h- T CT d T l^ (T ^ 8T L: HT CPT XT S: `T .A pT : T CT T : T ; T > T CT hT r6 T .A T l6 T CT hU r6 U .A U &A (U C0U Ȯ8U .A @U OA PU ; `U ChU (pU 0< xU  U  U CU ,U 6 U  U ܅ U CU ?U  U  U @ V CV V @ V @ 0V  @V CHV `PV  XV  hV < xV CV V < V < V M_ V CV V Q_ V `_ V B> V CV V J> W .A W 0 W C(W X0W _ 8W _ HW V XW C`W hW ^ pW  _ W /= W CW xW 6= W S= W . W CW ?W  W  W  X X CX > X  X (X HY 8X C@X 4HX > PX > `X M pX CxX hJX U X o X (=X ݊ X CX BX  X < X A X CX 0X A X .A Y A Y C Y x(Y A 0Y A @Y B PY CXY `Y B hY B xY -C Y CY pY 6C Y NC Y C Y CY Y C Y C Y _ Y CZ kZ e Z D 0Z C8Z @Z D HZ D XZ E hZ CpZ xZ E Z E Z LE Z CZ Z B Z RE Z H Z CZ Z 6C Z NC [ * [ C[ ض [ L ([  8[ M H[ CP[ <X[ M `[ M p[ `M [ C[ @[ hM [ .A [ _ [ C[ [ 3 [ 3 [ + [ C[ (\ |T \ T \ R (\ C0\ 8\ Z @\  P\ 6 `\ Ch\ p\ 6 x\  7 \ H \ C\ \ V \  \ = \ C\ \ = \ = \ a5 ] C] ] h5 ] 5 0] ( @] CH]  P] 1 X]  h] 4W x] C] H] :W ] _W ] w ] C] ] X ]  X ] 3N ] C] 4] 6N ^ MN ^ A ^ C(^ 0^ Q 8^ \ ^ C^ ^ D\ ^ h\ ^ IZ ^ C^ ^ [ ^ w[ ^ Y _ C_ _ G[ _ w[ (_  8_ C@_ H_ "^ P_ A^ `_  p_ Cx_ ,_ B _ N _ % _ C_ _ - _  _  _ C_ |_ S` _ b` ` ( ` C ` `(` j 0` j @` 1 P` CX` `` b h` b x` V ` C`  ` )` ` ` `  ` C` 4` 1r ` @r ` q ` Ca a q a r a b 0a '8a C@a Y| Ha  Pa Xa V ha Cpa Xxa _ a _ a " a Ca /a V a | a  a Ca d+a  a . b  ( b Cb ? b N (b ] 8b V Hb CPb <Xb _ `b ` pb l7 b Cb <b r7 b 7 b l b Cb Ob  b Ƌ b  b Cb Ac  c  c  (c C0c HR8c  @c  Pc  `c Chc hDpc  xc ω c (=c k c Cc Vc o c  c ` c Cc c 6 c .A c ] d Cd d ] d ] 0d 3 @d CHd X%Pd R3 Xd k3 hd ~ xd Cd 8d  d  d (=d O d Cd $d O d O d ي d Cd Bd  e .A e 2 e C(e 0c0e h 8e x He 7 Xe C`e che @ pe V e R e Ce Ce  e  e (=e  e Ce Ze  e  e  f Cf  f  f  (f N9 8f C@f Hf 6C Pf R `f sl pf Cxf Hf yl f l f 8 f Cf f 8 f  f  f Cf ef  f  g  g C g h(g  0g  @g 5W Pg CXg k`g  hg  xg  g Cg ?g  g  g J g Cg ?g R g  g l g Ch kh  h . h A 0h C8h k@h F Xh  hh Cph txh  h  h  h Ch Ԁh ( h K h  h Ch hh  h  i . i Ci  i  (i 9 8i  Hi CPi dXi  `i  pi  i Ci xi  i è i Ъ i Ci 8i ֪ i  i G i Ci 8j  j  j ְ (j C0j 8j ް @j V Pj 7 `j Chj `pj 7 xj .A j  j Cj j  j + j r j Cj j y j y j  k Ck k  k  0k 5 @k CHk $Pk < Xk H hk ع xk Ck Pk  k ߹ k  k Ck ̛k  k  k a k Ck lk l l e l  l C(l d0l ĸ 8l  Hl շ Xl C`l hl ٷ pl  l  l Cl \l  l  l  l Cl l  l  l  m Cm m  m  (m  8m C@m ̙Hm  Pm + `m h pm Cxm m m m  m V n  n q n X (n l0n 8n xn  n D> n ȝ n n n  O o U o p o Txo ] o To |o  p 0 p 8Xp P hp w xp  p  p p p tq q Hq  Xq  hq H xq q Pq h q r q q p8r  Hr { Xr  `r r  r r (s  8s 1 Hs  Xs s W9 s  s Qs  Tt P (t ( 8t  @t Ht ht ȧ t b- t  t 0u m7 (u X 8u @Pu @=u  u  4 v h5 v  (v `2pv 9 v J v  v pv v  w  w pw : w  pw  w  `x 9 x  x E x @ Py З y : @z I Pz  z 7 z  z l0{ ' {  { C {  { { h{ p| O |  (| ;0| @H 8| D@| > H| P| $( X| g `| F h| 0p| q x| v | a | v | % | X| { | v |  |  | h | w |  | , | H | | H} } > } J(}  8} $s@} tH} ,mP} U `} hjh} lp}  gx} J } *} *} ,.} . }  } h} ~ ~/ ~ (~ 0~ `~ m/ ~ ~ ~ ~ ]/ ~  ~ ~   L/ @  H P  ;/  l h  +/   @ / ` Hh p   / TȀ Ѐ  . `( 0 ` .     p .  h   H Hw <  (  d ( Di 8 Le @ c ! T +  ( l0 x H  d , x  h w x l ` ( (cp0-sdhi-pins-089:;<=(cp0-spi-pins-0 (cp0-nand-pins4(cp0-smi-pins#$(cp0-spi-pins-1/012(gpio@440100marvell,orion-gpioJD@9 @Pgpio@440140marvell,orion-gpioJD@@94@Penable-usb-power:enable USB powerenable-leds-power:enable LED-s powersata@540000marvell,armada-8k-ahciJT ? g ndisabledusb3@500000$marvell,armada-8k-xhcigeneric-xhciJP@ > g ndisabledusb3@510000$marvell,armada-8k-xhcigeneric-xhciJQ@ = gnokayspi@700600marvell,armada-380-spiJpP \ g ndisabledspi@700680marvell,armada-380-spiJpP \ g ndisabledi2c@701000marvell,mv78230-i2cJp   V gnokayudefaulti2c@701100marvell,mv78230-i2cJp   W g ndisabledi2c@211000marvell,mv78230-i2cJ!   ndisabledcomphy@441000*marvell,mvebu-comphymarvell,comphy-cp110JDphy0phy1phy2phy3 phy4phy5utmi@580000marvell,mvebu-utmiJX  utmi@58000cmarvell,mvebu-utmi-2.6.0JX D D@ ndisabledutmi@58100cmarvell,mvebu-utmi-2.6.0JX D DDnokaysdhci@780000marvell,armada-8k-sdhciJx E ndisablednand@720000Dmarvell,armada-8k-nand-controllermarvell,armada370-nand-controllerJrT  g 1nokayudefaultpartitionsfixed-partitions partition@0YAFFSJpartition@800000ubiJ?ethernet@0marvell,armada-7k-pp22J$g Kpp_clkgop_clkmg_clknokayeth0 %W_nokay k10gbase-reth1 &W_ ndisabledeth2 'W_ ndisabledpcie0@600000#marvell,armada8k-pciesnps,dw-pcie J` tctrlconfig f7pci~C$   g  ndisabledpcie1@620000#marvell,armada8k-pciesnps,dw-pcie Jb tctrlconfig f7pci~C$" " g  ndisabledpcie2@640000#marvell,armada8k-pciesnps,dw-pcie Jd tctrlconfig f7pci~C$! ! g  ndisabledchosenserial0:115200n8memory@000000007memoryJ@leds gpio-ledsuser green:user :onsfp green:sfp :hdr1 blue:hdr1 :hdr2 blue:hdr2 :keys gpio-keysresetreset : compatible#address-cells#size-cellsmodelserial0serial1methodrangesregno-mapinterrupt-parent#interrupt-cellsinterrupt-controllerinterruptsphandlemsi-controllerarm,msi-base-spiarm,msi-num-spismarvell,odmi-framesmarvell,spi-basebank-namepin-countmax-funcpin-funcmarvell,pinsmarvell,functionngpiosgpio-controller#gpio-cellscell-indexclocksstatuspinctrl-namespinctrl-0spi-max-frequencylabeltimeout-msreg-shiftreg-io-widthclock-frequencydma-coherent#clock-cellsclock-output-namessar-driversar-namegainoffsetdivisorbootph-alldevice_typeenable-methoddevice-namecore-clock-output-namesgate-clock-output-namesgpiobasegpio-hogoutput-highline-namemux-bitcountmax-lanesphy-typephy-speedutmi-portmarvell,nand-enable-arbiternum-csnand-ecc-strengthnand-ecc-step-sizemarvell,system-controllerclock-namesport-idgop-port-idphy-modereg-namesbus-rangeinterrupt-map-maskinterrupt-mapnum-lanesstdout-pathdefault-statelinux,codeh h B0_binary_u_boot_bin_size_binary_u_boot_bin_end_binary_u_boot_bin_start.symtab.strtab.shstrtab.datah h IA!