Z d-M1)?MOo/Oo   P!:0@" Р@ K`"_B_`"d"_B_d"*K"_) pG&_9+='++1`   pG(;+0R#@@@@@@@@@@@@@@@@@@ pG;+4  pG pG pG pGK<_p` pGhZJhhPC hPBX_K@#@K@_P 8hFhk-hG( F 8FFF" FF<D$%F;#F8ғBqӤEBqҘaFU+%FQK$FW;FpKF KF[hKFiӱKF[h kp@GKF0cKF@#hk+i+! F+iG(pp@ x0,LxX,1N DB F%x1u] D`pg@2+ͿKZ"2ؿTpG-n@2+ϿKZ"̿2pGLn@hZ`xt("m(S(d(0(pGn+ pG pGOp`pGOPpGOPpG pG pG8 F!2+ʿKCU28kn@#0 h]By۲C +W"0"hDL` p#q0+F `hZ`ppG pG pGi#hPhCQ` pGih C:h C`Zh@Z` pGh@ihZh_#B F pGih "h C `pGh"ihi_@pGhDh`h/!=@5C`h-]`@h``Lc!; ob-M FFF(3h0<0+PЫh  '3&F[F1F(Fй"YFC # ;3D @F0G6B Fo[F!F(FȱZF2BD LOq F sKhBKFbKF"Zb KF") Cj DB؃hDDpG pGo-A`F" FFo h;`6s,+! "!F@FDx+4$<`0F!F"@Fh 5$,D & o](#sBFF(F0F!F( ((+h3+` Fp-+h;++`,-O4O4#(+O0]O0#F F++FO17F F!F(FO( (,o  F0(O4hDDCh`pG-M$ FFFCFF&F;O ZF!(FF ]Dȿ6$ȿElEL &FRK$FFFDj%iű)F8F陹)F0F Fi@"hFiiF FuemGop F(8Ѓh@jhhB(F!K6_ JOKFnD)F0F(ٵB#O ;@8DRB@F ;+"oF#ZCCCs_ c`p  ]8F`EjIlJ(`F F8@λFn@8F(hl( 8F" I#h``O2IlC(`on@n@hhO2Il( `o Fn@8iEi" Il `h "K3h+ o c`8Fon@?@@Dj"Il ` Fn@PDjl("In ` Fn@#sxEjk`KFlnlN@tc pF1F F jhB8k`KF!Fne@tn@Fll+0##0 8HhEil `+x #q8F-EF(>ЄhloiC>& `f`2FIl a2FIl`"Ilci``6_NXO 2FBFIl`a@6_OFFfa/#F# aon@n@n@Ѐ n@Pil6C `o FphFjEi`il#C##`o pFF `(- K6_JOKF3` h)F@ K @x}i  * 0) +J@i!V } H=f@i@i)! b! \   Fi!`i N`i@! Fo pFifi piQ!F0F 3! @`i 5`i! 0`i"! *`i2F! % pFhica!`i C`i"! `i"! `i!i "`iF  F-MhFi Fh<0{[hkG(>(h ;PF7Fx0ԣz-ԣ~*c'Ԕ"ѮhBF0Fax Eع#z+BF0Faz =#~+"0Fa~ 5X"j*ГZBZA0F! *(0chS!F(FGF(h Sfj.b#jj+^аF& z#x"~DD`3c  0(M#i{`ciFCyh  @ + AA ; 0!PDH&. ##hRF#(h F(`.#ajBF3F(h (ЂFMO #𵍰FFF!0"hFF@0#0#iF6p  -MFFXĠ (FS0"!hF#F! !0 ! 0# 00KCF  0$hihkih{iFGH(0D0DFv-hӹ0D0DCi3Bo *i#E$ iF( A!  D (F+[[E([F + pG pGP88 pG"!F\KFt@FpKF;KF[hDp+KFi+KF[hսp@ CkGKF0+KFPD)(FF F@P FoF() F@6-AF F8Ա$B&o E'FB"јE o@Qo@eo@F9DB xO3-E(FFFH(Fڸ%BF!F0FhF0F B!F0F6:FQF( `(F-M xF/+ F%%B0);F+/*FB9I@Fq#"F@F+Fh @F^@p@MbpiihJB3F!(FҲFh_@#2FX!(F`aFkh_1F(F Fp-M$FFOD %FKJ! !OC&9FH_O FFjEKJӨBFF 6.9D4,ѿ_ H)F  KK@ (F ʚ;MbFi hF`Hd0 a ʚ;-AFi%hh&z_OD `p9F(FF_.`_FHd1F(F*`&a@Fʚ;-AF F _h__&aD `?_ _'`_&a)F FA-M FFFi"! ,Ҁ,π,Fh9FF3)Chh[h,h-ih_gп_)F F/DOH+F! FO@Fc?%!OJB+F FҲFW z')F F+FF@Fh DL9K0_c`_(!*F F'F!/ƿ#P!X!6C@_`*F FF bh_,?_)F F>OH+F! F7F@#O@ 7Dѻ+)F FDF/: _b`_(!*F F`WFF;_c`_(!*F FFO8z8 FFi!`i  *F!`i - 8o -MF FFpK/h,F.Ыh3+?Vt2FO3!F x... O3!F xRB#x0+cxX+PK"F9F0NHO0#xY+E+0;+cxF;۲EJ"f;۲+!FO # Bкx .*  ѝ*н!FO # BЊB x0*JxX*кx :*  t*Дhz9FH h9FHZkJFH9F|2 Q(LF|4YF"FH!FXF(?ULhN9F Hތ@l@s@A@s@]s@ l@}s@s@-MF k FFF$y]){K+2[kcL3hBF8FSFk{F`BF3`{Yx8FSFk)DF{xD,C4h{xB[xqD(@D4`$54hSFBF8Fk4`{[xDSFBF)F8FSFBF)F8FSFBF8Fk{F $ FSFBF)F8F{[xDqSFBF8FkaF(SFBF)F8F3hSE" ;I\  53hSE 5I\3$3`3hSE  .I\3hSE$2hRE !{x[x@3;DB$zϤE22`r12hRE!{x[x@3;DBϤE14hd 4h \B\A{Zx3hCDK205{Zx3h [2 CDK`*FHg@s@-MF } FF 2F& # TI@F`0!^SBSA bbb b21Fhx+Bѻ{+! $ !!i23Э XF;`F)H;hQFZFF gF wF W;hZF3F IF  VE)@F0``AF (F0`()F F``o пoQFHos@s@-AFF(X#,! FMF FUH0F o !F :!8F6F(#;rF8FnF50!F8F(l- 0F D]F(BB;?+#0oo-MFFO F;F(FJ Yx;F(FJ1D(F-MFFFO FCF:F(FKmhYxCF:F(FK1D`(sh Fñ\jhhF Q&@Yh#hH+FHopo ތ@s@hFkFiFGFT3F!hbh hH(F3FJIT4B<8ohhB%8`ik43BТ<t@0t@;t@-EFiFF hBzh#hC#`ch# c`. #h##` *x#i##a_#`"i_ h_;5>*F3SEHAt@"KZo_ ZoBrZgo_"B_gBpKo_dIHb Fo_Bso9q ZCDS D#Ozr SCJ#s!@Ыf@mt@MbD` CbCpq CC|C@SC_ J6CC_6 K;I H  _) BB?g@t@pOKFS"`!MH pLK2_JJDC&_TGJGJ1F2>F+6ٶ3OR@HFOr>HFA0 +:J:KR#0_1J2 FO14H2 FBOAA$P "OQ&Hx"Oq$Hr"!%HmOrOA#HfOrOAH_*O|QHYOrHFS"OqHM"OAHG"OAHA"! H<D@t@@Дe@e@ B?@ dB`BhB8F(ZCl 8h()ѠiclCcd#j[hi۹ii+)+i+/ѣi+1#j[h[i+ FG( 8cl FG(cl#cdj[hj+ FG(h[j+ FG( FG(j[h[j+ FG(o8FF!F%`F8pFKFn+Z# `KF[mKKFnh.oF@ w@w@@@@P?@-M_O2K`_Z`_pb`_Rr`_oq2 Da_JZa_Ja_EPRa_"!_@!_ !_L!_J!_JD!KFO_B (FHKFO2`KFn-zI(FFxJ(FF(:!!F(F# l F(| R,8,BlBj FF(FcI~# o ~(\KF JFShCsS`KF0cKF0hkh+JFIFhGKF$NHaMHMHLH(@IH%IH"HHY (n i(h3dE0+@_F(];Hf(?ZI ,CHF#!F@m B(: j[h[hl+4(/)Fl `( l FH hB o,(F (?n#l H R?B,; (H0" 0UUU-7 x@ x@(x@4x@Sx@x@x@;@x@y@9y@o~@(OKO+K__J3AKF#h=h;i-Fzhh-@ -@RHQ(@NJD[],LKD[x@BFGIGH'9J\+;۲ST,?K"*@x2p9K0BB#+,O 0K[]+@*FI,Hw#*FIJ<HoGy@y@@y@y@^z@&z@uz@z@z@z@z@dz@kz@y@z@@B@z@g@z@f@|@Ƞ@xg@ }@B}@i}@}@А }@@@&g@*{@@k@|@JSK8"_ C;+ظI! ՒKD! F(7! F(0! F() J`_#=@ C_`4O O @@sb-HM+h#`KFh  KFJ`KF[hY1*t(` !HJ3###cC#3K_"K Y\)T<B@hJSCOr SC_JH433#C33Cs37Cs7B`2#c`2?"*!HV(̀ !#JF(ǀH" (@𙀽0" (" (@0 }tHkK_h__Z`h_&p"_`i_%B_a\i_$_Za!_"2BB@R_!@!_"rBr_@!!_""@R_!D!_"pr_D!O"*!DH (J#! FLP0x_7K_`_`_a_:H\a:KF$"܀!  4c#%( /L0K0NZ%pGElгFd2o8+Hd7 UQo BLѻF!H " G(8 DQOH9o9FF8h(ўK 111h!_ FO &&_##!0KjiOa$ ! &+x4+kx*;+#$0R COcT0k#V0zKzK@c00##p#caO@cc`hSC"`qJ`epJ1"foJbfkiVkiXB$1C $1kiB#3@L#@83,!S,!<Ҳ D*1+x,+++ +]є 1+@ƀ++𨀄 1y2(F(?d5h+o{.F8h 0F4CM$1C$1 F@F! F#F@F(r F FNF( F(F0C h*H5o(J)I#5! F(۝ B F (3F2F! F#! F( F F(#5! F (۝0+Иe@ @]@@e@Y@@0t@;t@1JBs!# 1+x+ki !!)KxB Zx! 1+Q &G1)#,+x+ki$1[H1x+ + ,+ Ѐ#!(1r#+%#!F FD%#!F F=-#!F F5֘@9@K}Ҳ_Rտ_!q_"t_ r_ s_ p_q_spG hFkF{icGF]#F)hjh hH< Fo#F JIic1F(FGF(E#F)hjh hHo#FJIw@0t@;t@@-MFFq !FhF!{H{Ho F FBF(FSO3(FpJqI.(h#lJ;`z``D0XXF(ѻIO -NkjZh*L[h+R/_0+[j+YKKFXInF+@pO"TIwF@"9F@FRKG?(Do瀱M#F)hjh hKH+FIJJI+h(0(Ѭ+F(j3JB"(F1I([h+ћ'1K/0KB0K *ѓ BB**HCoA *ѓZ)$H5 Kqa H *ِFHa` 00qH`0`9D@FGiBp w@Ҁ@@Ā@Zb@@@9w@0t@;t@'V@#@P@{@@"A0F»!B R!@_@!@1!B P!@_B!@1( KS _0( (  pG pG pG j APCh_J@@J@_ `pGPCh_ @`pGOC `K hK`pG@B B(FBpGB B8FBpG10 +@B * KH@KFHH<@@@ JK (FF@0@JK (FF@@ 0J#FRKBQ#3+  @@CB@.CB@3BذP@#Bذ  pG pG pG pG pG pGF #Bд A#F"zBH0+3( ( K@@B@XBXA   hZJ`KhXJO` iZJ`pG@@x@7LdhL5F FF G0 <@7LhL5F FF G0 <@OC7#ARF FȻ# %ARFFxOCAR F(ODFOR Fй#FOR F#AR F@O3AR FF0-AȀF F4_O  $_#@@@!! $F_"7@C+#".OcsCxo$H]!FHHV OcOSOS HG!F H H@#Os 0&m@$u@;@m@-M"#H#%+FF"B@΀ x#OZKJ:@;_N 1F0OKS _BA уIKFS˿_@cE O FOB@𝀿_rHO @;3#FB@ (iH 9C 99_CCC@_9#% U-BOO2Fi(.o$E5Bt#OK _ @_ _K_+_LJ+_+ )B ) 5( _9K@+5cV+_C+B8KQ+_C+6JBѿ_",K4H+M̼ C3)(?`  K C3C 0MF__ 0NC`lCPlC0lCl`(?@ ( \ h@h@h@h@i@@д@@d P Р@p Є ᆳބ@@-MJIH^K6_+Ȁ++ɀJ_K @C[3C$_5_$D_KLz_3@KIF KFSK_BBK"O5$FO+F5B+O`czI10;C_Q_A 0_A2-qK4"qKpKqHqKqNqKqKqKqKqKqK qK!qK" pKqJ`3h #mL#`3h #c`3h #`3h #eJ#c`#x!cJ`cJ`cJpcJ"_AIDB_@@ */٢ ( F5YK+B+*B*RJ9C9OJ8C8.LHB@*## *:;;99999; #@J`+F c0F+@6K_L#6DA_)𒎘vu##l@l@@Є@@DHЎe@ @ @) @t@ @@E8@m @)7@Q @ub@b@>@7@@<@@@@@@@(@ *?z *?v B Sm*[#i#g %P0+@ 0 +7иHH%(F$ %!H%!H% !H%HH% )))%)% %%}# =*;@" *D" B"ZCH" "ZC:L" *Ҁ9P" *ǀT"   8)X "ZC7\" *򣀔6`" *򘀔d"5!#+}! h20#KC l20#KCp20 #KCt20+(#00 +^ #0F 0+V@B! a *(";-#:*8I"\+8@C 08#K+##!F"FB$є03 +@@ "H"H"J\+F");+####r2C1[BK HS" FJ H`1/@ @ @G@@@@@f@@[@3f@D@@B@p %% NF"J2*L?0( " H5G2*@?DH8@h@ކ@!KL #`K*`ЊBљJ"`"`(#h#3#s#`FF #*8,OO3*ܠ"$O ":`D") F!NM2`JL`"Y*`J `{##`0J#J`J`-#J`J`J`J`#"3# WFzHFwHyA * sK@rK"OAOPhG/0F +OriKFAhG0+Ł +dJ"Ɓ#!aJ`aJ 3+BT03XIYH.;h3WIUH'3h3TIRH +h3RINH#h3OIKH03LIGH 7Kh3IICH4Kh3FI?H1Kh3CI;H.Kh3@I7H+Kh3=I3H(Kh3:I/H(L#h8I+Hh6I(Hch4I%H#k2I"Hj0IHh+]-IHX^3@@0@@@@|@@x@@t@p@l@h@d@`@\@.@R@t@p@@t@}@@Ň@χ@Շ@@@@@@@,@9@S@f@x@@@ciIHT#jIHNKhIHGKhIH@#L#`BЀ'KNhMPF3`'`5+h@񈁀K`#s7({zHO -yF sH $rMsOᲙBXpH3y>nLi GF!kHchO1A@GgH"chO1ApG_H"O1APchGXHRAO _BDMH+ɭ * 02 2DJR *?JR#00O3@B@B:OrF0APGO"0FOPG"!AP0G nF/yF%B&?%"3FF  F(@@  6B#h30+A+5緈@}@ш@@@@@ @D@@p@@@r@;@t@@@<@@#hF)F3F#hF)F_3FP#hF)F3F#hF)FT3wF"#h)FF3lFX#hF)FU3bF(?fpPFFH~+hZ"KF`F#`B `PHk! #h'3F+h"}K `|HV#O #`BU/n##`+h"qK`sKh_(+h"kK`nKh;kKhV# @#BQ S(x#O`O*hB#`xO"ZK`\Kh\Kh+@#V Bo(@+h@"NK`(PH+h ~ !hKH #h3! #h3#`Bؐ#F"O FB"y;KBBO1hBAPGD `5AS"FOCF(/H.H  C3S-(#h3vFCFF B#KHBhO1APB@GH3yyAS"FOCFP(?lHHlH3%@p@?@Z@@@L@@t@@ى@@$@# '3N*hB#`"# '/N*hB#`'##` "*K`L(+hX" "#K `Jر!HR 7` !hH%#h3 7` !hH#h3+h"K`H+h " K` H+h"K`Hp@@z@@@@;@#Т0B#LM0B#LM0B#LM0B "$MNFA@h@2pG2x!A@hGOrO1AhGNrhhhV 4G4,o%+F 3Q+*%+ ѻ@-Z0+σ +هJ"ЃKu_J3@3 P _CB$|I|Hg"#F&F##@;B40F7(@2B29Kh@"7KGM`ĕ#  F(@@8E I hsyFFDD 3* `h8@-M*YKhx!WKC"x$TOT=F #cC  x![CBrxFC#x C3:hCCcO2CsA0bF(d;hA0bC F(VO FAbXFF(I"FFshXFC+x #ABQF#PF#!F(JpOzpR+x O@CA0b!OC mFO2F A0bbF`"F ABXOzp'4,n #!AbFE(?]@@@<@ Ԇ-MF FFc-$FF%3xC "O YF S+ B J  EYF HEF@F K Jh[DB#  E(FF砆@@@@-AFFFFAQAR#F. FF! F F+xAC"F#F( H6+x@r;h!FF#AB(FǍ@-M FFFT{i#FAb9F FO@cA0b9FFF@S+3H(F p0B1F-H9F,Hı&p0;!'J;D( Bؚq03A6+B9F3 O3 *S<њ s@3H$04[D`F@@(@@-M8@ FT ddt |D@Q DFO:'#FFOR)F0FF OR)F0FCF.%F`F +O:ORYF FF8FK4B7FORYF pS+0C+KB  EF$}-M%")F U X dxF%!O6HK(FhHKC")FA8R KFxAH{q0+A.!3 OsF FF( 0"C% !3 #F /F(;h `3kD+D,5p0BT O#x=F 8 p0B 7"KhJ# /3h3q0+A[% 23h`3kD+D<[ @0C#F+FFb5?<T@<@@!3 #F F(*F@F O'F@@𵇰 FFFF"+F!FFgFO3OR!FF04 `F(?#-M# # F`xF!O3FAbmF(@#AbuF(@KhO 44xFOOp0Eҕq0C@̀"#FAFF(K&#$02F1F F[F 2FE[F# ? 'FpPINB$3 ~K~O}K|M zK {K p0B$xKuM ԁtKpNlOp0B%mNp@Bف#OFkIlOB@cK$#"#0!FF#F _K_K]MFXKpBO#SHB@H'ѻ ''DFp0BSFK!##"0F3F ODMBLp0E$@NG(0$q0A2]q0#A 43657 d,K!3+ O3HF(@q0 +x+r#:p+pB @B#8p+p3 x Bٲp Bڲ  Fp;<@@@@@@@@~@@@q0#A4363353$3733"F#F#FOF(@# +*x+;hT3""F#FF.F(@ـKhU3""F#FFF(@Āp ?##3pK#  F0[F G;!O3 lF(@r#*p p;h?}T3"F#F#FF(y;h?lU3j @B#(ppvKhT3"F#F#FF(UmKh3"*pD2xBٲBڲ2p F3pB5;#2q0+A53"0*+#x+MKh3KJR]"+FFFU"F(Fq A31(F F"0(kњ*4H" q0#A43567+K+K0x+ѸFO3!  F(rp# p#*p3p @*xB8F*p2xB(F2p;EѶq A՚ \3<@@@@~@@q0#A܀ 43 3 3 3 3* x* pKhT3"F#F#FF(;~Kh{U3"F#F#F|F('tKhi_3"F#F#FhF( p#pphJ "0 F3F O3!* F( x1#p xCpNKhD3 x"#FFF#F(î +?dQ3p33 2 p @3xBٲp 5xBڲ p F p3BѬ;3)J#q0C 3 45!K0 KCD O3!2 7F(` x+ ##p;p 6B @"x;pB8F"p*xB(F*p"K <@@@~@@q0#A''KM KxȂ)KF!H t!K h)pH H1pU7/46p0BӧKh55xFOO&"s#FCFF6@6 .їp0Eٚ0@$Nh X 9!H ]0x )p5qP%AKg  Kh#H)FY3h3D"FF#FF( 7Bxxs2h[u2YF#FZFF(vxxYFs[3hZF3#FF(^YM3h\T3YFZF#FF(J3hYF\U3ZF#FF(9433p0Bj=O=h5AxF&Op0E Җq0C 3h1IT5/K"S(0F#FCFL(;h2Z3"F#F#F;F(欚0 O3AbF(֬O3!AOs F(ǬK]HABAA3~@V@@@@@@@<@@@B@@@0TT @-M$e LKFh)mќKAR K\FȹoFARF PFhOEF+FAR DF(5 FOCAR! F( #FAR# &F(O3FAR F(xKFARF F(њ0 D$,!FmHvlKhlKC"@#kO ;LLLLLDE@FOxp0B$Oxp0B𥂕q0#A46 Os! (@4#6 F (Ђ0#!A0F F(^ ?HOs>M!*F F(L#FFFQF5HO2F A0bxF(40[FFq@,A5!30FOsF&F)F H&F5p0B.7!KhKC"V3 # +F(0 H3kD+D,4F@@@@@@<@*@ԆB@W@#AR! F(ȮO3FAR F(O5FFA0b F(FFA0b F(}Kh30B#F0B!0mO5AbFF(| O@s!FF#F FABF(jA8RF F(_ F Fl5X+ @B OUKUMp0Ba3F7/53ue!OpC-A(BO`CF(%lF((OA(BF+_F(>Kh0P;KS"@d ̰kq0#A:h*""H3kD#D<"Y CF#FF4p0B03K "Fx3LF(ԭ BF10ʭ"ON;h!FF# AS"F+F(?!F Hk;hF#@$0$<@W@k@@@@ӎ@0!KhKC"O3!AbFF(#AbFF(u#A0b! F(gI~~[CB:hCcFA0b F(RF" i7O3!FA#F F(=mK:hB#CFC A4nF(*0T aK!F\_J[CcA<UF(OPcA! HF("FFtFN4Os8/! /(?I#OEORF "F(ެOCFAROC F(ϬOFFFOR F(F3FOR F( ##FARFF(OsFAR F(F+FAR F(%F+FA0(FF(NF+F2F(FF(v#FF(F{(?H#@@@?<h@?@#-M }KFx%$ F"O6p-3 ## F0%q@,A!&F#*FFX*F#Fб F+Ab)F(F .F(#)FAb6%F(Ф 0  gFFP! +Z! 1)+5PF10+F"!AH0F F8F(FC.5" T#)FF1F(m F 3 T#F+FYF(]U#F)FF(S F 3 U#F+F?F(CK6 ^Up05BV5o 0 Y"P3)FFF(#  2*(" +FFF F(7BяA@@}@@-MFF# FF.%F.F  ;x3ARFAF0FF\@ @\@1FCFF6B"F-MF0F ]Kx+@c+x@_$ 'FkCSO #FZFFXFF(UBJSFZFFXFF(E@m3O F ZFFXFpF@m3FZFFXFaF8#FFZFXFUFعO FF ZFXFHFpFFZFXF;F(l F q0C   p0EF#"#FFF(?hw#4#O #ZFFFF(##ZFF#F(о@@q0#AD#Z0HCp0B/@0Axd@#ARF(#F(L3h+@!iKABFhK F(;"eKFxABF(-#ABFF(" " XK_ S Khm)F+kѺwٺwٺ wFFxF9F 8OC!ABFF(p0B\$O  ##Ff,@kOC!ABFr##AbF F(?#9OsARFFuF(?^ٺ I@@H FI@@I| G0PLP0Jpq0#A#0C4@B@} @W@m";O#OFAB#F(4,osh+t!ed!KF pCARF(2O`cARF #F(%@f#FARF# F(nKJBJAOa0BFARF( 0\  CO Dp$ #CQCSOpbCSC C!JFA(BF2C#OrCqA|BFp$AB#FF(#FAB!F!KA$BF@wrF(3h+@N"!hFA$B`F(n,JTBTA#!ABFLF(} xC(8 9F8 8Os!A,BF3F(dOCA,BFOC%F(VOSA,BFOsF(HRKARFPK F(<0#ARF F(0 Ob[ FA$BF(O3FABO F(+x<%FFЀp0B!h#y!CFORF(sh+@##ABFFF(ެ"KFxABF(Ь&F3FOR!0FF(+x@OS"F!F3FK(!F H4Fk@k@w?< @@T@\0J" ABQF(.  AB@F( AB3(?!  F@FAB!4rFFOOcA$BFFF(?BDFF >p0E<$q0CO#F!H3*TBBF!FHZ$#FFq0+A "y;}BѢhiB)F@FB57'FFp0Bq0#Ah+ ###"FFF+i+ ,("""FF 45q03AD3X0HCp0BG#Ab! yKh+?KHS"e&F'FF;xFl@@@@@B-M̂@F|xNF #" 0 F# Kh;xO @##`;nB@߀e`d0$Rp0Bـ+@ -@FA(R)FF(@O#ABF@FF(@р#FA(R@FF(@ŀ-̀#A(R! F(@A(S#FFxHFwK[i!*FFGAxc@Atco#FF#H#OHORF HF("Bp!FCFOR 7F(F*F dKh;W%HR##A(RF F(A(SFF#}H@sAB!# F(ڮACFF#qHj##A(RF F(%F+FAB(FF(OO p H Ot FCFAR(FF(O8 F;FAR(FF(r66F6ZFIJ3F(FA(BF#F(qFZ3C#Or(FCqA|BF(\#FAB(FvF(PFCFAR(FiF(CSF:F! uF(9F;FAR(FRF(,[#Ab!(FDF($Oc!0RF#FFF( #"0RF#FFF(?@@@@B@ϐ@0!Ft! FoF(7!FF,Fx  #"F F5X 0-*"@F"FDF(?"/"""FFo F/F(5!FFF(r-)@FF"FF(""9)@H @-MxFO \Fp0BDLEM!CH"+hD# 2x>Kh;KS! R FqP%A_0"F!F3vF( F/(K 0F3F#FF(0!F3PF( F 003FF#FqF(0!F3.F( F("F!HhF4t"+h<@@@@;@@-MFKFh xO3!AbFF(@#AbFF(@𵀛Kh,_3 @# ۲0#F9p`O<<DزBC؍KhKhBH Jo+## O #WFJ B!0p0_B'#{J B!00 O3!AbFXF(Q>FO3 #qABT P32 F]*F+F0# p0SE7q`F `!OF#RFnFhRF#`F F0F P BF$P! S!1)  0FF/J BE(BFҲ *ID 0B8Fز+K h33 K 0+#"9$ $x`3+K 0+H CB SDB(ЅBЕB(*"K @<@<@2@(@t@p@@@@q`.A-:K[]+9K DZ]8Khk;B 5K D[];+#.IKUB,@#)K[]* C*F!)H7F  #KD^]"K)FD[]X_x 0"3FN  6@@"C0F3F+FpF( F F+FbF(<@2@@(@R@<@K @ -MM+h+e F`!HG!HC%(F$k"O#fK`FxxD#;`l";hC"xne0am+K\e0d0+K\d0KK "KFKHK!K K#KJ` FH#+`#"#3F(F{H"yKzN`zK3`zK`**wJ2`"`(3hO#3#s3`pKh2"`nKh2"`"kK`l"kK`kKp;hDiK"n`iK2_DC +fJ٣ (dH@B+%+,#" +Q#m@m@s@s@w@%@{@%@m@%@%@%@s@w@#`u## ##q0 OBFFORFF?Hiq0F +$Дq0vOs!ARFFO#ORFF#ARFFF(X Os!AFF()F#H.@f@@0@@h@Wj@ c@b@!c@b@<@@%c@m@@@@.@@|@^34@0@@@@@@@8@(@@ +#!NJ3` 3+B)n#M+`B#L+`"h@"2#3`(H$pMxF O00p E'O? O #"FFcF(M@  7B+h3q B")hCFFFCFp*hCF F2F5F CF*hF 2F%F CF*hF 2FF(,lx SH%RNRO鲙BOHxNMKi GF!JHO6!ABFaF(@BH")F(FArMF(@8H")F(FAR9F(@.HRApB$H%+F 3Q+*%+ ,w-uYq0@vOs#ARFFF(?FFH#hZ%# 3`H@@@<@|@@k@x@@r@;@<@@@c@?@#'"hB+`M#+`#3`Kh(#h#3`KhCKhKS" @#B>6(j#'"hB+`lO #3`KhKh3KS @#Bb!(@#h@#3`(xHq7` )htHh+h3mF#O FB&xO2CC!AR CdFD `2AS:F9FOC8F ([H[H1  C2Q7`K(+h3*FoRFF#E&O3JCAR! C@%FFH;xASRFQFOCPF(?v=H=HJ 2# '"hB+`"# '"hB+`(#+` #l"3`.Khn(#h[ #3`Vر&HP 7`1)h"HI+h3 7`$)hH<+h3#h#3`H#h-#l"3`Khn+H8@4@@L@@@ى@@$@0@@z@@@@#0BZ#LM0BQ#LM0BX#LM0B_%!+FAB(FVF("KFx(FABGF(O3FAOs(F8F(3&Mh! #*F(> ztKh@"rKtM`ĕ#EFrF(@kI h kKh "`0 `%FfKgNgKgKgOp0B:eKpOp0$ &#$`M+`,`]Kx,[6.ћ0 $SKQNWKOMQKp0B 3 CE +ٛ0@y%q[[[#[CK#P; +#3p46"F5p!F#FpF#C##F(1H] +"#!FF(p0%s$OzsOBқq *AJR]* R]8ZC1F vOzs8574D,;<@|@@@4T@x?@t@p@*@@%@ @@@@@ @[@q0#A>2x*;ЧK3Br*L)x):"I2p x2B8F p"F/x!F#F(k$W # C#F##FA(W4363531) F(")!1pҲ p*p*уB8F+xYpxB #tJ3px3p)pB#nJ3px3p#)x3p;pFp9)p!F#F()x$Q #*"F!F#F($ xQ # C#F#F(Ѯ#GJ3px3ppq0+A5p0B">Kd>K `>K `03"#)FFY(Ц#h#+`51H03#h#+`*H03#h # +`#Ho030Fh8Feq05PHZHWO `QF@F  M HGO DQF@F  = @@@@t@p@r@@Ջ@z@܌@ߌ@@9FH#O      #&{C3 {; uHq03A6.3:" `1FFgHD"SF1FF`HCO3!A8RF7F(@1F@# F l@AJH*F 1F(FVEH?*F1F(FH>H#*F1F(F:7Hz)F4Hv3Hsİ" 1FF"XF?5a -(H\% ` "1FF@F?5G -%HA \P "1FF @F?5, -.%F! H$)F HF +~ۯr@;@@ @@@܌@&@A@L"hOAAPGh" !APGOBhFAPGh"OAOPGOBhFOPGh" !APGO2APFhG t@8FJ DCB4,M\P.F;i\I%xF0+Sx\D 3۲x+$ J?\D D 3۲9+Կ0;W;B8 $0BO0g@-MFFUKS'#KYFS: 0H+F$KFj8FPGFXFFH@0 :Br =p#C+۲C+pcCC-1F C0 :O8pb*COH=MC@BhO1A@G1F 80 xJ\(A@#<䲣@زC_#<䲣@L ز (O0 C("FaIbHV%,S$-@-@-@y@1@u@7@5@5@5@5@5@5@5@5@@7@@@@@@@@@@@@@@@@@@@@@@8H7-?#2IF1FF<1ݲ%t]@ CL]@3"C+Ҳ "@@-A-?O0 CKEx+?+HO0#<䲣@زDCC @@@`L@K+Op < @@f@S@UU+H O0O0Op-MFF F= #F&w&M;zBRFhMO1A8`G 0*_@BYF FQO1FhA`GYF FFO1FhA`G2FO1A`hG6OK _YF F.  FO1A`hG_t@-AFF #cCx\RBCkxB"x7OB20BBbO1hBrFA0`G A0`h,IBG"h!A`G Fihf ( OBA0`FhG$43y"!A@hG"HFOzpF(OBO@AA0`hG"FO1A0`hG F("F!A@hGOzp F @t@ ԆYKhyy" KFA`hG$,$ F4Z, !KC"p@t@@-EFF)0 +%%F$ T4,J  ,F <FK(h#VF KS'P#FSKV{0|@,B1BQ!F @W@-A!F >O!:h F(O("rB;h"!FF! F(r;h-;h:;h"!FF ".%q%qA;h!F!Fvo FS(.0!qAF!Fa! F?(ѐ6!qAF!FO! F-(~ @-M FRyFODF?OE >L?Ms;K"h"%OCDwB#.F0+A5\DF TEKO1[h0G+OkDS<њ KG$04D`t@@@(@@@-MFF#,&F5FO@,A!'L0 GR%0B K7B)F HF$ K Jh+DB#@5B@Ft@@B@p@@-MF FZM"OQhFOPGBp=OROPFhG1F hGF(@𔀂FO WE0d'OhO !0:FF#}F(v#0:F#F#nF(g7/5OFhO@AAPGW&d J9hFOzsXCO@BAPFhGAtco#!FF <#Hzh"OAOPGBpOBOPFhG'A   Ob#FRF Fx#0F#RFF F( Ft@D@@-M FFFFF`` BF09F@hG+y+y AC"F#F H 1h[4 A@B"0@qGP@t@Ǎ@-M$"!F D  FyF!KLhKA8PC"O1ch GO1A5FlB.6!XKhXKC"xH!30FOsFH+F! LHFF5IK [h!0G0 H3kD+D,"APFhGO2APFhG"O1A0`hGh"O1A0`G/Kh30B`#0B#yF"  )KO1A`h G(@ yKhKS"@ \0+A H2jD*D,3Q B ")FF!5B03%Ԇ@ @p@@@t@#ydM!bKA`haKC"O1kh G"A`FhG,"A0`FhG3 UN001hRBCBbA0`hPIG Yk"O1AhG1hJJhBA4HIG#y0A<CJCIR# hRBb GOPb6OFhAGFF F N5Or:FhGUEO %MEhO"MEh"OAOPGOBOAAPhG"OAOPhGOBOPFhG" !APhGOrAPFhGOBAPFhG (?e H t@p@@ @0?<<@@?@ tF5"FOFOPhG,y"OSFF#F!HN$ FADAXH CB*"A`FhGFF t@T@sFNF3h3H#y K)Fh)F0h#"?DFFp@@D@@-MXX0F FKFS$0`y#+y#>#" 0 J# Kh]p@@D@ @#0 0B@ 0O  WE@(O+"!A`hGh,@*"O!A(PG"!A@hG"A(PFhGܹ"FOqAthG"FOqAhG"FOqAhG"FOqAhG"tFA(P0GA(S!#FFH\.䁲WBWA [( 0 FG(0@ف"OpqA@G'N!A@hG!"FFsiGKOpa 0A(PhG{KOA\A(P hGvHFuHuK0sJ \O!A(PhGToO:hAt Ch@f!G:hA Ch@f!G:hA Ch@f!G:hA Ch@f!GQN"OQhOPGBp(OROPFhGh!F GF(@"Of'E@O@M"O@AAPhGFKh\Fd XOzsXCO@BAPFhGAtc!o#FFN7H"OAhOPGBpOBhFOPG!F +KhK,0 H?L"!A(PhGA(S"F#FHU"@qA@hGAC"F#FHAL"!A(PhG"A@t@j@k@k@@BMb@|@@D@@@@ϐ@FhGkNpC*Ft!APhG 2hAPBOahGA(@ 3  O KK;SK2hVIK"G2;B"OqA|@hBG"A@FhG #*F !t# F@2hOc!:C F+?ڭ"A`FhG *9HZFFDF84H#F @F(ڭ.H.JR#,JR#00C O XC  "G'OprA@FG&0A3)0#FFF("* F"F(УOzp@@Bކ@@<@@!APG03"OqAPhGA@h5J6IG6K!xA@hG"A@FhG ('"O1OPhG#B"&M##FC:@;B>".hm  @A@G6JJ A\C3x@t@p@l@h@d@`@\@t@D@@ }@ !:"h@@A@G '0Jh @A@Gh@A@GFA@hGOAA@G`.(pKAP]`p Cht!GHFHK0J \O`aAPhRGKAPhKhh C@f!GKJ]0hCBCABBAPOahGx 7B OL p,B  YBR? pcBRC CA(@hrIGrsB"OqA|@hBG"A@FhG"hFA@G K (򝀫h`JaIA$@G !A$@hG *𔀑JBJA!A@hGOBOAA,@hGOrOQA,@hGAPhKJLIG0!APch G OaR A$@hGCJO1A@hhG ( ObA@FhG"OAA`hG0) x(@sF4#FFBh-Kh!OPG0+@'L"!A@hG%K!xA@hG"KhK!KHS"!7FIJh( FI[DB"hl@k@@BMb@|@@k@@< ?@t@@@D@w```Ah!z-BA*CHB OHB@ HB34u F%FF-OB"zh,KBhf0+A ՘0Bh0B)F8F5 Fx$FFOO B?J0#A3i+ #"FFFRsi+ TOr"!F F"C46#y׬F@t@-MgFTF+F ^F)FuHMYFsHF"ȱF0A`GoKA0`hlIBGO  QhPFcK.@!PxhOFl| @LcxCDCBRXLB"B2A0`XIhG.!`!O@B"A ChO1GPJ+O`2A4hMIB|RGz;#B"BboxAA<hBGhOqAG+:Kh6. _22B"O1AhBBG&B)&B/%BEOzp (D [ O1`A0`"h MG Fx228"OqhG603A6 3' '?OrhF: GOrF0hG5#@(@t@ @ 3?(?#-M# # FF FFy  գMO1A`khG"A`FhGKhOO 55$FyF&Eз03A@Ѐ*F!0F(ÀK&#%1F(F2F[F}E[F#  ? &O{I|O E@#F3 uKsK$tKЁqKoOFoM B@%nK jKeOcN B@&cM B@ȁ#'FbJcMcN B@YK$#"#!FF#FWK VKUMFOK B@ځO#KI B@0$KN B@x@4 jF+y$OGF%"AFF+05 -FE y} 2JB&06% 0Au 3 R 0#A4657  ZKDK< O1[hDG " y)x)љ !)p B @B!t@ @@@@@~@y@G@t@o@@K:xBٲBڲ:p F p"K 0+AY5373  33U3d3 @B#p"K h T3")FFBF(@𡀚Kh33" D:xBٲBڲ:p F4pBJѧ; yx+3hT3"")FFF(`zKhU3"")FFF(Op ?##;poK# "F!F[FdK[hO1 Grh# p3h?[T3")FFF3h?oU3")FFF(?- F 03A6+3 yի]+?Kh3?J1F]"FyF( A32 yF!TT1) 0#A43567'K 'K yx+ѧK[hO1Grp# p#*p3p @*x ;B8F*p2xB(FE2pѿ A y\3 @@t@y@G@@ O O EF B'јK!#"#F;FML CE? 0Cր345 0+A? 53 3 3 333A3P3_ x2 p @3xBٲp4xBڲp Fp Bam;3zdK y x+# p^KhT3")FFfF(ŮUKhU3")FFUF(MKh_3")FFDF(p#p!Fp(F1g  :K h2Y F !CF(s 0 2*(" 3!FF<F(^ 7B- $K5U4BsK2h! F T2F(A 3h 2!F T3FF(22h F U2F(' 3h 2!F U3FF( @ @t@}@@@-MF / KFh y ՘LO1A`chG"A`FhGKhB3 @#۲ 0 "FIH NDD ӲB+؅KhKhB1Jo+##P @0PqKO1A`hGG3 #@A <`1)  pFh HF0J  D]B(3F۲U,J D]B8FȲU.JhB4䲣B'F3>?.&@> J]*"!8kfxVp2*K]+N1UBB ZDB(ЂEКE(+" K U# JB!0pp@t@ @@@@X@T@@@@&#F4F@J B!0 ;P%A.;K]+:K  D]8Khk;B 6K D];+#/I UBػ @# )K]*ٛ"F!)H.F4䲜BF&#J B!05FK D]K!D]PF WO :h2 5@QF@"C;hF3F(ݮ FQF F(@@@@@R@ @ @ -MFDBѣOQF)8!;hY F,aХB1h$-,F(Fh.FK8B%0,Bu0OS 0Z0,4F+"Ѹh|"AF G@# wJ``;h@F;h`3Dh ##;h3D3(F`B0Yh(+Ѹ 0F;"AF0G(0@F[Db`0[Dh+0[D3`s0F0S 0+}+$ 0B,4F;h$Q;h4;hh`@F.`=h%Dkh+Ыh+лh3`'8Knhhpp25Hs3K`1F1HK P D-b"AF0G([!0`O2Q0D0HF1F(((НOYF8FuF|(ٝOYF8FdXKS 03C`YF HYF H 焙@@@@@@l@l@#@B-M # F3 D0pFHF+ؐp0#! "H% /F۲ O +F  "  F+F3x " !F#W(-jF аFp0_[E^.%O tK*F3 )F^(F  +Fp0겓BO% BF AF@F+FFFp0B{q0APkD O FH   E6%CFjq0C BO' PkD,!FZF;F F(<ZF;F(/hȲx +B( ؊ PkDC 7/'Nq0APkD#FK3B5Z!F  (! F[F (?l@i@@& FFb#7F#` p B ӟB##hc#`q 2A2"hC" @"`6F8NF3h3Kh3Hn#xգm)F+ K0hh KF)Fh#"? DFF@p@@@@-MF FFl# #\JOhXmT*FKHS$/F_@/@6@/ApsA2 FB8FALSB8F@ @ @HG!F8FT{B@@ @ @HHCF!FGK!FS*0F|FB:!FC n!FC ;!FF ;!F  COzp}K!F30XCF 8#C cCB!F8FFD:@:CB B "B2o@B BB rBc)FAB0F(v#A B)F0F(jOsA B)F0F(_OcA B)F0F(TOxCA B)FOS0F(GO"OH#@)FA B0FFȻO`)F0FA BxOrc)FA B0FSO@B# )FA B0FOSA B)FOS0FPO@CA B)FOC0FxA]3AprA]3BsI|'HGHHI| H@Hٺ ٺ HHCF!FjFI| H@HW@@@BV@f@_-XЌͲLМ_/-6/->/-_>O/@XРРu440 S۷PР 8/@@@S@F=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG-@:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡK<_ pGJK(FF@@K_pG0P<0[ J7_C]_7P,_PC`K4_O  pGK$_#@@@  pGpFF(F FF0F&KF$_3"@C+#".OcsC#@_#HV)FHHO pOcOSOS HA)F H H:#Os #`&m@$u@;@m@-E$F%FOtO 3B!(F@I; @JCC_G5 kC @_H50 C?,O@D5-ѿ_ KLPFЀ-MpH!oHPnHnK6_*X(gJ4C4bKB_T`IaH*$_J9C9\J8C8UJ_VK @C[3C$_5_D_NKLy_3@@3*FFHNS _BB O3 O F3*O`b; OB _K "_K _K4+Ѡ#)#+# # FVF8I(H FPF$KU+_C+BI H FH J2_CS_28RIHIތ@$u@;@Gm@Lm@ЀDHЈe@tm@@Гm@m@n@ Q/b:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/Q ; aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P-PA/P-PA/-v@@!@&@ x@@@@ᆳᆳᆳᆳᆳ        p  @@                                             0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-                                8(H@Ė@ϖ@{@1@@ @@@@_@C@@h@@h@)@h@@@h@@@6@) @E@+@?@S@k@,@*@+@`@h@q@@@g@A@Y.@@@!@4800T $go048<4800T $go048<0:+E3:).4:'+05)-(2V6-(+{/"3@e)@y)@@Á@܁@ @ǂ@ӂ@߂@@@@@&@&@Zn^MM *XX4 @  J+@1@7@=@C@I@O@U@[@b@i@p@w@@@@@@@z@0:+E3:).4:'+05)-(2V6-(+{/"3@@7@ @U@      @ %2%5 %6%7 %8%9%:a& `%9#a( a& `%:a•:`%;a%<a a a$ A(”<…;…:†:…9„<€;;:„:€99ƒ9„98„87„7M@`M`M`@M`@ M`@ M`@ M`@ M`@ O`@!M` @  M`@ M@`@ M`@ @@ a@@!`a`a`a4*`H4*`H4*`4+`H4+`H4+`4+@    @000 ` a0@@P`@@a` a`@ap ap@a@aa0`apa`apaa`apaqa` a a@ a@!ap!ap"aP@a@ a@@a@a@a@aaaqa"a  4 @*T` 44@@JJTT` ` 4  **` 44@@@JJTT` ` Zn^ __of_translate_addressddr3_ctrl_get_junc_temphws_ref_clock_sethws_is_serdes_activesys_env_model_getddr3_ctrl_get_junc_temppattern_table_get_wordmv_ddr_rl_dqs_bursthws_update_serdes_phy_selectorshws_serdes_get_max_lanesys_env_unit_max_num_getis_prfa_donemv_ddr_is_training_donemv_ddr_is_odpg_donehws_serdes_xaui_topology_verifyhws_serdes_topology_verify(((((AAAAAABBBBBB                                                                                bootcmd=run distro_bootcmdbootdelay=3baudrate=115200ethprime=eth2loadaddr=0x800000arch=armcpu=armv7board=turris_omniaboard_name=turris_omniavendor=CZ.NICsoc=mvebuusb_ignorelist=mtdids=mtdparts=arocsdxbimmv_ddr: 14.0.0Error: Wrong device size of Cs: Error: Wrong Memory size of Cs: DDR3%s Training Sequence - 2nd boot - Skip %s Training Sequence - FAILED %s Training Sequence - Switching XBAR Window to FastPath Window ddr3_fast_path_dynamic_cs_size_config FAILED %s Training Sequence - Ended Successfully RE is too long (code overflow)RE is too long (data overflow)Jump offset is too bigclock-frequencyu-boot,i2c-offset-lenregspi-max-frequencyu-boot,i2c-transaction-bytesreg-offsetreg-shiftreg-io-width### ERROR ### Please RESET the board ### No closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\/aliaseslinux,phandle#address-cells#size-cellscell-indexu-boot,i2c-slave-addrspi-cpolspi-cphaspi-cs-highspi-3wirespi-half-duplexspi-tx-bus-widthspi-rx-bus-widthCould not read count from timer (err %d) resetting ... ngpiosmvebu%d_NONEDetected Device ID %s %s: Device ID Error, using 4 SerDes lanes %s: Error: Lane#4 on Device 6810 is not Active. mv_seq_exec_ext:Error: SerDes lane %d is not valid %s: SerDes lane #%d is not Active %s: Error: ref_clock %d for SerDes lane #%d, type %d is not supported hws_ref_clock_set: ref clock is not valid for serdes type %d hws_ref_clock_set: not supported serdes type board SerDes lanes topology details: | Lane # | Speed | Type | -------------------------------- | | | Returning to BootROM (return address 0x%08x)... alloc space exhausted cyclic function %s took too long: %lldus vs %dus max poll_op_execute: TIMEOUT ## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" unknown cmd (%d) at %d ^%s$Error compiling regex: %s %s: %s: error: gpio %s%d not reserved %s %s: Invalid cs %d (err=%d) udevice *)(NULL*** spi_xfer: Time out during SPI transfer %s: TSEN not ready error: %s: polling timeout A38x does not support interface 0x%x i2c@11000->i2cmux@70->i2c@0Cannot get I2C bus %s: uclass_get_device_by_name failed: %i generic_%xi2c_generic_chip_drvCannot get %s I2C chip: i2c_get_chip failed: %i MCUomnia_mcu_read failed: %i, reset status unknown! EEPROMcannot read EEPROM: %d bad EEPROM magic number (%08x, should be %08x) firstbad %s EEPROM CRC (stored %08x, computed %08x) secondMemory config from EEPROM read failed! Falling back to default 1 GiB! 1333HUnsupported value %s for DDR3 speed in EEPROM! Fixing up DDR3 speed to %s as requested by reset button Fixing up DDR3 speed (EEPROM defines %s) malloc() failedInvalid bus %d (err=%d) %s %s: Invalid chip select %d:%d (err=%d) spi_flash_probe_bus_cs() failedspi_flash_read() failedbad CRCCannot import environment: errno = %d import failedi2c-parentstatusokayMissing DTB root_driverspl_init() failed: %d /chosenstdout-pathconsoleNo serial driver found U-Boot SPL 2024.10-OpenWrt-r29197-ab4c7d6af7 (May 27 2026 - 15:55:08 +0000) High speed PHY - Version: 2.0hws_serdes_seq_db_init: serdes revision number is not supported hws_serdes_seq_init: Error: Serdes initialization fail hws_ctrl_high_speed_serdes_phy_config: Error: Serdes initialization fail omnia_msata_slotMiniPCIe/mSATA card detection... pcieforced to MiniPCIe via env sataforced to mSATA via env autounsupported env value '%s', fallback to... omnia_mcu_read failed: %i, defaulting to MiniPCIe card none mSATA MiniPCIe omnia_wwan_slotWWAN slot configuration... usb3USB3.0 PCIe+USB2.0 Error: too many serdes lanes specified by board LAST_SERDES_TYPE%s: Warning: Wrong serdes type %s serdes#%d %s: Error: Wrong unit type (%u) %s: Error retrieving device ID (%x), using default ID = %x %s: Error: serdes lane %d is configured to type %s: type already in use %s: Warning: serdes lane %d is set to type %s. %s: Maximum supported lanes are already set to this type (limit = %d) %s: Warning: serdes lane %d type is %s: current device support only %d units of this type. %s: SerDes lane #%d is disabled %s: Warning: SerDes lane #%d and type %d are not supported together %s: Warning: wrong number of lanes is set to XAUI - %d %s: XAUI has to be defined on 4 lanes %s: Warning: wrong number of lanes is set to RXAUI - %d %s: RXAUI has to be defined on 2 lanes hws_power_up_serdes_lanes: unsupported ref clock serdes_power_up_ctrl: serdes type %d and speed %d are not supported together High speed PHY - Ended Successfully ddr3 init failed: %d done Enabling A385 watchdog with %u minutes timeout... Disabling MCU watchdog... omnia_mcu_write failed: %i Initializing LAN eth switch... Trying to boot from %s SPL: Unsupported Boot Device! ERROR: Invalid data checksum in kwbimage SPL: failed to boot from all boot devices ranges->i2c_mux_bus_drvreset-gpios#gpio-cells%s.%sset_dir_flagsset_valueSF: Failed to set up slave spi-flash%s %s: Macronix Quad bit not set enabling reset hack; may not recover from unexpected reboots %s %s: Cannot set speed (err=%d) %s %s: Cannot set mode (err=%d) spi_flashjedec_spi_norSPI probe failed. /configu-boot,spl-payload-offsetERROR: Invalid kwbimage v1 ERROR: Wrong blockid (0x%x) in SPI kwbimage ERROR: Wrong srcaddr (0x%08x) in kwbimage ERROR: Wrong blocksize (0x%08x) in kwbimage U-Bootmarvell,orion-timermarvell,armada-370-timermarvell,armada-xp-timerorion_timermarvell,orion-spimarvell,armada-375-spimarvell,armada-380-spimarvell,armada-xp-spimvebu_spins16550ns16550aingenic,jz4780-uartnvidia,tegra20-uartsnps,dw-apb-uartns16550_serialjedec,spi-nornxp,pca9543nxp,pca9544nxp,pca9546nxp,pca9547nxp,pca9548nxp,pca9646nxp,pca9847pca954xi2c_muxmarvell,mv64xxx-i2cmarvell,mv78230-i2callwinner,sun4i-a10-i2callwinner,sun6i-a31-i2ci2c_mvtwsiatmel,atsha204atmel,atsha204amarvell,orion-gpiogpio_mvebusimple_busmiscblkSPIFlashSPIBOOTROM/clocks/firmware/reserved-memory6810682068116828PCIe0PCIe1PCIe2PCIe3SATA0SATA1SATA2SATA3SGMII0SGMII1SGMII2QSGMIIUSB3 HOST0USB3 HOST1USB3 DEVICESGMII3RXAUIDEFAULT SERDESDDR Training Sequence - Start scrubbing DDR3 Training Sequence - End scrubbing %s %s Warning: Unsupported freq mode for 333Mhz configured(%d) Warning: Unsupported freq mode for 400Mhz configured(%d) Warning: Unsupported freq mode for 533Mhz configured(%d) Warning: Unsupported freq mode for 667Mhz configured(%d) Warning: Unsupported freq mode for 800Mhz configured(%d) mv_ddr: unsupported dram device type found mv_ddr: negative timing data found mv_ddr: unsupported dram module type found mv_ddr: unsupported cas write latency value found mv_ddr: unsupported cas latency value found mv_ddr: failed to update topology DDR3 init controller - FAILED 0x%x DDR3 init_sequence - FAILED 0x%x ck_delayError: %s is not initialized (Algo Components Validation) phy_reg3_valg_rtt_nomg_dicg_zpri_datag_znri_datag_zpri_ctrlg_znri_ctrlg_zpodt_datag_znodt_datag_zpodt_ctrlg_znodt_ctrltip_dunit_mux_select_funcmv_ddr_dunit_writemv_ddr_dunit_readmv_ddr_phy_writemv_ddr_phy_readtip_get_freq_config_info_functip_set_freq_divider_functip_get_clock_ratiodq_map_tabledfs_low_freqhws_ddr3_tip_init_controller failure adll_calibration failure ddr3_tip_freq_set failure ddr3_tip_dynamic_write_leveling LF failure ddr3_tip_load_all_pattern_to_mem failure CS #%d polling failed for Old WL result ddr3_tip_dynamic_write_leveling failure polling failed for Old RL result ddr3_tip_dynamic_read_leveling failure ddr3_tip_dynamic_write_leveling_supp failure ddr3_tip_pbs_rx failure CS #%d ddr3_tip_pbs_tx failure CS #%d ddr3_tip_dynamic_write_leveling TF failure ddr3_tip_load_all_pattern_to_mem failure ddr3_tip_dynamic_read_leveling TF failure mv_ddr_rl_dqs_burst TF failure ddr3_tip_vref failure ddr3_tip_centralization_rx failure CS #%d ddr3_tip_dynamic_write_leveling_supp TF failure CS #%d ddr3_tip_centralization_tx failure CS #%d Title: I/F# , Tj, Calibration_n0, Calibration_p0, Calibration_n1, Calibration_p1, Calibration_n2, Calibration_p2,CS%d , VWTx, VWRx, WL_tot, WL_ADLL, WL_PH, RL_Tot, RL_ADLL, RL_PH, RL_Smp, Cen_tx, Cen_rx, Vref, DQVref, PBSTx-Pad%d,PBSRx-Pad%d,Data: %d,%d,%d,%d,%d,%d,******** DRAM initialization Failed (res 0x%x) ******** mv_ddr: completed successfully DDR3 Training Sequence - Ver TIP-1.29.Bist Activate: poll failure 2 max poll IF #%d write_mrs_cmd: Poll cmd failddr3_tip_read_training_result load_res = NULLpup_num %d not valid if_id %d not valid WL: DDR3 poll failed(3)WL: DDR3 poll (4) failed (Data: 0x%x) WL: IF %d BUS %d failed, reg 0x%x PBS failed for IF #%d dq_map_table not initialized RL: DDR3 poll failed(1) IF %d _read Leveling failed for IF %d Training Done Failed Training Result Failed ODPG disable failed _r_l: DDR3 poll failed(2) for bus %dSpecial: Pup lock fail, pat %d IF %d pup %d CS number is different per bus (IF %d BUS %d cs_num %d curr_cs_num %d) WARNING:Wrong configuration for pup #%d CS mask and CS mirroring for all pups should be the same polling failed IF %d Freq_set: DDR3 poll failed on SR entry Freq_set: DDR3 poll failed(1) Freq_set: DDR3 poll failed(2)Freq_set: DDR3 poll failed(3)Wl_supp_align_err_shift: unexpected phase WL Supp: IF %d bus_id %d Failed ! WL Supp: IF %d failed fail, IF %d pup %d DDR3 A38x silicon init - FAILED 0x%x DDR3 Pre silicon Config - FAILED 0x%x DDR3 silicon get target frequency - FAILED 0x%x DDR3 Post Init - FAILED 0x%x DDR3 Pre Algo Config - FAILED 0x%x Run_alg: tuning failed %d DDR3 run algorithm - FAILED 0x%x DDR3 Post Algo Config - FAILED 0x%x compatible%s %s: flash operation timed out env_buf [%u bytes] too small for value of "%s" not locked%s: cs %d, pass_lock_num %d, max_bus_num %d, init_pass_lock_num %d %s: subphy %d %s %s: timeout error: %s: unsupported pattern type [%d] found WL Supp: CS# %d: IF %d failed Freq_set: DDR3 poll failed(1)training done failed WLValues was changed from 0x%Xto 0x%Xodpg disable failed _r_l: DDR3 poll failed(2) for IF %d CS %d bus %dERROR: ck_delay is not initialized! wrong parameter train_cs_type %d edge_comp %d pattern %d direction %d search_dir %d control_element %d result_type %d pup_num %d pup_access_type %d if_id %d access_type %d .flagseth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' himport_r: can't insert "%s=%s" into hash table *** Warning - %s, using default environment ## Error: Environment import failed: errno = %d %s: Bad cell count for %s ERROR: One of ck_delay values not initialized!!! rootnopsimple-bussimple-mfdi2c_generici2c-chipspi_genericspi_generic_drv1066F1333H1600K RU3m ; F J R Z b j r z  N V ^ f n v ~                                         " & * . 2 6 : > B F J N R V      \  pt x |CP1\  pt x |C\  pt x |C@G?@Q@@2P@!@ P@'u@8LP@@6tP@@60Q@]@+@@XQ@Ā@r`Y@[@m@pY@V@qP@@{@ Q@@lpQ@@@$Q@@zV@q@W@@9W@iX@@@W@w@˃@m\P@@s߃@ ?@ @@M%@@ `@ۃ@@@2@A@MA@g@6W@ @ @@ږ@8#@9W@QA@]@փ@GYW@@L@@l@@˃@miW@ <@qYW@@@'@ @s@r@ց@z@ @ 8 ( Turris Omnia7!cznic,turris-omniamarvell,armada385marvell,armada380aliases ,/soc/internal-regs/serial@120004/soc/internal-regs/i2c@11000'9/soc/internal-regs/i2c@11000/i2cmux@70>/soc/spi@10600soc"!marvell,armada380-mbussimple-busCN`Pq    internal-regs !simple-busqi2c@11000+!marvell,mv78230-a0-i2cmarvell,mv64xxx-i2cx |okayi2cmux@70 !nxp,pca9547xpi2c@0xi2c@1xi2c@5xcrypto@64!atmel,atsha204axdserial@12000!!marvell,armada-38x-uartns16550ax |okaytimer@203001!marvell,armada-380-timermarvell,armada-xp-timerx0@0P   spi@10600)!marvell,armada-380-spimarvell,orion-spi xP|okaychosen /soc/internal-regs/serial@12000 #address-cells#size-cellsmodelcompatibleserial0i2c0i2c1spi0controllerpcie-mem-aperturepcie-io-aperturerangesregstatusreg-shiftreg-io-widthinterrupts-extendedcell-indexstdout-path` @ᆳ (OР iHMP  H4P  MOЍHM  H4P } OР iHM! H4P t HOР iHMp! H4P j OР iHM! H4P ` OР iHM0" H4P d hOР iHM" H4P >1)  8Oo/Oo   P!:0@" Р////@ Q/00////00S+ Q+ \& /A-P@ ` pV: \ : "& \*000C0@0/ /@- 0 xp@- `@P EoRU P @@oT RS   P0pxE-P@0 `R` T 0S0:00P긠pP  0P T 0S0#0%P ЍPPV0 0S%P T00PUTxRQ# PS 0@- ^ \ ^\PX@@TPL@ \!a2>2@0 //0 0  ///M-Pf̰@`0040p C@Q&"       04 8 P    B  B>Ѝ@-@ 2RQM-@00P0S,`pPᨀP"  "P0SX  ᲠZ B R  T 0  AЍ:AA @0SQM-  P R(`,@pPPl 00S 0f Z00T  0!HQIQ 0S0XV0P1p0 Z V 0&R @ Ѝ[ @  @@)@@00 V  R 0p 0R B `000 R V 0S :@-@PrT00ЍM-`@qQ4G1U: 1`M7 08LT W030#X0S0 CRS  R 0 0T0F0 C 0?? 0ttFP S :!  Q *  0$YZ,@\~0@P/ R/0@- R 0 R0#s01 # @0 PUS  B0d 00#s01R #0 p .~. p .~. %s: Unknown relocation type %llx %s: Relocation at %p is out of range (%lx) VarToFile0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-Das U-BootRUNTSERVdPՅlH((IBI SYSTdH$ UbEfiVa 0D0 00/@@-H 0)  800C80 80080 08 /$0! _ _//,00_ _//M-@P`q 00⃁ 0  00 000PW@0*0 !0_4?4_0Q P <0_0P P P//// E-MP@1P@@1@! RP1S @@11$_` $_'_`$PPN pp1h!D;_`0P;_T0p;_H0_@1D;oP 1_P;_p VTtpPPE U0\0:0)_  _)_{_[_ +_+$) $)}P _\0D+ _P+ _p+V , 4_7_4 0<@Ѝ`P|]x]t]0S/  0SR0///_0 _ _(/, _C%)!, _l  _d  _\  _P% __@_ _L_$ !_ D!/ "" 0UUU-7@- 00 80 1C4SP 00CP S#0//0 S0 Q00Cs0S0//0 R R/00P//P000//P00/i`00 000(S?C//P00/IP00/00 000S/%/P0000/ I0@-P @\*  0S*0P*SP: S*S0@ 2/ <Ͽ03?0@-@M B3@P8 <lb 00 0 8L <L0 @A4u,00 4$p 0$ (k0 00 d00 0 ]VnNz Z c0C0vVN@0 @01 0|>x1@P 11 0 C&T 1/MrJ|V P0@- N/ P0p@-@0P0 R p@U/MA-p0@/SP"M 0S00,o`l` V l#"ލH @P0 5/PW00N!N|Vs@-@P`]P  nP 0 Ѝp@Ѝp@-@崂 岂専宂嬂媂 娂$如(夂@衂p@-@P圂嚂`Pp@蓂@@`A-@0P0 Q Q ^#Q 0S S^0 Q  Q 0 000ЍR0 )0 )`,p熁Q P00 `, s@- P @`P00  A$Ѝp6N@-` Pp@T  8A ЍP HUNp@-t`P   p 00@ 0

OqOp@-@P=?0 00#0b0UO40U_ 0'p>?0_ @-0???Oo0??Oo//@01_  02_0 _ _00'/@-*@@-0 1016* 0???Oo|/p@- @ 04PB 0010S" 0000Q: 0 000 00CQU)b0E2  3 00 p 0p@@ )Pp/@-@B <00C<0/<_)7O@-@B <00C<0!<Q))O@-@B <00C<0<C)O@-@B <00C<0<5) O@-@B <00C<0<')O@-@B <00C<0<)O@-@qB q<00C<0< )O -P0_ @0P^ B2^ T0@-1M@_P$H_+&8TuPB , 8TP  7T> 8TI 7T #8TNKD@DTX134:H ,(8T; #8T,U U4T/ F8T = TU U ? T ދUڋ Ѝ0ЋU U U| tpF8T? T@= T P:PyPPPPePPoPP&P/PPPEPPPP[P@-@tP PdP X^@Ѝ_@P 4@ 010p]PPPP@@-< <@010CP # 00@p]Q40P A@ @  0 _S/@$PрP/M-`@P p_ _ 0 0 0TR*\ :0 S0R$S PUЍA-r@Pp `0_/A 0420 __V0r  __0 00_ P A0420 _ _00S`V E-@Ppq`p 0 ~P ( Ѝ0 'Q@-4@0S6$ P00l]@0@SQ@-@Pp,M `P"ADo4(0Q$0Q?P``PP00S` 24: _  _0 _U0,Ѝl]p@-@P`* $P 0 p@үpaQ@- @ P Ѝ00  P  P0000 s0M-鰱p0S7a ,PPU IЍhA0`F  $r "$. Ă  0$ (  PU0p P P( , $( r R00v@P PZ  'X p0 t T0 $0(0, 4 8<(i]X]ϹeQa]mQp@- @TP @0 PP p Q   `0V <`v < V0p 44 ( 0<0uQ|Q4AQQQQp@-x2HM"_"Q 6_S2(0CS@x *4P^ 0 "sPZ  @6'PR  .'r 1 0  PPP _U- U: TqPP% pP! d7 \P00Cs0S<  ,:0< 0D@0 P /HЍp JU 0 r`kpP ``RaQRSMWRlRvRRuQRRSS䦊8R-S~R9SFS@-\@WPH 0[P 0S0S3 Ѝ@yЍ{SS@-@ KP( EP lP @SSS@-`[PP@ @P 2P _&@Ѝp@P -@P '@P  K0 3?2/eQS@- MP  PS Ѝ@P P P P   0 00 0000001- PeQ 0r0s0S0/R/0/7@- P0 0 0 0 0 @P, Ѝ0@- @%0 000[ @-0R0SP  R3# S3PR SPS@-@,P  PM@-P |0,M00p@Ph@0@` 0p PMP P0 R0%3,ЍN|V@-0@P 0 çЍM-P`p(r@P \ AЍP @P(0 (ЍMT4TM-8MPX0S |p8Ѝ  @0`40S S S  PAa X0 0 00 PpA (pH`y@PH H $P A5p @00@D 0 (`,0S񟗉LUWWUWWWHVHVVWlWWWW0WDWXWWWWW 0`40S S0S P p{ AxpPjP Lp`P P 00p[]P ` +@x W=0S}p 0S $0S$}(0Sy(0840|,0<0l` @$0S6WXXTXTTXXXXX X|XHXXXX XA@pT P ~w@W X0 0 00 :pPG ApJTiTTc&TT@-PM\@`p P 008#ߍ : pTTUA-p` P@@5_PU0@oEX @`<0 R/p@-`@PP @1<@3?0^p03?00  PM-`@D0SЍ"0pS pZ$PUPZw 0 P @d X 04/ 0 0S PPPUrJUwgwu0Q/R/ 0M-(MX ` 0 SHpLPT@2 V~0S 8\t\\\\\@^`p V P T3:P0X 00  P0y&pV%(ЍP0 @r0P0P0!0 00 \1Q 0 4?s0% SP"P2 P% S P2P"000P R1 $(,R2PEPP  0SS010KZP@ZQ "0 P 0 H 0P @EP@0Z P G CPPxmU*eUaU{U{UU @- 20P  wN@- &P@ U $0R @-o/'VM-P@MM6 $tD0HPLPPPTP""D "00040S 80St1PP P M'ML ލЍQ &$Pn0S0 PPP v0P0X00%0`V0  P* M>`%$0PL T@5@  R  "$0C8⼻0`$PXP-u`,0 wPtqn 0 ,0 tⒻ|P0t0͵,0PU4 M+s!U4spptl [0  U M+ M Mt MfH_  PZPz  NPP@ UP<4#p 0 p$0#  P 0#$tZ 0P0 0S n$Q <0S  X@?o2P0SPJVX0L0P0@@SH8 P0M. 04DP0PS L0S1L0@P  PP$0Q D0  P $0SP0  0P 0p  h  0\!S q`}TB@t))0*Q`_YHY2/    0 Q0@ P0@P%|$ @?ىZZ[-$M 0 0<0@0 DH  0 r$ЍM-(MPgPY`hq``+{@TQK0 1{ @ .P nPc0@P`{@ p P ľT pT @ R@Z 0  @  0 ( (Ѝ[[[[/[)[M-@pPPG   T2@0Q 0S P PP"u!妀pPdpP= `PT~PP0$!PTP,]{ PЍ`S=`Foob`V ` ż0HP[   6ЍM0XfS  P l~PڠP P|y @>s03/,{wuR[x[w[_@[;[[[[[ 2/ 4p@-0PC_ P@Tp  p@FP@ dP@,Ppp@\*\`\B\D03_8S/@- @P@@\@-@M@@ D@ 03?@o@ЍM-P00M0p0 H/P`0010 0100  P R , ((,XG`ሠ儠P0 PT fZc^ 7张RP:{Z |2{PhD`){Q P<V 0S S S@00 03?0S7 C@ ᮶0`D0\P Pz   ( ,{P,0L`P0(0TH0000000 @02/0003?0000SS|LP  ,0 05 0 00J00?c0S 0 00|` P <%\03< RX532 0 PR (圠@P`JĀ wT0000LT $P  $P $YP $dP 0 3?00x4x$Pp Xz D0S03?0P0S 4<$TLyP, $|0呀 00`$00V00删00H?o20S@ A?A0&@P@ ,005 0000 @P, ` \&xJ Z :<800i x>  0???0J0A0$SV00 # 0 S0#03Q0 D0S "0Syy JBT0B *:P&8y0Ѝp @嬠%  1 AQ?o20S 崾O 対  y@ P@   4/0呀Xx 劾㱞 @4/P 倾 4/P  4/P[{\\]\'V˂\ら\\[[]e[] @0_[7][N][l][][]^%^vX)I^^y^^^<___HVX*_X___//P0000/R@-cwg 0 Br0 S 000Cs P 2#0///0QS -lQ  Q0 S 00S0\0S /D0 hk0@-@DP$M 0@@00 0ݽ$Ѝ0xkp@-@TҽpP*u`Pwhǽ v1Q H徽03?S ,1浽$峽00pkk l%lM-0 `BxpxPጀ匠0U:@唽T 䏽T卽T HH RDP Ⴝ@ =l6\Is6_lawghlp@-DD D0PCWx<Ux8`8@PTp bvl\I\Isl\I@- ▱00S ЍM-PX@Pp pT" '`P %x`qTMxVxxᴸ`PW* M!T00`CAᘀ嘠pDVMV t1 `W:\DpDTL0DV  4`lllllwgD-lll@-EM@P pwP T00 V@ ` V <0 0J@Eߍg '@P0d  =@P 0D 4 `( h0|@P lll!mKmVw  p@-@P``  L'PL !PL PL P tL P`L PP Pp <L4L媔뇸Pxmmmmmmm0S/L R M-M T@T -0P0֔@qTЍ 3PpEPd lP P8 @tP24Q粮Pa  0 3/P ᧔@Z0 Ԁ Ĕ 0S P  堚P g  R d墚P pHP 囔,ֻ mmm(-mn&n1n>n@-L@]P 8XP (SP`bnHqA-`PMPW@pp?@   BRߍ u ☁pP V  0 S0 0S R S 0| P ,OV`0 S0 0S`VS 0| P0#"0S2@S0C   "$r  ," " Pr "dS0S01 p@-M` P~@P U@ 1s #8 0 0ލphn@-P ЍA-MP 0S 0 `YP LaLqP@/ 0吭@PDP@P! Pp@0 ݙPp@0L@P  #@P  P @ލlt@P !X~@P HH D P0B 4a@P u nnnnn4n;nRp@-@@`rP,噺lF5/@P@pnnA-`BV@(Mp?PU0 R:R00#R00S/ H~P `V  00Vd(ЍhPE=U 0U0 0U 000000@0 P$@P#V 0V00V 0 000b0D[oUA-`0BSpP@` }P 0 DR U00^p0A/(2RA-@PD`B p}P 0 A//A-`0BSpP@` }P 0 DR U00^p0A/2A-`0BSpP@` }P 0 DR U00^p0A/2@-@@ BYujM-A1@D1RMDAxP`pN100 M p0DTᑃ""Z` 1$0 0 , (0 P, (0 0$0VX `̀T P` K!0J0$0 {P$0S  N`1  0 }P 0 -~`pU:`60*m۶0*BoLo-M ,ЍRM-@rMPᷫP0 屫P 00@ 0cP  ]0P0 e00@  000S P S PP P1 00 A 0 $0ZQPTTpT`T$0).Pp`ɟP%0P%P@(Dp'pDZ`& `DS:0@0@S?  04I0 0 0C 0|00[rߍ[QP Pp` 0P S P0S 0 S0 0` 02r0TX000彠000000 00$00(00,0000040 0800<00@00D00H00L00pP00€T00X00\00`00d00h00l00p00t00x00Sd00 0. H7  " d " " " 8  ,, ,8    " " `  " "< "   "<!\  ! @"\   "x " `@  "!x  !P t "  "D " t$ "D   "L " H$ "L   "p " PH  " !p  !X l "( "0 " l, "0   "T " 4, "T   "h " X4  "(00#h  0# 0T0q0`V : |H|0000$00,00800@00H00400P00`00X00l00t00d00  `! 0(D0 VPCP  0S p Sp p  0q3   S              00pG0LqW 0  " V 글"0! 0!|2 !*  ! !*  ! !缀. ..*  ! !*  ! !*  ! !. ..*  ! !*  ! !*  ! !Ā. ..*  ! !*  ! ! *  0 !p !! !0!0 RI/ooozzz ߊzzzRA-`p`@PP @P0S g(q0PUT goM-0``FqpqP̀0U:Ѝ叉@P0000T0 pDPUT \\ T@,0,C,QT,o6\Is6opwgp#p-pM-M`@PPV 00-S0ߵP܍ 0x P xR000x00 0`P ax@`P @V 0@T "@P 0,0C,Q T tP p ⋰,0@ P  R00Z000#S!pT QZpW 0Ws00p100S  x 0P 0|000xP &plp x0xq9T ,P8hb@P4 h  0  00  0S 0 @0 @T0S004 080SF 00<00S% 3/P x`hpVPP45pfppp@- 0 @Ѝ(@- 0 @Ѝ@- 0 @Ѝ@-@8iMP`@0S p<0 ٴ@0 |ӴVP ld\ 0Tô 0H8 0<L 00巴@Ps  ⸱@娴Ti⣴垴 0h 0l 0p 0h0S 0 h ⋽冴ʼǼ 0t t1tz 0P 00(00<0 0S 3/P(q  n"k!h$e 004` 0\ 0DX 0HT 0*Eiߍ`YΦ 8ppppppppp qq!q'q6q@qRqVpqqqqqىqqqqq/ɉqqqqr r[dq 0R @-1` ` /R  A-@ pXP` 0W0P "@ $ p`@@۳/+rR/RA-P` `@YPo1P @P p:P  էPP :! $2(0P$00T 嚳 `ab[rE-$M`B PnV 0V00V0 00 VT1 N< A0`FV: 0 p$ 嗃0Pr'0pp@ ٪> `0p垃 X!33 00  0`#t0 `d #3=n&c H@,0 U0`EЍ= ף ףp#tA-`pBW7-P1p@AOoBsQP( pR  ‬ppG000xxPPPb@`0 @P@ 400S(媰Ѝ@@Zabt@-R2ՄMP`@iVP `%PP <兰8kk4P(}ЍM` @PI@Pi  @ R` i@ P apP@S k0/T@| P lL@d P TD@L P <<@4pP རᰫ @᭫P ! 3ᥫP!3 :P P 4b 5/jxpjNuttttwuuuR/R/R/ ( #  p@-RM寯@Ѝp@00 x08wPP x`!P 0 嗯@@0S t勯0l凯u 8 @P D}# 1  $@suvaAvTvdvrvv0BS 1/R @- @P P/R@- @P P ?/v@-DMPh @ᯊP h pP (DЍU U@崡PpjP i 0<00S t3/P@P TiTPt@.Z`wVP 0@0ESP0PE0 i@` U;P Pd 02#00PP U,PPU  0S(0P0S$0P0;S 0V0<00S% U 00 "?RchPd 05#PU3/P~ p儮{Xm40PTT, (0$0qvKvvRw"wQ6wH-vfwM-@MPp`0Ph@P$0( ( 0BS$0S cg G@Ѝ!0/h0P 0 (00 0S:00  0HS0S $00 ,0(k`P ,@T00 Z*!00 00P0 @($0@0@4Opp0  1Gq0[,p 00)qp@0 pG`! 0?w@-MP@f`pW 0 f!SUl A <Ͽ2/ @U0@@@@D4?P0Ѝ`gP0 @lP@-@hh@}hwwM-8M@dPPf[ ">jPfP豟U"8Ѝ00( _fpP,0(0040 00ӵP Ih0 0t0pYPGgP7akphk$0!jP$0,S%UP  $0jpPp0 Bq0 (`,04哵P h 0xpeP00S: 0 `@005Ew x[-xA-P@`SdPfPPJpP m0!lPfPPHX Q|p8jPp0\!plLP! P,岬 rpP 0h0 PT0S0  ToPP 囬噬p 0iP f厬V  2/T PPV  ҵЍPT4xzxeQBxPxxxw[xxyFyiyyA-p `P@P 0DS(@@@-@04 iP 0S03?0Ѝyp@-P@iPp p@hy@-@0, iP0 \p00Ѝ*@-@0, iP0 Jp00Ѝ Ot(@-@0, iP0 8p00Ѝ'*@-@0$ miP 'Ѝy)7@-@0P]iP  00P R ^ (ҫ Ѝ0 <ϿyA-`P 0p:i0P@4O 2i@P  0+iP   Ѝ0@3?4O@@@00 iP03?0yyVwy@-@ \P@oЍ@-@ tP@oЍA-@phPP"T 0h@PP #ȥ`P FX`P P  0@0  hP[WЍy~h@- @iP Ѝ@ Ѝ@-`Lp@P P000p@) 0  ЍZyM-@P`|Xp5 XcX ᡝP ڹ  ֹ ҹ0 @\ ⳅP; 0 |F(3T$# PT2 ,@Pr ┅p# P ` 0S Ȫq@ P@ zP p崪`寪 pЍ @@P `p P  `0S X@ \qT剪 դPV@{ 8pp|rP Pp 0S @Pf4 ᳤PL4 @P 0S \q LߜP3    0 @4 Py 0 | 0TP L <)=z+z{1zz@Y5zOz`zzzzz!{M{M-@`0ԀpT:Ѝ0GS0#tP\eU6 P!sP0 $q %P 0IP HH`@[0  &P꾊a?e{E-R4M+P@ X`P7+}@PA @F $PP@D  P.  P  PP@D @(P@D20@T-7P0@ 00ES@6,`p'@$`X 3P@D`@rP,PE,0S4Ѝ0 j,P,PETn7 ⱄP pp0 0fTU@`pA@`p0S1  U' U. HU`+ 0 h U 屶 2/P*X@ h(PX aŧ `P/U厶}P  其U003? |  02/P*| 垧 gP aH 哧pmX( pb աPU PdPa  fPxa  庡pPU d0P0Upj 0d  RX źQ L 0000 PE<R200<@>TL U Tp!   0V?T  0   0    BQ0 \ P l |[RP50DK00 ]R   R0 QRp10 :0D0]Q0 0:fPT` Lⴵ0@   UpX@ _0U0000pgW0U0pU0sS  p!dP 3nX sXU0009 0e`PPP P  P^nXc@0 RS @nRT  _  0^P00sSje 0c`PK ZHvX=Z U@ @ 7PZ  P&TZB!H2/I@T :PZ`1TP@DZ G0 P.ZaX sX] _`~l0G0lWp pU U @@ tcPPTX  0uc`PV ` 00P00S ߥM  ^W P& 6Q Ḁ@T ڈ[@DWltAT- tP) f] 1Y^P 5_UPWP  m]0@S| AWA 2傥`xA}Whu XƟPbPU dPm_dPf_hWSU00gSNPpdP P UB 1'1P=0 5O2/60l110\ 1,0L1'<$041T01U 0 1T0$1 ^" RPU=ϳ00e DpPU/  P  0 PQ $(PP00pS]@ˤɤR[5 0 ]pP^0 000 0岤aS ϳ pP ɳ`@^P 0@cP^$dS  accP^ ўP 0OP ^ žPpEpU@:p 6@@D L ᦞPU #P q+a|||}}D}s`}}~~,~J~]~p~D~~wg~~~^mK|} <BIFQ^r6Md{ҕRsЀꀉ&*8ảM-P`M ]0 /P  ] Ѝ 00000k\@ᰱTt tq. \p W  P:X! 0AapP D8! 07aP 0!0a0P 0&  fP"pp \@ \ 0団 0S0S 咣x^#\@p_p?p 0  000 P5 P0 ǞZ6Y4P0P/, 0 ` p  1P P 0 0S 'P P  lP  XP  DP 8yY`@0GS0PApGor,L0SVP0$00 P,$0q0$0 嬱,P0_0 Wܝ0`0T0$`V?WvTV0 H!Q 600Uh  4  ,000,0 P0 Z_oRSPUT000 ÐPTP fP 0$ (x9)= $EI]l^t|ǜ$ooWÝE-p` 0lMP}@Pc 0R@DOoB@: W    [O000Hٝ0000 <0U00`$`}@P;!0!pS0 P 9T`T0P`S0 ,⬝lЍ03/@P0 }0  S xR0 H0 0@ 0Pf t  wgbJJM-R Mp P×Wp`@ Pp@PW p @Vd0T0 0S@2y`PQ v^ VKP ЍpU  >y`P0W000$0[ X ᱘T  VP  000P T 0S 0 00 0 00P U PT 0sS cS iS PtSPP u  ` |pPD.|p00 (ȜX"{P|P 嶜 u!尜X | p姜w CX XPu| pP_oRN|U X叜wB *X==w: )5Tjsƞ@- @*RET T T 7T0AR@-$@) Pj7@-P@p00 -Rp00 Ѝ0s@-P`@ r RЍp0-Q  R  _ R0E-`PH@P,V` G`PVVV00Sp0.P  0 R~P @PU `Mo Ѝ/E@-@ Hp؛D0 H\қXЛ H@ RЍ 000 忛 KVdR@- P0Hh孛@@H夛6 w@P (四TЍ0 ꊟoR7@-6nPP@  Ѝ0,@,@D,0SM @6v P lҟ@-`P@P Vp,~LWT Ѝ'@$L}@P ꟉM-(M o`P/ P0<0[jpL p05{p@ @ T  lp0({p@@ T `T T@;@P1}}s `}nziz@P `Vx@z]}Y}UzPzP x@D̳P@_T(Ѝ;/@9=E~hRA-@PD`B p^P 0 A//xA-`0BSpP@` o^P 0 DR U00^p0A/2A-p`P@d N^P 0 DS U40Q 0A/T2R-0D0CQ0 Bf] q/DR0 BV]/a0*S $S/0{S  /S 0}S00M-Pp`ᣕtAh gPLᖕXHVP" @ᚌU@ L(8HoЍPPP l@hUDoTTTTT@ T 忙gR@-@^P0Pp0 4TP ~o/~A-p0BS"^PPcp0 @]X` V0P*U` U``0jR1p@-`j^PP,8@4P U0U00U0 R  BU0 R  B0S  /pM-KM 0 h F10p 0oRPU d[\3@ R pJ T TG TE @ x #Q h[P :@DP@D@DP @D `^PP'`v` X^P Tp` P^P`TJ^Pv`0`Tv`0?^Z0P`pv`P_ PKލ@D@D @D@PPp p`0 j F@D@Wp!X1h10Sx 0d0 0(Qp.Jm T JR0S` SSPU ]@P0PEt` U񟗩!!!!""""""[[ 0 `F⿡PP  \` KR@@Dї0 @(R{t̠Mp@-@PP01@oU@ r@l0d@PIP hZ㟗@Tu0 p 0Pp1t<`~M-AMMTV@  ($@D8D4DDD D$DW, YP 2/($0RCgI$R+$ $e p`@㰥 T7@^Nڜ, 0W@tpGW ($G($RCEI$ $0$R ,0$P`V p`(3]@P$R/$ R  P P 0PQ AAP qxQ 0@q@A`@ TVa@Q` R P4ą *$ $ $@`p00)$R$RXR^00+$R= 0$R: ,0$P5 @$W(T t $ BRHHHHHHHH\ )$@:tw@T80 0 0 `\PZĕ\+Q+ PD \*$  4$R 4$R0)$R[[ $0 B$$ 0 H0 p$$ RP \ RP RR$R PP B$8R B08$5AqP+PH00S0a{ { EH$R )$J($RC;H$ $5\4H)[+!  @I(QC!HXPHP@0Z 0`4HPh? ? X傖P AލЍXPk_ |wgáMM-P`PPE 5@ 00V0,V@ &P 0S GP 㾕mH 0P 㸕~X P`ψPP# 2p@l6lP(@0S P!P 㘕GH 0  íP 㑕WXPЍᦈPP   p@h5P5%@5` 5% 0# 05P`5`5 5`5% !XP PP"Xp X 0@ 0 `V* X {wp0 pG0w0SpPpC4WP0t0#00 00N0060 00`P`Wp W {PwPU30?0 0P_0 K pG{wp{'P(W0  pDRsPpG 0R #`@Q 0 ?Q@02/00WʫW U30?0 0PW P 0S 0r SS0TLß0#0D3@H0S0C00(0CSpH~SpC !Sp> S Aq p5 `@P ?P@S@p& Sp A- \S# p  NS p  1S p S p  "0 0 00~0p0000 00Y000 0w0 0p0P[<10S0p d103/m SRjd 0d1Q 1 a00#0p0Y0 0pN0 0p50BS1P00PEd`(FP V*`VU l0 ~0: 埔t 嗔0@@k`롉#bU̢toxPoToooooXoo|o\oooxo0áM~RM-M`43P0l0 (3@$30p0 pbY@P/2W00l0  &p p00 l00 @S@lZf0 010 00 00 p0h0 l0|0 %T0d K1 T 0 s0dK0 %`p:0d Ks000;Q P  07h0SP 0 00M0x @SV@T@ 0R03P0 5$:| 8xx0p`h0倀U01t0 0 t0WPE0e 0Vt0.0dKS 0C 0H Cd KΐxN >E0  | 0|0 h00Ch0 VP l0  40 40p  $0@K/Z PkjpjDaM-R@ M<PX@PD0DS !Y0 R`p PL  FP@ T0 T00S E` `0 @ d`Z@ PU Ѝw0SP 7U p@jʣ@-@< P,6 Pf죉fM-@0XMR00,0CT$*P< ʎPU 8 ŽPU  , ⺎PU 0 ⲎPXЍ @D`$1@ 01 @01$00 1000S S  ےT1U@P @00t͒ 0 T0`VkpW4H04P00@0@ T0Ry:0D0D0P d!0@0@ T0Rs:`D0H !TD`D T0R~:T00T00H00@0@ T0R:0H00 d@0@ T0R:0`sH0@`@ T0R:t 00@p 0000gT0 R`0$0S0 @0S0TPp Wt 00 0v`4 V  RTP@x4`Z FTP@l`v@0H !@00z@01L0L H0R @H L0-TP@S@00@0rD0P !@`@ T0R:D0H !D00D0m@01L0L H0R @ D0R @H L0^TP@+@00@0S@0H !H00H0@00TS@01L0L H0R @H L0>TP@ H00P0@0P !H00H0@00@0?SH00P0@01L0L P0R @P L0ÑTP@@0aH00H0@00@0*  !!050 0R  0 0# 0oA@圑`%#7UUUUPGz٥A-`0BS-pWPSW@ M0Pxtt0t `0`T``T Lf㽐`Y0&VSMᆳlvM-q`@P HVPP, 00@ذ9U U /k:P0 P㜠 -RV0e @t R@PЍU UV@V jjjfR /R /M-RXM8P:@ 0`5094 0309020901090009039p040TPׅT5 2 3wTx0 020S0 \4 P L 崐 XЍ 0 1_T |T vp0h40ZrS iS mS;  4P10 S000 S$0e僐wS3pxX01@S*T@3@PT  @0FPTU   @0 FP dFP  FP7 0 0 FP   <0EP  @0EP< x7t5a  @0EPL4S    :0EP  3    <0EP   >0EP J3#0 dp p /4S  5 !  :0EPd3 &   <0EP<  >0EP J3#0 6 00(000pU2"%ŏ@t@P 53@01pSB*054 5  3 5 5 1 5 0 5 #4 4 0 3 80HEP  咏PuP 00`R` S S * 傏@t@0`  xuP E0P  j@t@00cS*pwp`0` 06/P 3@((t01PS*0 4 @0DP 4 0``dD0P852PuP00cS*@t@`0` 06/P 3000(00 S^:@S@`0 DP  0(0`@$0t S*(0S00s00b 0$R  Q 3R㰀  0CX 0ASt 0ߎp0W:4َP2`S 0PW% 0q"ɎX 0"R@Q!T3  Q!  崎岎pR 0T31壎XT2R,0,0Sl h!SdXR  4׈PT Q fIq@T`IQ rn@CfffffffWfԨרhI릉y0:XGӧIb>( JbkS]ŦئfRnM-`MPC@`a@p@,@D,0S;860<0(6 0p8060,060(0604060005005@5pP0xS|CP 80@<0800S ( RwW $0SrW0 H`Ѝh,@0rW 0PH wW'U 㬜HPp00U .vP0 J @`00( 0K,@P0 4|PPEU" 0ESUC@P 8 <jPlWXdX@T0(0,0CP 80@80<0T8 <LP⁍P䳟4pX   v 0S pP U@ i80 P$0UD0ZڱX0 0 00;/ 0R(/ UVў0[  0;/P`0VP 20 0S 0Κ / 0  ( 0` L 0Sf800 P$0UDZ0 ,;/ 0 S/ UVH,0S   3/PU{ `0SP2 0   0Svԝ  $0  `/T0 P)B<0rW 0800,00(0$0400000 wW x0 pL0 H0 @0 80$ 00 (0 0 ffffffffff⩉07;p@-@`ԋT)PJ?.Ԇ0P d 0xRQ@ἋP :p0Aq ^1#!0NPdNjpp@-pMPp@`~P*?`?`oP0 48 P0   5b 00 4;0A0 Rߍ Q 00CމM-@0%MXWP0TSQ8X 0r00R40TR8", 1 S#tŸPP4 P(ڋQ ՋӋ 2R̋F "}2Q" 忋Fd"n t20p"SXfPdP`g`O`F"[8F 2V(" Sh0?Q FV {F !FvF!AqF 1Ua`p 7gF  2`tU g0`S6 mZT! h0S6 <JFVo@PP4a %ލQTX _00r00R40TR8",HV < <@=0S S S2T%Q jv˪ Fժ:U窉WSswgZ ?3F_Vڭ^dnK~ϫ,R@-@0oR͙0hM-p`@ NPP 0@DSV p0Rh0S H^P00DE 0 M/42h@-P@0S H^P00,EP hR*A-@pplP h뀀@`P 0 \凊0 |P80T0 0 xT/h+z5R7A-@:p6` 2묀@QPP 0 Q0<00S 3/P`F^0 |P40T, , 5T/hIy+zR2A-@`p@PP 0 0<00S 3/P\  |y\P40T, , T/hy+zᬉ@-l@P H d@P 0S P 0S PЍ D@h BA-PRT^`_x__D1@`PU' 1pP!  尉W0@i0S/妉y@s@oP`咉pP^@ZP` T $sph+z3Q j @-}M-HMp, 04Q0P0 0S8D@HЍWP@0T a A{P0@  G@ZQX[D 0S D#ؐD #ѐ$0 3㤃夣` 0@S H01$0S l3L# ᱐H0A$0T (3(#  0[` l@PUC1 0s{P 0a 0Z`婗 _{P0Zz`$0`0L$0R{P 4L{Pj$00$0x ,0P 0Y+PU1Hz RP00`G0@000  VF0 bH0∱ 0 A {P  H0!$R$B V0 B@{P V"H0@0$ Q $ AzP zPH0A$ T!$ D[zPP zPP zPPlC36Xh٭Hq#[Jdo1ΑĉMRp@-\`Pz@PD puP44P00 0nsPp/hĮޮﮉp@-P0`@P 0Sh@pV  嵖P  P  IP@ Їhp@-PJ |@P  t 忇p+M-`@V(pR@' R R@"V -{@PpGU V 8 P: P W08 !@01Ѝ8 !@<[{PA-MxQ{P@aqTUkލ0SY8b0S \00W00R0S L < h@PTTCA00CSB$iiiijijj2/,Q ' $LQ H4.8 <Pz@xtplhd`YouMt4Liuïꯉίگ毉R'A- @P$  t"0SІe{P8dȆ`\p U0* 0{P  0Ḇ0P`/ְ#M-PhM H`'U@P  t Tp0PpG(0p0  ,߀?o2 008W0$0P0D0(0ES` X0 BE `X4@ 804@00 4 dP  `V080z8hЍ(0SP PXP` 0GP 0[ F0PP 010 (`$0S(0$S, ,,0SxWS8d5$Q\% P0D H @0004000@0\  0 0 `80S00WH0 004pL0$0S0$0T0,0`0$0S,0$0 0d00 z0P80" 40S;t``0 0P00L0001/D0S`0L   0X0P00  H00 0z`P7pQ+dQ d0SD ^`,QRd0T  S0P0$0S0X0P0p Z< < ` 0`0X d00d0SQ H00 01/P` 0 (0S,"1V 0x\t08 h`0 0P00L0001/<0zS%40 P 0,0 p$0S  z0,0 a0<00<040 0@000τ 4 ,O080t0`l)=uz걉wg>EL6.IbZmoj޲M-@`M@  `$T@0PP  u(@Tp% cTp \ `@ 0P  0P q@y`Ѝ@ `0X00$0@S` c C4316200 00Q(pp,0 P0040Pp@@0i0}Z"3y"P. * 0( @T`0, (0, ( ,R : R 0R0:0  0#Tp X0 3/Pp0( @T`0, @!.V}Գ@- 0 @}NЍR/@-@D?<0P EPσ˃bA-Mq P(-WP ``p@\,@D,0 SЍH⣳T00H 00⥃,@,@Dwg)0RE-` ( @^`P 呃` ЍP0<0$ R (Q ,0S2/~ppp}P k}@P|/0<0(03/0<0,03/P(@DW  WPC] 0@-PPM   0ዷ P `Ѝ0@@@Ѝ00 PP P@PP>>/ ,@ꐴRA-P0@ -R0aS@DTP `ph P `pW P` /`ݴR \/R.0@-AM@M 00AލЍ0?0PP0 l T `(P0L Q  10 P 0/S@- 0,@P h専 0SX嫂@T ( !0 3/@P 嚂嗂$2C\@- L\@-T .\^  @T aT fT @]G Q 0PA-pR`-Q Pd @000`FV fSp 0S 0 BPPP@7@-@PpP0  Ѝ0@d Ѝ0RA- Ѝ@`PP p@?ou20S dP0 QbP  buM-`0BSЍMFpᾐ庐P 嶐@ ԦP嬐 p?ox20SP  dPU  Z X 廁PЍ[ItP 0p@CQ 0 000`b P 0 000 b P ZuSsR@-P"p`ZCPP W@ O0T0p<0 p0`S 3/ P 44hP Ѝ`T @]bu'rR@-@!p`%@P  WP d P 88=@U P R3 Ѝbu'rM-P1 M0R01`1@1P Ѝp  `P@W  ۏ ?ot20S   c R  PZ p1p#0  8aPP 0W;0`0 W O2Zp0 h0`d0@`0d0À000 A^R08;,崀ooobuEΆA-`0BS@Ѝp@lP劥PpN?ow20S@ ac@T  RXKP0ES 0`Ya P g@ ZuRE-@ Ѝ`)@%PCPp?ow20S@ c@T  6@  E` +p`0FSZ  PP0 i` PPp buIRDA-MPpӎ@ώP`?ov20S@ b@T  Ѝ 宎P`1`#WO 姎@DPRA-@CpPÍX0`彍P 幍 P,9iu/j// P0 PLDDD$,4<T/P SL/D/@/</8/4/0//$/؉؉wg؉؉؉؉؉؉ى//////?~/ /$00S@-~/ŋ ىPp@-P@ P P p@p~n~U U f~T T Tp@[~PEX~U긌M~K~Tx PTp Th `\XTP ؉S/ىqnPىYىKى_ىnى;ىىىsىىىىى@-0@S( 3/P~ىډ@- @*x 0!x0 0!x0 0!x0 0!x0 0!x0 0!x0 0!x0 0x 10 x 0 x $ x ( tx , hx 0 \x 4 Px 8 Dx < 8x @ ,x D x H x L x P x T0 x X0 x \0 x `0 0 x0d 0 x0h 0 x0l 0 x0p 0 x0t 0 x0x 0 x0| 0x x0 輋KKqN946܃dxdVtVTPDlxxWƇ V:`Q @V1 W8ЍMsA Y@P yZ000@?Pp ⇤@PZ U/ ED a@ډqډMuډM-`Pp0 (M`ppGW<@ -RF S?| Z00S` WE @nP? [@OW P 0 B P$ 0#`PV|1||NdR bR cR FrR tRSH0 SC0 RPS:0  `[% 0 R0S [ {@ {P $@D0 0婝$0P L6(Ѝ 000$ډމamۉډۉۉ-ۉKۉۉR@-   0 oЍRA-@PD`B pj?P 0 A//$A-P`H@B pR?P 0S 0 A/XRA-@PD`B p7?P 0 A// A-`0BSpP@` ?P 0 DR U00^p0A/t2PSE-P`pMG P0A0-S  mP5PV@PU0 ]BP+T`- -Pp崠 !BPX \0S R0  w۾PU※<zߍ@A/܉wg܉ ܉M-0@<0pM0S 3/&ppBz%PpЍ0<00S 3/  -X0<0HPU Z0 5/PP 0 z% tz*mP `VUPP%PZ0   zPP`$܉o܉L܉܉A-` MPp,0FS AP ݍ n0@0S yAPW W00P B@P 04 ⾇V ׺ 8z܉|VJE-RMpD`Pl@P0FS@ 0 AP`V` 峺ЍzlPFЍEl PFЍElP  xlP  dl@PXX1X!P`B4HHq QU,4(4U:, yPdl@P,V*`  pAP y@ 00CP`U0 sP 0s0S0hyP@@ꁘJމppÉ0܉ILJћIכΑ܉ILJI܉1S/A-@Q! 0 #4`vytP(pHtPtP 0 cy1S ^y!|Xy10 S0#!!\OyC/0 !B ! #44DyЍ!o=y ݉&݉3݉]݉݉>݉0M-"M!0 1RpB*y"ݍ`@pT. 03/PP- @  03/P0tPP Uxy k 00p0Sʀ0S }t"=08@$勹pLJI݉I݉݉E-PM@ftp,x,i  XZ 000BS  0SW0   }RY S< 40`Boo`bxW00S 0 Cx X | 0 0p0!00CSH!H!!1@0`pxtP(HtP tP 0 xx,  0SЍD0  0 00Sw|hxD  (P 00 RH0S2 o00 ^bމ, މމ%މ@-@ M   V ЍM-@RP $PUЍM.x` )x0 00"x @帠@$0SЍ0   0 x0 xdpd  xXp8w`@4މVމމlމwމgމމމމ0%R@- R@ZP 2SP @w,00S$wwŋމމ߉R@- ڈT @SP <w(00S wwŋ߉:߉߉R@- 0Pw Ѝ@.jPZ@S|`|pPUT dwTww0T0P0SSŋY߉s}߉0@-@0M 00 0xx0@@`wZlSXPPЍ0 00 000@0@0Jw`S߉߉߉P&0@-Ph0M00 ST00   0@ 0tP7P00Ѝ0N߉R@-@p徼P  rP 3 p@ P ( wЍw@ N߉p߉0@-RP,M R@@ rP v剼@P@,Ѝ0l@0d 0 ␞ P Hv @"T+k߉NO訁pwgbE-R@SMPNi@P; gRQ0STwvSߍ Hv @RR) RlPh@ g RPP TR @TP1@P# @P 81t4b1KP@@PaUD0* Q Q# p.Q  B 1R tpW.p. R:1R/ H!A @:v8P@Uމ#흊D_ڊ2wgs@-P~ K@P0S `V  LvЍpKP @KP >cM-R@P8M` HpPw`P`8Ѝ \uK!I!G6u 0X 0u( )u~0$u0uN 08ЍMꮉŋ$@nWS?j$CZt:>0A-p j@Ptz@a_PPE ht jPPPt @t 0j@PtZb;VRp@-@P` TnPHtPp (nP p@k 0tꀚꮉŋM-RM,RpP`EVU@ 0 <PPD00$0 040it0 | P  ^tЍᛪP P' ;/ᓳP ˭ 2/@ An  @0p|  PwP  2P PL/ 2/ ຢ(0@Z'qCedR0 B!7/A-` @*R)҂@PTH0@op @PHs  00q 㧂pE-`0BDM00pSx20P9RK`P吂 L2H:QPℂ0.S|0@StW n1W 0 P BQSPq Q 00As0 S 70As0SW0As0STssDЍ2s0000 1P1!` 0`ۀ {oP 0 00 0000 jPPᜋ@P000 o@P `ဠ倀 00BV l4s`0soT(s`ŋ@BŋŋŋŋŋŋF@-M Pp@7g `AP 0 00 ۺP00ЍM-R8M ڤ`@oPP`FP@V8ЍM7Vd傸pP8ЍVp@7`P4r` i  \oP0  VoP0 PoP  00000 0gnPr00 `0YP @ ܥP`r, ⾪@,TNO@؉EI߉paA-RP &  0 0A07@ `P4(<p?P}?4\r_:V$C<$Rr NrЍMb|RM-p@`BP00S P0dP0"" 0[@oЍ C R񟗊괽$8T쾁 LmOoBWOoBX @@@0pvm@P@dddOdP@@ #f @f@DOoB f @f@T@  f @fT@@ e @eT@@Ө e @eT e @eT@@  @ѸP@W@S S S0p'} `V Qa GX~ZT@@y@-DPPP`p$1S 9p$4p`ذ%1SpP*0  $p+1J0S S Sp0p+10S.d p( p `wgm1]ksى|@-@ew, 0SЍD   Q$ R! (P ޿@-@ }DPЍD0 Dӿ0S D  (4/@-:P0@0o(o0 S000c0ŋp@-`p$MPa؛k0Sd \\Ķ@P Po$Ѝ0 0 0`@XP$e#@-`p$MPaᇿP}ӿ0Sd`o$Ѝ PP呶@PHp0 0 0`@)P<T$dy@-R$M@P `iP 30S0oy@$Ѝ hyiP\#o= HoiPU 4(+0o/30S   \iP)3 QiPU }@n@P\ ew 9iPgU}@}PPln@ } 9@P@0SSESF0C$f0Cs R Sˁʁʁʁ0ˁˁʁʁʁʁˁʁʁˁn`T+ n0hTd0  00Dt@ 00 #0j$pd& `n`Xn`Ln`@n`4n`(~n h@P}Pp0SU>kn`fn40S0P`pCⷾ} 0$Ѝ@2@!p|ŋK(Pؤ1z0Ɓ "ȉ?ZXzdvpp@-`(M%  P0FS@ XP @(Ѝp<0>(0 3/@PV  娮 noJs@-PDk H@P0S `V@ЍpuQPP0 |BU m@m5M-P0BSM @K|0`S pW mK 3@P0 m`H`PnpmP[U#?0?0@0 pMGP?PM0K☠ 唠  00P9G 0K?  B0 09` Q 0P0P  R !"004 0 H0 L  Q 7w!Q00S !"6 HL 6 6\0Р$QVРZb_PXs 8m0KpKp 0 K0K`P vp  vh  `V\ X !mh0p0 00 0[[0 Aw'?@?h*PP  p3w'?@?Z*0P0    3 uE00F00I00 00P00A00R00T0p0\0` ` p ` 0 ```p```````0$`0CS$ 0! S(#<" #0%`&`'`0"0CS$001 S(#<2 304`5`6`7`D6P4I0P8HJ0 < P$K0) 0P(* S$,0- S(#\P`P[0U%?P?P@P pMGP?P K0 fP DK8fVРKiK~i!A-p+\PPniz@T@P 0P`iy`PYi@0|SQPPg0 |墹U (Bi@>iP:Uk5@-`pMPa[@P T P x0Ptt iЍ``R@P Ti/0 0 0`@PP:Uk$=@-0kM-R M+~ P+@~U  ٬U   CЬPpg[`P pWP|h ЍP T[pP `V@4P 0 h0S 3/0P0 hQ  08 0hh Rq AqRt 0xQ$S Hsh0C Z R ghJ `hz@Q 0庠0S 0 @ R  (0 SR S:Ch0S  xP @`` 0[L0hHp dP@`X ZP  hvt 0 hpT4L@X@@T Q  S 0St* 3/P'bOgN@jo"Y0$؉vP P/A-Phph @ 0 @SЍ0T 9z`@c  0  b0gwg 7@-@0  #z0 zxPu~ \gT00S S S4 0g( Ѝ0|JA-R`PH M Q  ℷp @T  ЍfgV bg`g 0V0H%S4! Vg0 y0 y0  y0  y=~ 0  49g C4g1Zz M-RPMPpb0Es0S @ '#8AVS rU 1G10lS@pGW 00rU00S sU p1G0*S 8u800S6pGr0E?oW20S.rU| W*sU'qx+PPP@W uW`@ u@D HLNbP "@PW@`@PЍ0.\ B8$0 h P0 080B|uP0!$0  0S8+YX8juP0 HD0刅L0UX D BpUDBP  UD APD, xP: |b}@pyq@ D UA P" @bf@PUD AP DPD0S 000US @UD AP rUD00nSaSvb0C SrwScWa0 ,PЍMsx,g,0Up0 UppT@Y@ V0IJ5>* eT1#Z eN( @D0T0P+  Q0#02ST#t`0D \xD ,eW0  ,PЍM腷W 0,P+ Ʊ+ 0S+0 ~ e%@S@@ee`0 ⤱ ᴱ8 ✱0 ᫱ 80 P `p4 D4 @ 0冱 ᖱ D ~4 Ꮁ 0`"SPD 0  pwR@@T pw| xx00p  0 40p LYeW@TP visX\TwgA-`aa@P p儀@0S  aPP@@ЍaPP ,SaWP>aP埊M؉! @@/@-B/@ᓽ 0N@p@-P0@S` d00eO!P 0S  P0 00ppp@-0P$Sh0@ 0X@?S  pD0 <ap@T hWPpppp@-    M-0`S@P0S 0S 0S0 lrX0SfbP Pp0pq0 PZ !WPH0 ;  PU UPP Y 0 0V @oPP PPP嵵0 000 ̵P0 Y 0S 0 S2 p\R00 R P 0G pG0 0 00S00 0SWኵ\R0  R0@-V Pd M-0P8MS8 `p0,0 0(0$0 000U7 00CSC&H70S0,0 S000000@X``V# `@`V`0SPP R Q R 0R RS 6 p8Ѝ Q0D0 0D?o$ 2R0S$0 0 0oobT00ST``VT0S 0S"000S 0 000(0_, 0 0C00P0 000 0( ,000 0`0V0Qr,p0( 0 ` 0 @`00S0 0S X S ]0PC^0  40+J 000,0  @ 0( U 0L [40 0 _400 , `   0  00S #S 0  `V p T T0S @M T0S0000000Sp) 0pP0oZ㨂X? `^=2]P0X00S `0P2p0S$p T?o2 T000W 0S @` 3͙01S 00C0p1400 0P0 RW pP0 0S0S000040HpZ]0  wT1pw0@!pCpp0 ]04p I0`S00 ;0S 5 240p0S *]0Z A000; \P d&bA0 P$0A2'Ss0 @ 0ppuM؉up9FM-`@M@ ↺0 P0p<`,p$p0(,$0p8p4pHQP&  ,j  0S 00 03/p/40S#$$:(pPFu!p D%pQp4aP{  5R00SPUP@Ѝ 4R p [  2/W GQQ  ƲW$P [$0S0S00S"0KSl\[ |[ ;[$$Ͳ 00#03/ Ppw  03/z  ₲ 03/ 03/Xsp   !$ 00003/p0000_P0SG 03/ ?P {P $ $   $  03/%$ 000 03/ 03/}Pp}Pb0 0 03/'PpqR0SP 0 00?o20$&Z@ 03/e$|Z6 03/[0 0 03/Pp 0S&  1 40S 8 |u 0 u 000W  X '[#![[ ` 0 40S0S`v`000(0 00 X~ooDuA-PP@M% @T" p ZP㬀@ 0S [Z`R|10@0 0`+@D tD0@Ѝ0@0 0P@광p@-P40Ɗ&p$`P `ŋ@-@ H;P 5 P@ P0_Ѝ蟊P  _@WRA-P` R@n@poRPAxgRt0P0 sAP<@0sPA 0哴M-R@M(`PB`0,0S (0 Si H0( 0(S[!W00S Y`@|V @1#`. PU `0[, R ( RP0(0H0 (0Rs[@@ [  40L{ 04@S!S `$;%L0S0 +0S0+000 : HЍ`ܪ0 40R  R245: 0S0  lY00000(,XP*K(0,00> S S 0  R BQL !!$"OS[S$ S 0010CS8h!h!h!h!!!h!h!!!!!!!!!t""D"4"!d"!T"!0[S00H0 (B0n0S ~S"010CS T"!"d"!!T"d""02S00CS00H0 (B(0 (  H00(0S, I~S0000A000=000900050001000-000)[0KSS###$$# ((#' ($ ( (@&$@& ( ( ( (% ($%0 S804Q JA 07O" 0 h X   ZJ7 000C0000S4000004 S* 00000S  000C0004 P*JZ  N0  gX  Z*400C40004S*@&@AUX 400 0CS40004S 0A0*DX40<00#<00Q0A  R$ S  C P 4  BA4  0N 0000Z  Z#0C Z 0C0 0 00 ~ 000C0000S4Qg $Wp 400 0CS40[=0SX x[0S  Cr L$L   R,40P AS$ R 00S000R #Z 00S4Q GJ:S04P @fꐣ% 000C00p#pW 400 0CS40>0S 004 S:  D S400000 0 0"P 00 00 C400< 80R40 Q0CZR4 0JZ JM00 0 P [W00000Z 000  LW0Rp,0p@- P`PA P>(**)****)*)**)P P$ P*ta0@W 000X0D00@D0@0p0 0@S0 Sp00 @3 Ro V0000 !P@@0 j 0`000000000`0xŋu ŋpŋtŋŋ_swg)Ҋ-f  fA-0@S R_+0 0x1Rtp0dQd!00(R0 ` `0X 000 0 0 e0CPg k0  W0p0G0p000cp@0CN@@@p 0@0Zp0o X 0 s 0 H000X0  ^[ɋɋȋȋȋ@-\@~00  (       0#EgܺvT2@-h@e0H  @  8  4  0  ,  ( $ $ 0g jgrn<:ORQhك[@-@C00@-@:00Pʰ0@-0y/P0@-0m/ 0l0S @- 0  h h l2/ 0l h /@- 00  0 805CL0 0 B/P 0@- 0h@宁P ἤᣤ%QRw@-.P@w 0T 0d.@-6 ~|@-  0L0 0 0 08rɋA-/P1 0$Q, `@p㰀 0 (02 P03/P|P 0,` 0l@hh \{*pt@`PP 0O,@ꆖ\~W`@- $ DP 0t 808P0P 00 P Ѝ>O0@-@M0`0 P$0 $0M@JAލЍ@Ѝ/ 0P/ 00 xJ 0S/ 00 lf 00S/ 00J00S 3/@0T0PA-P@p`aaE-M 00@0  HPP@ 0!<V 0<!Po aA Ca0 A `a~3v10?p<3167 P  T0! U/o  b B3/L!b 0 B `b3t'20? 0p3267> S 0 QP N U @| N4_  xM4_1Sd SXM@04_DDM@M aЍwggfffh/%09>CGO 0S/ 00 / 00S/ 00 he80S 3/@0Tp0Ppp@-@`PaaSe@-M utp`P0W0ATЍ0 D0 00l@o40SP 3/p@oaa(P S @-F3/@-@ Ri3} S @-3/@-@ R3e@-@ 2@-@ $oA-`PIp@ᔀT0WЍIp@TfIL`P 0T FA 0P 0SI@ꥒRA-P`@pgP@0M P`U/ݴ1US'p@-1PS$0s/ R R0PS @S@QPp D6%GP  0RGP dp/ppY] Lo @-@P00 S0 $,^P@buwgA-@PpPT@0A;A-@PpPT@0Ap@-@PPpT@p@H-0?00@0M?P?P@0 |ƜP `pPh0S1Sh`l0KM- M0 X?0?0@0 MJLKW@?@0 |p᜜P  :LBP !hoo`PW1O0@QC @oW Q00S 0S9PU0 SR 0W 0 00 0 `VQ0 P(0$0 x0xQPl 00$0D 8 KW SR owgci@-@ K 0 oЍ0H-@ PD$?@?@@@M?0?@0 |P1 U: Qo?0QP 0S@ K0m@-M @mpXKЍLKPD`4p00 pP|K mp@l-|M m|ЍM-@pP E`PX FN@= P EPTpЍW F 8 @8P`E  :EpPC ዐPQ9PM0S FFP 0 DH B W:  Z 0`S 5 FPP 0@S- pp = xF0p0000-S0 =S00+S00 [FP [ TF [=PsW:  /@- 0 0  PD< @- 08<0 0 80Dp@-PP<`@ 4J@p1=P @Tf@-@P 0 JfM-`d@TTxJP4pⴠPU 0S =P W@fp@-<`P@T <P P@@pfA-P`@P0 ,p7/P@- 0P 4J Ѝ P3#@-MG@?@0:0: 01P90 0`0<0pW%  0@7/0S 0#S 0Sp000ЍP@@D9SmI@T*9S TmM-M`80S*p@P ]dDt@0h 80s0 000`0@ P00np0SP0S <XЍ@-MGP?P`0 pPP@<Iߍ $I@  M@,Xp@-0PGAMTʄI `V &1S00hqČ}?00r 00 0 ;ЍpE-@`pPXM0h d0080s0 00  PPUЍ@-r` qP  p@P0 00P0 00P0S0S0` R0 P  S00SP ЍDd0@-M\*)@h00Čr 0 0Ѝ@-@M0h}?00 00  0 !0P09hIH 0h08=H 0h0ڙ 2HЍIM-$"0@q 0RFMWs&P 07h401ܡ 0`1?`00p0003 00 0 D0 3kPS0W?G `0gd0h 00`aS ` W kP 9 W  Pp㘰 0 jp' 9 PpP P0R0 0CS 0S Q03FߍɋUSBCUSBSp@-(MP@ ០410hP}?0 0P 00 0!0PXG 0h0<` 0h0(Ѝp`7|/M- 0@Ph!!0R30MD 0G@A@0` 00 0G@ApWI  200 S00,00 0$ ej`$ 9S< 1 0˘0 9,0Z`09 00S 0 0h}?00 000 !0a`PI 0h㡘0I0Ѝ,0Z [0K ,0Z 0pWE-@PpQMG`?`u 0Smp 1#4L01M01SPF Z 09,03/Qߍ 0S3 Ὗ00020000@0060S 000> 0SZ09 B0S$R W "M  L @ 0SSS S X M D L @ F$kF  pP0M-PP(Pt#,IaT@VM0?!1S<"10CS88 R``P`"1 0#1S 0%PS&"20 ,0 0 R& &pP 0S 0S 0S 0S 0S% Q& |Ft"t2pF`0D"0Ѝ+Q*  +Q* .% 0Q060 Q %0S0%00 h0 y1$90 0<0$0SJ03I0h_`}?00?` 0`000 P$0 ! S0 000<000, }0 `P[    pP  !`P "`P P`{ 3/P 0 S*4 `PnpWiHȋ cDbRHh`e 0ŋ\yQRA-p M00 0P(?@R`?@ 0P"0S08090 P0pG@ ݍ0@S?00T00 QS1:  @- @R0@0RQ1h|00  @PE1 S|00 S S0 44E@S0h000?@-d0h00Čqr 00 #0 LЍp@-0hMČd0 0P0 q 0 0@6`P,9P 1S 0 < <0Ѝp0P/\/A- P@8`8pU P@TaaA-P`@88p1S1P40S 3/@aa 0S/ 00 @-@@P\ 00S/ 00 aA@-s@- 01 R# H X@PH a p@P`@,@D,0S@,x8HBP `P@,@D,0S Ѝp P D,@,@Ds30P a0S *,@,@DɋA- 1(001 0SDЍ`P- xV@P* ZVXPp开0D0 U D0 HDV 0St{D0D0P 0SU(lD .V@ffW;M-PpMP ; 0S 3/` 0@S0S7  <*P$ 0V 7D R 0@2/P @C60T0P0S& 0pDۍ0S03/P 0V P @C60T0P0S 000}߉0@Sp@-P3#c@P, PU U p(0S 3/Pp 0d x0 0X x0 0H x0 0< x0 00 x0 0$ x0 pKKqNM-@QTMh 00 B 0SP` VD3 ^ )^ p Q$ pG pp00 00[ 0 0 0 GQ0 00000r vPRPJk p^ p7 Rd   F$R'R R @ $R   @  @ pG p p00 00t֛1[- 0 0  0 0  F$RR0R00 0@ 0$R0 000@00 0@000000ᦛwU p[ڨP6 0 H00Spppf  F$R!R0 0R00 00 0$R0 0  0000 0   lp<pp000F A-pQ- 00 A<PA[P P!P3XQ`PM@ `Q @EC`P ET*@Q@F pE0epppG0GS0p@G00C  0   00@@e@000CS000000V@ M-M@PPS 1BⰀ᳠ᗇPP 0S X6`V"切%B `WP?PA 0`0P 8P2BP` 1 h BP0:SP )60U0*S000U ,RR[P* PPЍR PA`@??0PPI 0` P4P`0QXh RHc `rpE? 0RQ 0S9 0SX S) Q60SY0 S# aVڴP1U[`S `zF 0 1G<0F+%10&10pV0F#&! &!0A lAR V0 %Z[A % J?: Q0R 0Z-  n `0VP0hd000 000! PP(lPpP@(p ᛙH` ᖙ ᒙQ 0 Q 0 Q 0 )L@P 1 @ d !"!F!i!!!!!";"_"""A-0`pP?P0S@&@  # @ pGo Rrp#W  B$RR R00 $R0 0 0 00000+,9SY M-$@.MT `?` PPp W p P B0 0    0 01 S   S 000 90 t1S P0<0`0@SI S451S2 @0`Sh: 0h d000 00` P20 0<0 0S&,9p`P(pPp 8`1S!V0hv`d000 000 0`P 73/&00? .ލ080` p刀 9VE_P 94X1Q?dXd`r 9V<0S00p"0S  p pGT2 R P000? PK:_0?0 PSP,!? P<:   2`1`S ) %P? PP0  p0` 0ᲀ0   > P:    pB  6  !R -=  $0     0a  R ,O?00= /"ɋ"#P(M-`[;P @,9PP@Pp 9Ѝ,9@P 00 P@ 6pP$0FS030# 0 1 00P0  PP01@ U0 T | |0qA X Q T P ,0S 3/aaA-p@P`[1P V1P pP1P 0 U 0iP >꾚Ě˚.jM- 0 0t!x0 0h!x0 0\!x0 0P!x0 0D!x0@ p4,݃ P@`, p(p$w UPT@VT`  V U  000T~whwwpKĚ˚(P004 S0 00040/ 0P 0@P /0AP 0Q@- 0S/ 00/A- 080 0@T4 s0@DT/ 0`n=" P0SP$0 0 (0, 03/ 0$ 0 0$ X= P0R :8Q=080V0@F 080Ѝ;#@-@- 0P/ 00 @-8@P @03/0p03g!=;DȋT00S / 00S @- P P0ɋpM-R`@p0 0P@T }=P `@Ѝ@0x0PU [ hf=@pW0 0/P0 U=PPpq#ݴ0@-M 00C@PT 0P0@ 0R @0 3/P Ѝ0 3/  Q 0@U  2/P IIIA-p`P @P p `P0@@0 M-P`@4p/P@T\<M-@PM KKpPP 8<PPЍ`0 SP@@P   0$N$ɋW$_$j$#ɋݴ$+$$$$@-@ 8;0 ;P  }$$ %p@-@P6P 0P.S0Pb0Cs0SP Pp ?M-Pp0`AP @T @P  :PЍ @0SЍM 0RPV : 00 0 ;/VP :0 u00*%1%3%P@-@PP@-P Ѝ@-B*4S 0*4`pPH P`UU 0ES2xX$U$4p0W$4/ 40 4hъP- \͊P) ULQ;0TPEp`44S$彊P (4S 4 $0#S  4P04V Ѝ9❊P 0`0啊P(4$S T 40?s0S0s0R $s0Rk o okooA-Pp`@Ѐ,P0Qu@Ѝ@T}UBPL P0,@, R @ W   U PT |] P ,'' 0S E-@;QMG QD qs ЍE9'Q 5Q Q kQ H AR132 I0^ (}Q Q l9^00I00  0D9@e 0S 0` Q6`젂I0^ f9KI`V$ pW! PDT0EEӓ먦 4` 0tD9Ѝhd`\:9TЍE&%%%A @%%V%&,&|%7&e&A&H&W&\&&A-P 0pCX 0@Sp00T03/P000 R `V03/P`@ILJIp@-@PPp@88` 0 80Spp@/&&0p@-P0P`@0P 0S  3/Pp\p%pp@-P@P000LP0,I+ F+PPpj$'E-@p.3PP 40@E0@PpG0`0S  8` ЍZ \G0 0S H P R 0HSN`܉/'M-PMpx `U 3P `*P T}PPHO8@ZЍ:2P  ^4 J @P /8Z R *P F R0  h8@PZUPP2 R (8@0@#@Z@T 7\@ 110001QR 3 #120z z @PUL  R  U ZU(7o @P 7eR  Px ex `,` 1P 7  @x    `!PQ3#!" 1މ['f'܉''''̪ ('j-(M-p`PP@ 0S@ %@  03/P )P @0S@@-0kS`  HST  P SH  < <;S 0a0(=4 Ѝ }Sij(Tb(p(e(M-p`M@ 0x ?0?0@0M?0K?㘏 XL700 K 0 |dP  7!UQR V1K 0.0P0 o/ P60PS\. V P\* 0 S<30 0800 080 z,,W)0 0C?o2R00 L0K03% KPz0u0V P P\ PUPPUPP 0 V8 0 ` q R PyP0000LP S<3,0)PPnojw(@-0  0HЍp@-P@D;p㐐 P3p@@ᆐ(A-`PP@pz0 @|夆P0 H|坆Tp@-M 0"hP 16< fP30S S S(fP zx|6 ~fPI D\B\ 60S<!gPx @0Sy0(5 yfP`q @ f1PPA5U5 cfP " )KfP[0!SX 0< Q"   @*0<~0d5Ѝp <.fP <>2P(!1P!B@L*0(0<P!B@L/(L B|)@*0Q0polm0gP((؉(((((ɋ(J)^)s)_ڊ)ɋ)*)M-0#,`(V0p0W0R0P@0`F ?o2R0S [ [!  PA ^@ 0 (pЍM/   R @TP 01Ѝ./P@0@`F@P0U 0 P 1PV0 !@@@@M-MM 00$0 00, (0'pP ܍Ѝp00P 000A@S@q'`PA?  R R0 R `0 R R R   V  <01V$0J2A0ŸA0 0@FP\ PKT T T@@ <0a&0@00p@ 00PTm $ `V=W^Z00S0_000(0@@dZ0` 0@%?o 2$R0S T T 0  ]P P P04[2 /PZ 0 V^[ ^0S P@U T T T <0a/PEU0@ p/p/NP@|Pt4,/`0MSD8PGP ꭵ0*6m۶0*SMM- M@40 TP`` pPw'?p?p@pM?0? 0|=P m0|6Pg1RQa 0R Q80 ,` Xp ,K} B U 0 ,Kp, 00SB 40SX<(80, S 6:04 S 1:h0S ,K8` ,K0P& 0 h0lGPpT0 `pGᰍf!@`P ᨍp0 H|ӃW 0 0K1S l0h 0`P0T @UX0P hIGNOREMEEFI PARTs@-0P `@NP ЍpT0  BQP0=P@-@P   ᲋ /PЍM- M@p[KPD$?@?@@@MO`?` K P UP D3@ 3< 38 3P0 U:KCPP !0 $"0(#0,( %0$(&0-'0)0*0+0,04.8/|Cp 0( l2100 5$203(40,46<87<2(2 2)))))**$*I- Mp@`[P׌0w'?p?p@pTM 0 K?? KnUPP0 pS*D@DCRP !0 $"0(#0, )(04*8+<00C000d 0  ?T,$ H.o00 LPo/iSj'p@-PPp0 04@0<@D< 40Rp$<@0S0 // /p@-P`4@<@D<0Sp<@`<@D0 0 0 000@//PQ00P/00 0100/P 0/PR0      /P00_ 1/PR0    /P0_0/0@-@ ^Q1\  0L10S*0b0P 0 <00S /%/P 0 <00S /%/A-P@U$P`0p0<0S P 03/PU%A-P@U$P`0p0<0S P 03/PU%@-0@,0S Pi00 0040S T$^0$00S 4 R 00<0S T(L0(0D0:D0  ?p@-?@@PP  ᬉ^p?p@-@PP9 D0 5P,P,P1 004P $ RDP- $0S 4P 00<P (0S@P (00SD0:D0PPD0  Pp0S@P PrL R3/PP p@-`< <00C8@PT@pV#P D@6\I6A-Pp@`P W @0 000`0 0bЍM- 0P`D 0pP,0C + 00H0 0+00@44T!(|04@X`<@D(p<0U0 < 0R  <@<@DU ,0 ,0C,PV40 SV0@DS  @<@<@D<0S X *X@PJpZЍU   0@:,h,c,JE^,L@-@L+H0S070A-pP0/ ##c@_ / 0_U H4Hs0@D/X 0_H4Hs0@DMbA-p@p@`P_`0 0P_`_@00 AA-P_P0c0X0#C p_W_WB/`VMbp@-P `P 0r @P _@0 X0@P0_pM-@DPᰰ0 t `_ މXP!`PVT0T @T_0 0壉,0 #.Ѝ ʚ;Mb@-@P@ 匉dʚ;A-@P _p__`` ._ _p_`AeM-@ MPPP/o"T R0T  p 0Q7 `0@ P 0zQ _SW5ڈ 0 @0S pW*  0r 0 pBSw00S Ѝ \A0_0_( 0W0PX`@0_0 0P _ FpG_Sk 0 X@0 @0pX0GSXWG _ _( 0 p0_0_( uPp@-@@4P0 gSp0S }pE0P0P @-}/0( \/0S/'m,0<0S 0S /%//M-P00<p0pS%c b@0S  ZJ TG \DP[A:  PR<:^   0D0S0Q 000@0 4/X@A000 0 0P90S6  S.   AW  00K 1!姆 000Ѝ R P  P0 0 0 0@儆 D000M-Ppll@`Tu 0S 0S  0 00C0@`A-@P0  P@P6]Pp0`@  $ 00   "S 000S0S0S@0  0z D00D0@03/P Ѝp3/P 0(0S 3/7@-@QP @P, Ѝ0@)0  Ѝ0@~,M-P`p'%4@<@D<0SX #P<@#0 A- @PP% `0 y)@p倀,@D,0 SlЍAUD0@ * 0d)Hq _)$E,@P,@DЍ,,,0@-0L0\ G4x0s0_@@00CS5\ \ 0s0_0s0@@0?\@ \@4O @_\ \0@3_ @@t@@0t@0A- Pp@P0@$ L "^h\\\\Ѝ00 RM @ # 3\ RC ^\@\\\p0000`s0_0\ \ \s0_0s0?\ \ \_03?\ \6o` \@P_@@P! 000uSP$//7@-@P  0hP  Q1 0%J3#3?&0% Ѝ00 @- 0  Ѝp@-@P $LPP $P@p,p@-@P``L`PP  $L  L$p,,p@-@PLPP`$`3x $LH 0%Pp,,p@-@PLP PPp 000 Lpp,[p@-@PLPPxP 0LhD  0Lh, $ $L p p--,@-P@ @ LtP[p@-P@@P <LeP $05#0S0pp[7@- 0h2@P P#U@ Ѝ0@- 0h P Ѝ@- 0hV0@-P@M 0h0 0 0 0 1 0 P p !2/!TЍ0 pJ@- 0h P@- 0h@- 0hs@-P0P$P00L@H`TЍp P0 R05@&-@- 0h1P 0 hO/A-pQPP@TP`P@0 -Z0P0U0S` L 0   0@-@PM0@L PPeP0000 00Ѝ0@EM-`L~@T30ph"Pe"b"_"P PPPP 0jjjjj 00 0(PN@ ЍC-F-0@-\MlP h@0 h@P0@ ?000Q\Ѝ00@-@0TMP0L$ P+TЍ0V-M-XMLQ 00XЍ@ P0P0P828"hpP$$U*LP QxpP  0 LPn`G8UeQJ 0 P P9 pD;80 pPP x` 0 /P P0 ST  vTR <  R 2/P&p 08ST`T x |P 0<P 03/P%V-c-z--@-Ts@-PP@ D0 @Ѝp Py@P`@PEP.D00D00S/ 000S30S:0SAL0S!@P)0S?0SA 000SI0SK PC@P :@PD0 000ZS y>3/@P D00D0 00 0S 3/@P 0$0S 3/@P 3/@P 00$0S 3/@P 73/@P 000ZS<>~h0@-0P`@0P ,L  ЍpQQO0Pp0,,@,QS00@-@P@:p@-P7@P pE-@PPPM0S0 0T0`0`S(Pp夀0 PP 0c2! 0&P x Z 0P} P iPUЍ--Qp@-P@PPp/0@-@0  Ѝ@M-@`P@p- V@P  PP@  ЍM  PP  X ,@,@D,0 S@P0@-@0  Ѝ@s@-@`QP@ Ѝp@P0 L V ,,@, R@-`@ PP"pp0<00S 3/PPT 0<0p0S  Ѝ@/0SS 0 !P Ѝ7@-@0P0L 0P   Ѝ0@KP0 $0  6P 6 0 /-7@-P@T "P@ Ѝ0@-@Ѝ@@-00 Ѝ7@-P%@wP 0<00S 3/sp@ PU00st0S Ѝ0%@@-($/#sp)#-@B0@-0@P0S@@-@P0S@-P0S@@-@0SЍP@0@-TMP@0"( (0P0TЍ0V--A-p`M@P`P`p0 LPPpQPQL[P 0S 0<00S 3/@ p`_ "p_`_,X}d`H p``Ѝ--ʚ;@- 0h@-@P@0  h7@-PH@d0P 0 P 0S00 Ѝ0- @-P 0h 0hM-P0 0$0 M0USO Lp@P`P@P@ ЍP@ }P PP @ 0 0 0000`0h RTp   0 X0 TP @@P,P@[--.@-@PPP 0vPqP 060\fPLaP<\P,WP..-.<.L.`.u...p@-`Q@LD0  _P pP 0@04P 00S!7"tHr q?P(Xp 2(r ?PXqpwpW ?P 0S$ 0 S ?@ ?@P @?000 1@1m1112E-0$#4?7SM?P?P@pP0S P p ,s0Sp"2Q0/$+Ġ56;s" |25 5Q0Յj0ą0 CR0k0 `f 0S iQ  g 800008000 p0Pxt0PpQ ?007pݠ嚃7#96ሉ0 ^Q  0$(0 023")&90 ?Q-4;$-0 0\  >pP00 P h000 0500S``V ?4;$*0 c500h00S2x0pߍL0S%203#0? @@A-0@0 M2,00<00S 3/P zP Ѝ PU"0c"0c010P0+iPb 1P&p] ,0>>,0$iPP0<00Sap0Pl000PQ i)R^PPh0 P00 10S10 00 0hP0S10cq封70 000 hP<)00000 0R0 0 1 0hP*0S`VD 0<00S} hP 3/P3/PPn00S?00 6Q(B 0P0_npP\`UP00SPdP00mV^P>,2B2N2[20@-0 PRMߍ0?@?@P 0R 0R  0R  0R P I@/0P0/-\ //-|/x/-t/- 0d/- 0h/0@-@ R *P PT:@ 00@p/0//p@-P0 0 0 @X03/P 0 rs 0S 0 0 0S 0 p- 0/- 0/- 0/0/ 0/ 0/@-@ 01/P000///@-PM$00  0`@4/Ѝ@-PM$00  0d@4/ЍE-@`(P,0pĀU Ѝ 0L1/P 0@00poPE"800S"4 00S"Ġ$\ / 0   0      01 Sr0 S00s04000/@-05DA 4/PݥЍ!0S/Q/0h1/Hb0 50/@-@ (P`$0 `1/Jp00 00C0Ѝp0 00C0M-@p W00:Ѝ0S 00P:0S. 0l1/P up000 Jp000 0(`QV  f0V 0FQ2SVp  f 0F7fb:cPE0 0S qP10q`&p@-P@_e`0/0/0s0_p`V p@NC6p@-@P0`<0`S%M" 0 000<0H00h H0dPTPP `(@P-QP 0T00X 000 0A81Ѝpp\$6,6@-@P$@pP`UDM qQqPQ @ o X0p P`P3/DЍM-`@嘠ppG0S 0R PP 80@pC0 P0 080086@-@0P<T P010T00S 8 $0P1ʋa6@-P$/( <@-4M@pP0 `o0 !0 0p$`] 4Ѝ@-4M@p`0 Pn000 ! 0p$PEU  P4Ѝ@-0Q7S5^먧 GECA?1.?\`Q_Plw?P`V 060p0@0000$ ltp$P,0(0\bP03? (02/0(0 03`0 Q 0 Up UrEopr037 70B/00&(!B 1+b PpGoB?0rpBq 1bpPUP URE_oPRPb%0Q0S1p0C?o2l0%K70p86 8p07P 08@0x00Q_Pt0p00?Pl plPP0E< 2/S Q6 S$P$1q0 P%  ?70U  olUXP1 10S<t0|0a00 0t h4 `4000HP1QR 3 #1200 10tl106 05W cX0_  s  S$ S( T #7 7Q7i7@-0@S$0P@z0<00S /%/D0 /R$ /PM-pp` 0S@! i0PS{@ qi   5@P ZVt @6`T SM-P@`(`00c0p00 S 0C0s0SU㐴 R  |2 Q{h` $p_p_ 0o0 0 B r /o᪢"  U RT U Q _ 0.  P" +"R% 0Pt S0 :_0_0r0_ 0 _0 0$r _0 00 _ ' 90SP 0; 0`  _$S C4  0C r _0000|WE _ 0. 0   P :0(Ym01 0$0_Ѝ00_ 0_0U0= p`00_ aZ0 0$0_ ) _0 00 0R$:000pWG*t0 00S  _00t0 `g_0`0AQ0 0 PP _ _0 mP0@ c00`__ 0U0 {xi ~P B77Y7@BLB8p@-@P$0S 0S 3/0Q 4^0S .^0( r _0Q0   0 (!B BRQ00s0_ (0$0S 0S p@/  0Q00p@-4$0S 0S @/p@-'00 P@</P00pop0$_00PppA-@P`p0$0_ U 6#S:RT GPmM-PP``7@$pM0L@p,_A00 0 0Q 0 `LP0 P P U&Ѝ0100200 20pLhL P0X00LP0@ 00LP0( 00LP0@00LP000LP0<0LP0<0LP000LP000LP0;0LP0h;0LP0P;0LP08;0LP0 :0LP0;0LP09 LP080LP 090LP0 20 0L^0L00 h0^ @ _0 0 0( 0_#800000 0D0_00SQ "q?PQ6#?s0_|! H         C 0   S + 0<0 R000?00) 90__SD<0P& 00@0< P2g0% Ph    n.`   0 @0C04@20_0 0_0 0/0S?o 0c0Cs0S  S#% RS S _ 0) $0S 0S 3/_ 04 _08g&B60 00_ )0 0:8}V_/j/R8UA8x888888888899"9<9I9W9c9m9v99@B5A9 9C9;@-@ HP0Ѝ@ 6 Ѝ9M-PPP(M`p@PP(Ѝ Z1PPg`g` x0S 0G0 e000C  PU*`GQ 0S V`!0 S|0B Q$0!0# 00 0\ P0 p0 0[ P&000 0[Ph.PP P :g:M-@P@8M`ppPP  0P|P0`@0X@10[ `V0 T. p8ЍT( T  !| P  $   @[ P `x T 010$ 0[P,.P|0X*F0y:r0E-PHh@`pP ЍEO TH  U , @T  X0RT@@0T[  84 T (/ E@ΆU::: 0P1/ʋ0P "/ʋ7@-0S.8188 4@ @0(!QU;@<000040PSL0400S  C3?0?o $0R B2/ /o30C,00 ;A S( 0 Q   01/P_p 84 0@SP Ѝ0`B:::ʋ:E-`P@p T UB 0S9000 Ѝ0p/S } 0TGP ؠZ0S S 8!PUP Z 0S P <R@r 3/P P:  BR #@- 0  ]  0S//\A:::M-00pQQ Z/ P': R Ѝ0 S``X*(PU  e0E 0EAa0⸰ἠᰁ$P(`,P00.pP ,R$  8Ѝ !<_/j/0-H /M-00M00pP cQ0`40, 8 AgPU@PS [XA0 .$+ `000 03H.@P@T:`H@P4X@T.P0 X0`000`400Ѝ `00 1 0 1 0`TA T  04/@.@P@@PE-p@(p$@WoMpl`oߍ\ `PH7HgL1D7P1<7D147aH1,7a81a0 TPP W u7 41Qi`1 00 0100 00000LP0000 `  !   +" (`&   00;3;06080800@ 000;5k0V05X00 0;0;7t0v05x00ȅ 0嘀90;9 000`(  ؀  @ 80200X50\%0- 0S( % S' ,S% 05" R Py P0S 0R  Y`$S4041S 0S 3/0 100|$ j _ a`41S 0S 3/80S0_oH0$,8`0@00000;0 3X03`03d00$10$10 $10$10 $10$10 $1 0$10;;001000  00081S  3/`P!0 1 1S1S0 1 1 1S 0q0*0 10S] 0 ^h?o2R0S 1S$1  1/`Px RR00R0S0   0(10Ha6/Zd1S^ 1S 0 R  '010101011}!/t!+h!'`WW`.'0 1 0041^ 1\ 1 S RS S0 1 \0P0000S`u*3/`P </0|++,1 =a<_/j/``o=c$ _.=N=\=wgP P 7 5@@o//P0 S2  Q20,,(0(000S //RS(01<_ /SR/@-R BSȌȌ00C_SR@= _0S0 R _0:H$0 R _0:&/r- 0Č0Ͽ4|8<3?_Ď_ʌ40 6̌ 0_r 1 1_ 0@-P  _0:0:<_ QQQ /Q_g0@0_<0:<_@/_ 0 0 /D΋00S 0 /@΋D΋ 0 /D΋/00S //L00L0/0 @ <   0000//-P$<^  R*/%R R/0p/0p/p@-<@P^ %p R: pp@/P$p@-P@@H^\U ^U`Loob`V R  R/  p<  _\2A8PA#^U_<R # R( R0 0:" _ _P _ P04"" ?pb0Q_0:ƒ 000 4_000C0_0 [ 0@0 L`P P 0 0\`M?_Jo0 <&"(1S LL41S M~L`Ѝ 0 *00CS 0S ? #0  w*00CS0S  40!NP0H΋QEEjEEEE?wE0 p@-`P`@0\0 R 0H00@ \?C"0C" B 0%p M΋@΋΋΋̋p@-dP0S pP`0Sxp@P00 002@Ppp΋@΋΋A-PpU 0MLPU$ A`P 0 P ` Ѝ VdV 9VV'00V00S H@P   UX@` \TH |000 000A-E F?F<ÉKF@-U 0,0C,Q ЍH,0PM-PPH0@$@s0MU(Pf(]H0S   UR P0LL 0pwH , PL 7` 4 5 , 00 $p0,fV 00+P / 10 110001100S$ 00S `|@ R $ <$ @ p0SPH0 00LPt0Ѝ,0 RY0` 02 6o0Q0. $0F`Q (0 > 0jL\: L\:$ $0 Vq$  ``  00,0 p0C,0p' pS`$000EVF@-`0 P0p@0 bP 0 #120uS<Ͽ \̠1Q\ 03?#,S8 0 Ѝ\̠ 0E%I$M-L0S7Pp pPL ,@P" ȰX`V#: P  ,R R.R ] X0L 000<0Ѝ`@mfzFM-8MU!P 8Ѝ0LP 0PS@@ 0Ln`ᠣV TP㈳TߦݦSPG PPB 0< LQpP8( KPpp0  ?P 0S000( P(0,0 0P 00, 0P`Ꮶ`D$ gP0 (2 h L<03?@2h~s ~3H` 0H04j8SD :< 0h00d Q0a@I 00!<0: __<0: <0l0_?>P@0_< l0T0( q0`(p " P)PC(00<00S (3/P   (D((8(Z tZ$000 0T0+FGLFFFFF G3GFGEsGGGHp@-PP[ @TX < `Ln < PLi< @Ld< 0L_< LZL$L% LM L&L PP020ĵ  24 6P 040 0=s  0C?o=r20S,00,00=s  0C?o=r20S,00,0pp5HMHeH~HHHHHHII-Ip@-@PP PpP@PE-PM 0L`PЍ@p嬀`TV  7 0SNP p P 0DhP  P@mIIYI0<0S /@-\ 1A_ `014C0@>'P\ U ># 0 0\ S0\P P   ," R ( 0 e Ѝ؉owgW0M-`⡁ Pp@P@ U 0_P 0 U:P 0v' %"0  01_ ::_ 1ЍD0@-M0 @P43P   Ѝ0EcI7@-@PMPHQ Ѝ0@PH@-@PLPPP(L.P( Ѝ(`Pcc R 0P0T0S 0(pUP [I0@-0P<0P0$PS@TM 00 P  P <00T000L0 40D0D@80<0@080<0堻 3/P TЍ0wwx~x 0P 0Q S000#R00S @-0 C/ ?p@-@P@PC   C Uҹp p@-PQ CC @-@P@C @C p@-@P@`QPC` Cu CU$C CpE-@P0P`P`S,M- 000US(LZGp0!L0 }PAQ ,ЍL0 oP  lCp 0 L P0P0P H1H!hPJxUpP  "%P12SX 0<0 0S t%P T@@C@ !C C C C 3/P PXX T%PP--0E-@P,M PP0p0p  0S@ 000US L L  LL}/Pn p0S6_`刀   |LgP6_ ``W000pp00&   ,ЍIII ,@-PP00@`pV0  Ѝ@V PB>Np@&K@0 S P P0 : Pp ЍP00 0p@- P@P@ģH$H U00  hp_/j/IA-PP00@`pV0  ЍP0  PB>Np@%K@0 PP @-1PD @Rq`; p$0 CR 0CS 0000p0 P@P P6$0 SST'S T! S0#  p1 P bPp0 P Ѝ@ P S0# 1p ЍZZlIj/_/p@-q@ P<0p@ s0E-PPLp`p`PMLqEpU0 \#\\@Ѝ%P@0LPNU@@0 0?P 00 0P 0  '00Sq c& Sn [  R  S0U00z`V`} @P9 s0@PO `PiY @Tm@0 0 0n@P U 0@ /0|!|@ C @P U 0@ P0,!,@S P!S S `'S " S% S %Sh 0 z@PZ0 s0@PP@NP  d@PD@@DT0 1@P9 @P3; s0#O+_/j/JS5JDJbJp@-@P`dP`  P p/PUmpp@-0P`0@S t:l0h: `0`t L @0 0 "pppp@<΋V8΋V4΋00S7 @-9P@, 9P) 9:P E0p09P :l0p9P 2P0P @L00/@J0΋,΋*΋JJ$΋ :$ @-0 0@P-,΋*΋A-PP`p@PU $@P L0 000 $ 40 0C8`0DpHPS00 ( , 0 0S 3/P XX  " 804 40WW`AJJ\J4M\JJ}AJZZM-0M00Q`@L`cp 0P40S5P U00Z3PU0VP 6//ob0T!}P00 @ 0SW   08 0 p$0 0Ѝ3/ 5??oZS:o0 ,2@00< ; ;@0 0P+  s0PPp Pp  Pp, <0 < <P s0PPpU p@P Pp  Ppp@- PsPp?M>M @ @ @ @   `Pp  @ @ E F,00,0(00(0hp@-@=aA-p @P>w0` 2 4P v0(A-p @`%Pw0  1 u0@-@9 0  0 0 0 < 9 W=p@-$0@ 0CS  $0 CR S Sp0  0 0 0 s0$0S  090 s0$0 S$ 0s0  |P 090s0P= 09 0 s0B=<p@-@0 tK1 oD1 j(< eF1 `32  [M1 V <  QY1 L0 G$0S00 ? A00s0 4 688 s0)0 $d$0S  !?09 0$0 0CS0    ?$ 0 BQ00 R 0 R0 0 <]< @-@0 p0 0 2 0 ;<@@-@0 P@wp@-@(< P0 00 u0 0  p@-@0 1 0 2  `0 } $0 Sp0q; o9 s0c@-@vPA< W@@-@0 N 0 I0 D0 ?< :;V;@-@0 , .00 s0!0  70 "=0   p0 000 k;@@-@0  p0  00 S;  0 0 0 00  \1 0 8 8 0 @1 ;P 88 s0p@-P`@q0 v0 9p@ s000S/   UR/M-PP@@p`P0 0$`PP <00_s047_< 0<0:*_,_<0:*<0::_88_< *:D H00Cs 0P H0D 00CX0DPH0d h00Cs 0P h0d 00C0d00h0_0< *8_< 0_< 0_< *8_< 0_< p$0 (_<0_<0_ < R0_< *8_< *8_< $*8$"0P]0E_o0 PeU 0 0_< 0_ <0PEP P_<0:X_<0_<0 H0D 00C 0 $0DH00Cs 00 $00$0dh00Cs $ 000 0$00$010<00S 3=dP<0::_ 00_<0_<00 0C0 4 20_<A 00P ?PU EKKL5LBL7@-@P=0S R R0 Ѝ0=A-@Pp `\ 000US ~0<0X%  T#*0 p8/Ѝ@-@P` p\ 000US ^0 `r Ѝ@-0@ P00ЍM-(M00@ ` 1100 1O90pX00H?o02001 0 0S=0~#X8P0P >9 &9 0S V0   B  BP:0B0$9101$ 2 S101!9 9 (ЍM9 9 8 P0Es 0PeP!1j 01p0S 0a  8 $ 80a R  A B  A\080S 8 pQLM-0M 08@P0@`00 0 '1@` @`PpX0P 0:iXP_0T0#3Ѝ@ @-p P@@  c800S4 H`Y8@?T@  0R W #4`V0@ ЍM-@PHP$0MX0<@00S: 00000S 000 T`0$`H $ 400080 Q0 R 0 S:308 R 0 S:304 R 0 S:30T<TPU(p0WpGl X\0 0<0pP/<0SS  D0p0V`D 0@0؃ L0`L0#4L0u0H 0 p0 T@D<0T0@0X0L0d0D0 , P0`P0s #8\ `00LH0P5P`!`* B : S&d* 0 60Z00l 0T0X Lp0Pp0[] p0p k p00#s00U QPP0q TQ6q XQ0q \Q* q `Q$d! 00 p0 000`/0P6p0  H0H0 S 0 < @ L  3@0 0,U40H 5p$p9P 0Ѝ ZH000 =0P 00s p P 01# P P P 4 R  P*40R  P*008 R  P*80LP"pP$: 084 X6#R 0 Y7 6700S70 p?lP T:50P 0 8 68000P0$  0084< $0"$@ 밄9 Ⰴ69pp9pi0H @(br 60H 0 Cr ~6 z6$0S   B"**  "(k6303[  $ B"**  "(\6X (T6303Z   B"&&  "$r H6W0!@6303pPR P 5K .S223F p 6p0? D 4: S7`P2PеP4 00 ,00H $000L (04  005븄  52P ,0 $# 5pP= 0SlP0$0H 084p0 Cr 5Z  " B"**0"(0 5X &p < 尧 B"**0"(  &0 5Z ,5WCpWT 00Sf 0S010#0,$ 5 &5X. (~5 ,z5% w5 s5W1 0k5 2g5($X (`5 $\5up K5 p B"&&0"$ 0 K5X 2 B"(A5 0 Wx>p ' >'/5H0SPz#LJ\JLJLLLpLLLMQM}M@-U^P ЍmP0P6Lhpx/ S/////|/x/t/p/l/h/d/`/\/X/T//H/MNMMMMNN.NENRNbNlNNNNNNA-@P8 0 P@T6: @T0  @T*@ @T$0 SP  0 0^0  0P   0P  0@o0000P0/Q / h0_00_h0/00_0S/00/>80/ 0R/00_ 0@0/p@-`P@000000 0 0pA-P$`pQ$C PU $GQ  RP;>@^>DM-`Pp0 S0@0000 00V0000U0  0_0  _ 0_W0UP`F0 SU@-P@$@ LbUp@-PPL@ @P @Tp0 00 $LKp0 00pUUA-PPL` `PJ D8P / p$Ѝ0 L.,@-P@@LT2pA- PpU0 0E2`@@0 '#al w''l  0?`0 0P?P諪QP5 @-$0$$O ???oDV::0 p@-@P11 (  ! !":@000pp@-@?P`?0* BV @ 0 Pp@ VF0S`ApVA-P`@@DT 0q0C0@DA-P `pᬎ@P f:@ 8P "\: .Pߍ@ M:010P0( 01 0qa000 0A00<0S 0S 3/@-@,0M ⑴ЍыWA-@ &MP: ,J:0#SD  :1 00p0(37 0_`?`00 P Q2S /Pf &ލR,: \:04 0DR2 ?23?2Zڊ'AW=WM-@0PM00P 00HS $@ $9$@0 HS00 @@(D9'020OS%050t@*0T <9<03?$0T1#40 0S*PЍ$0""#(#<000+00. @ 500/ 0400( 4JpP0S5  aa00`00 <0]9 >  '0㒋+<39  0p  i_ 08 8 _c08 _ W /pW 0 @D00 0t@0C 0$0 0$0FW@-@P$(Q QP %Q QE <8HQ Q' *Q Ѝ@C 0P}Ѝ0S0030 '98 0 90Px 01  9 8  0o`Ѝ@;XkWW_00_0_0@-@P@pP  (   p@-0P C@@RL \P P032NE1n0oh/ b0 0m!<#H  0,< 02#2 P pQ*uP ]D1_'!1P VM-XMPT@/T0S  T   X)P$@ # # 0#0P_T?WsXX S_ _  _&_X `_!  __P_ _ _$# p_$#(s  ##V: _ _ 0_3_$S$`_U:0CS$41$ (# 0000U400q0 0Q(Q4!i40H0x40L0l400`400T400H40 0<4000400$40040 0 40 $  ß@ sp܃ԣc`<4pp(U$ 0H L0@`80,,3H03W@: S010#R 0LXЍ &  F"PSP_  H __aH ___ (L H_PX NL H RH037 w P(_Q H@p  L `PL ྊ   ,*7, , -` _` __ _0_00__ 0__100_n _ P0 _R _0  _ H(_PH .Q( _ R`F ^0 __0  _R _ _( _ R,# ,#`黎@YXwgaXfXlXrXxvX{XXXXXXXXXXXXXZXEYX YvYYBYX7@-@  (*$ P }7 R0 RP Ѝ0@!p@-@_0 `0_d0_h0_p0_t0_x0_0_0_0_0_0_0 S _ t0 _ L-p P"$ _ _   B _ 0  ` A-< @|LH.ppLCP`\`L岺P0Fa@L嫺0TP$P`0 YYYY7@-~P ㉲PPUd~ Ѝ0a@P  8r%,nphZ0ZcRZvZ@-@P00/QQ0 0 0 P@D Ѝ0@AT00S0 ⊽P0M-`PpPU@ 0D0@DT@0 PpPE@-P00Q0AQAQ,$0R0000 Ѝ 0@0000S01s0R0000 p@-@P4PpPp@^pQ@-\ 0$ 0 ᴽ Ѝr;s@-@P LLPP`NP00 0$LFP000ЍpZp@-PML@PЍd@P\ (`@HpTR P 0P`{@ZZ<@-P@@0 0LݴP0S0000Ѝ[0S0p@-SP @ S STpT@Pp@墻pT0@/A-p`PᘀHMUHЍA0( ∼P0@S@0#S@1@!T@냞P @T 4`PE꠆@- L0 G ЍZ@-PP0 ``X@P0 0 LP 0 E@P0ݡЍp 0s000  @ @ 0H 0L0 O0( 0L0@PZZI[/[@-@P O "p@-@PPPɮp00 P X忮p00 P 0_?3_ 0pp4e_[g[7@-@P PPp 00 ‮p  yp  Ѝ0p@-P@@0L`P0 D0@ h嗙P  Pp[[@x}P0S @-&/ %A-P@0p  0%`P $OT3?@P@T*,%m@W, O&PЍ[0, F&@-0P<0`0pSM 3/@P U 0@ `Ѝ0L L@+0S@ R@0 *[_/j/M-Mp qV@P  ЍP  p@1< 80 @P`t1V `X0pD0ݴ@P80S ( 0Z(U0$0 R$ X0V 0 S0@0@PD0P U 0 0 pW `p 0@P 0 W \ 0S S @P ?<X<_/j/A-00P0<00S 0S A/00 0 0*``X$p %@P0S   %P0S  %P  R  B/o"%oM-M0`0@0sR E2000  0^PZ 0$ 00RP -  0 <  R ^ 0/ R   RR* $^  R R$ $$0S R  B 00S 000 0 0 /P0_07@-0 0dPU 0T0S - 1 h0ȖP0S z㦵P0S d0@P z㽴P ~0 C PSP Ѝ0w[[0_ _00_Q00;0000/0_s/p@-P$``P@@PL(p00 P pU40 006_(  $000p@x} M-P !@!00`S00ᶡ @ 1 @l0p00<0S 0S 3/-@&0 00s0_ V 0 @P:m+1z S_ 0嶡 < R  R 02/0PuP 0 1Sp&P_0( 0QQpЍ0S 02_ 01SPp&_0( 0QQp꠆ы[M-P ZM00400P(0 0p B02s000$0,0p40 0@0 0ApD00%0w 0(0tpxp|p0 p00m 0U009*u0P0P` 0F @ 0DP 0@F@00V08*1082 08 C0C0200 8 R<0 0OP8 <0 Ѝ0PU000000R1@00 |$0$ h00lp0$00`@0C7 0 X00\00@d0 0pP, 40S ,)(0 S 0 b00 B 3R^\ 00A@ B0@@ 03  R 0 0T \@- Ѝ@- ЍE-PDMpE`@ @p/000*e RP@@E  z"0(  PPDЍM-@pT@PPP喔`P  @0 P > x /0<0 010 004 P 4P000 |p20  /D I/ ^/M-`P@0@ 0XM <U0 P! "V@@04`4080000_shPXЍ㗃P < P K/0 0_ _0s00S0$001(000: 0R/,090,0_0 0VPP1 0pW pP P%*1 F(0C8, _0 $0 00_( _, 00_0 _4,090,0_0 0'PP p 僂Q 0)“P @  . 0 00#0DP@0  PPU 0 0HP 0U!  B[$p嘓PP 0 Pj E劓pPIJ 0Sv*9PN$ 4P P { q H!@ .000 400 射! B$ $!$  |PP!@ . 0  4000 射!4 B$ᶄ ePP@ i.0㰄0 X@ ^.0㰄0 M]UX2 0 20D~.( Xz. @v.M R0W8 000|*3.0 3PP$0 0t 0 0<00P0 N0 PP L PP yPP ᕁPP '\.\P\k\ȁt\A-N`PpX@,@D,0SЍᓯPP,@,@D `u `\@-JP U@\0<00S /%/0D /0SS/@-P000 09 0 [ Ѝ@-@P00P00000  0J `P0S0 SS0q@P#Ġ s0 04s0QI`ЍpTSY`T   0C  s0    P ` 0#s000 0#$1Ϲ@-p`\M@p峷PP {900 000p @0U k BP0SI\Ѝ蠆-<^ /%7@-@P 勷T0 0  0 P Ѝ0PP @-@^@ /-<^ /%PP @-@^@ /0<00S /%/M-P0` $S00 0 P {.p PW4@ 000刀U&P,0P 0 0PF40^ 00p^6^YYYo^^[p@-@P` `P(PQ,I0 00p@蒍%-(,IpA-`pP@_At @T PU@--!R @00_  0_00@P꠆^PQ00-1/A-@PLPPVpP (LpPP 4$ 1a|_LPvv` !8_:_8:_8T $ @WT00V0S00΄ 0001pSh3`0141DAST3 4181SD381<1S83<10_00_03jPP/8`ꀁ2n06._p_p0SL/P"Ÿ0P0 0C 0420_0 0_0`_d2 3_$s013/U@1Sp00_s@` z'0@0 :`D0@0pP`T`X0_0` $e'``` 1S.P Q 0 !0 S m !_0 0_81    $  "$   $  "$ 00_00_ 00@0_0_ @000_0_Q(!3/`P zP_ 0 ` `^Ћd^TL\t^!w^00CS/@-,9@S ( Q $9    R LZ0 ;((50 00S(0Q 0(  _M-BM0, ?0`S00$0(1o$0媢 000 0S0S{((10S03@0vPPtX`  & &0 040001 0l0800w70@0000@(0T 0 4 8R$t0|,!0=1R,9T@DOo@B601@0 f(1@S@/80 p3(A7<000<80 0S *b 0pp R 8<D 2@0P@0D  y3 (@@0oP|00pSP @000,p0 '0 @0JZ@(0@(1S  43P# " @ 00@00倠  0 ,000000_?0_ 000_ h 0刃#?SCD0C  ,p00 '0P:00(0@ @000_@0_ 0 7PP00_  _ 0 Xl$0 R00S 0??v0S ,@PU00@S0' S S0! S @"0 0 0_ 0)0P5 4PS0 l   l  TH90C0 x0 PBߍ@_v_X____M-@,ip$?S04P T4S4S00 0@4/r P S tP0_ 01;1jS9 SD S0`0@  04#$R R RC ` 0T U PUPTU $Y ЍB'0`@`0`s0S|"Ax"`0)S\B` 0 4 0`@ q$_0000 00000000 000  00 0413/P 0P00 0 0`        00 01S; 00 0R> 080 0_000_ 0:00_K_*0 0 $R R R R.  0R R  1;10 000_ 0:0 0 0 0PЍMw?_!Ϡ\ 0/A-Pp@`P_ 0S | EP_ @T |m|p@-@0_0_0_0 P= P Lp0_0_0$0Pp p@0 `M-@P@00_ 0_0T00_T 0_0DHx0S 0 _0_@0x0vx0vxv0x0`pxPU$ @ 1`0 P  0 00S0S 0v0v0S 0v0vv XXv@v-%#ЍQP& @-$0$$ ???3DV::A-PR[\ \\[hd 00 0 00# 0p0 D8P0?o2000PPD 0T0;U `@ 0?; S1`T```A-p, P@`x 0UP0 0 P` 0()_a?p@-?P@デ@P 0000%,Y "|pCV::p@-P`v@P!t0tt p?`00_;;V000_ @ 000 pkCV::QP0 R/A?Q//M-P@`   p   0`& 0*@ @@D 0U0;T 0?; SX00S 00 0 00 0 00# 00 DnP0?o2000@A-@H `P(pP *!t0ttp,H%pGWP0X X 0  0_ ЍDV::p@-PD@D `T 0# +S# &P0?o20000 0D TS TT0__  p ?+ R 0 0?; SA-`Pp䀟D0 @D 0 0 0S 0S5S& /o"S" R "S 04S !p0ppl; 0 U3P U $@Ѝ`CV::`@-P, `@(91|0p: 000() ?!0P ()! R r/d0dd` ",R  H0VDD", ЍMmCBa::/aaZaM-,9PPPS`$`@(QpPA|0SZ%000p- @00# < R4 R430 )0<0@0S X 02"$0B R 8800 MpTCBa::@-, P4S00O 000@ !PG 04S " 1  4h 0#<(9(Ya|pW %@ (AtP| A/ |`P @Pl  @0 !p@X@ Ѝm@BBa::a/baab@-P, `(9@1|01 p000()@!P+ (9" S "0b0000()'!P (9" S04S ",0,,( Ѝ@> ЍcbCV::E-`, p()P1|01 000Z@P Z Z 0()# R5" 1S80CW 6"1u !>@P Z Ѝf0!Z#< ()! RSS /00d000() P (9" S04S %.0 ЍEBV::wbM-,IPM,0 00tp0 S0P$9 `P`P U(P$9 0H0#Q0$S4S _0P#0 " Q`AW T04/ Sr . R #S R SZ S\ ȁD##S"_>0Q Q Q0 /jS4 SD S040@0!4S S S Xq0SH.D.0@ DT@QT ,[IPЍ 09090!4)0CSG0 0 440 @?P2_ @  @ + R,  R.  RA  ( @  @ .`R@  @ @  @ @  @  A  A B  B B  B B  B B00B00A  A A  <_30"_H< Q0 Q ]Q QY, Aq__APK;00e0b0S@`@(y1|`0V0";   P # $9,0 P 0@0C@S񟗈poopnQ$S0#8Q(@$9,Q(E@ 0 88000S:*Q:000 @0  000 @0  00 0@0 0 ! jPr 0# W":0#< SF =SII SD  !=FF@,Q ( ,9 0(P 0PS$0<0$S4s00D0@()00F*#9 T  S S2E)F X0  S@`@(9 `1|001S0#000 0.000P @哢#$0$0S   0@>3=0 J0 00 S  P T%1 00  Q`"!00( &000T@( 00P%1400n?0 0000$040$ S 00 0000+@0  0S-Օ,1Օ 04ᗐ3#0Ӂ@\ 7ss@s tdsT.!R/o@b`(`5T/ .AT@3T@#P@D# $ !," -!`!( R.AT@3T@#@t@T .ATAOo @d@D T @#[/5R ` ` ( *<00 8E08 P < *!+<0#H#(dLl@@-,!80$+!00 R000(0 P00 @J0 0"!80  r 80480$00$0 00 0N %, Q(9@ 01|000 7`2 PU 0S0 000    mPX$0 00S0A8!=R$ p R R88 $(,@  $(,D  $@0 0<p0S%0S {p0 ,0P@00#D0p0pS08H00,0L0 @0 @ D H 00: 0L0@0 0 A XPPY 0 # R#1S80CV, #1! 0|0  M |0 S_ |0 |0 > 0 80g0000 iPE p j9S Xp0S, 0 S P X 0909mbb4cN cc?bNVDA   @oBcV::cEcwcdABaAVM-`HM, P03 (9w0(?S0(3ppG01|@0  0 0S A 0S0 o00cs0SQ08S  7Pc000000,000$0zA0HdT@(P 0 00 0040$0oᨂ[0 040 S 0 000 0 0aP#0[800 <0T08 @080 D 00 00K000?0 0@ETHU,0$  7@P 0m9IHЍ00S 0 4PE 0 # R6#l0S80CW 7#P0PPALu Z ( PCV::,@-Q @ )d,@-Q @  BdP@- 0\ X\8@0Q P DD0 /0////////// ///@- @0$ S*0 \ #3@-! " !Ѝ0($  Q:\03#//(AA-0`@PpW p@0S008/PPPZ PP0 S) Q 0@00QQ0@0Q Q00R00P PQ0@P0 00S00R@-P@@Lp800CS80) @-0I/ m(Dg::@-@mm mHm@mA-!1`Pp0 @pq An  m!iV41V81U4aQ&l1U8%\a1QM-`P0@0@0M4P_u0040cL%uP0☜P P $ ЍLzp 00 _ _ 0S$ğ0Q VĤ0@ @$0` _PP_8 q_  _8 QP@Hg{ 0 0C 0420_0 0 0_0p@ (_0 _4H  __H ?  ? _ _ _   _   T D  \ D X`  @  XD AT __T  _ T _ T __` T__Dp_ _'x>~}I lPE 1x 0P! @ @X_q   Q .2 7}`Pkk0x0$U.` a$` W G>x 0R_ G(k_!,~$嬿 _ 4404#44 4$404#44~z0 0_0_ 0= 2P PT _T __LQ(!X!u$PggggCV::8h/hHh@-T000 0 00 Q, 0S  ЍM-`Q5 p0S1 ƺ P0S( 0 @DT#@ 0R P0=S P@D R !T: HЍ@ZhA-p@`TPP W@ t 0x 0 @$ 0S 3/@P (01(0t (01(0 0$0pS@HM-PPP p,=`P&YP@. k@P PX:*PP 00LPI?P  7/PP jV @ lk@P 0 0jVPPM-Mp`@ 00M  ᔻ #KιP5 (010 P pM 0#K[P jV 1kP vj&kPP РKfjP Р  Nhp@-@,P,  ` \pX,~hp@-@,P, N Jp$<~hM-`R02Q@@VPp( 0HS"荄`<0 00S ,0  0 R# S00S00XS 0V] Vc V~ 01SyS tSXS0S F0Cs0S! 1 0нЍY0C!s023 00  0S Z  .RZR0  0S  S 0R XR Z  :RZR 0  0  @ 0p| +PH@ @|@ Ln P 0${ wgЊi $jAjHajyj@-D@/4400P 0 @ 0 $  0 A-Hp`PX|@P ?@?zP@?i@0 (p,`0P408p` P$<-L0$M0 0000 ,0Pݥ@o$Ѝa7@-@P4  t2400CS40'.0*80 000"4 80R ^"0| M-`@@a0`PPMTb0Xc0\00V"(yPЍd0S 100 5$203(40,4687<bp2P@100`4Pd20h30l50T60X70\ 0XCU0e @W 0S  P8U0Ep 0xePP @e Be`0 4 8 ̃048<0R*0e x@00    $0(,0P e@ (1@100 5$203(40, 467 8<g@0P $0(,48<0S dGW  $(, P0e0CS  p 0S0 eP0 @~0 @< H D,!$L0QH1R2M-`M0p000T0R :S  ,  (,  0 0*@)PP 0&,xp`刀匠@P !VW"ZX40040  0@P (&,^P ^ @Ѝ004 0 004  t&80# 0 0 @Q0P U$R0(S0,T04VW8<PQ "dұ80\;80ͱ`00H"0$4`0P00p0WH0%0@2᳀00x 0C h@p x/P 00x00"ᡱ  0xp|0" Px0rP$ "L 0↱P]V Z`P % P % x "#P񟗮$ÄÄd„„P000X 0S80x0W|000xp5|50 <00<000x00 00 <0 A a00@   0 2,8aP 0Ï>]0XP00 00pGfP0 0! Q0P U$R0(S0,T04V8W<PQ "(80V080[ ; 80@0 dQ  [P80080ZA _0 @@ x@L Px0P @01 052 3 4 $670(< "(p@ 0d @ a`04bc 8,]YV$0 S $` @Q0P U$R0(S0,T0 4VW 8<(P,,05$045( 5 S`Q`4o~0pmp-ppppq8qLqbqE-@@RdpMSa `04b 8c <WTI*2e0P0 T$0X(`0\4 8 ̎ ,<PP  uPЍ80 @0pGdP @100 5$203(40, 46 87d <@ PuqM-@0S`pP Q @ a`0 4bc 8<X :PU"0$ |@P t80 08@ @0PES  c@P  t80 ~@j::M-@`P M 0S0C 0<p0́Q RpW Ѝ B 5P  z8 !q7@a` $bc (, BW P  z8  @ a`04bc 8< R B  0@e  Q0:@S 00UV00S M-@M!0l`pPW$d`" W(# ',$ V$& V(' &,( @ 0h !p%`P 0 fP \ 0 @a`04bc8<R:0@0 0P 0@e ,%<08 <"4R$% S$& S(' #,( , 8 0 4 ! Q !P " P# @ $4!+wv xy0, XUl\^W[*00@e ,< 80,#$S4%0R4&0R8'0"<0(0,08 XU0004 P!Q"Q#! $4lP0S u0 @ ,wv04xy8 SP @?@<08 K 4 p@4 80ߍX!W14Y!8Z!Lc@QJMJX$@<P<(,@Q@?Z=duQoo1 S>JD BZ0@B/4(@P 1@(1#wv $xy0(,e 0hB@@4 80<嶪B겇 Hd6Q0o1J0a0 Z, 0 (  $ @ !0! H⍧U 0TCWP804 `z @Y 0J4 `@P00ʧ 4 80 i vVG@1Q[0ES%0!*Q&#:M@B 0 4 d@00 B?$H<UZpp 5h3<0S 0'L+rQ-r )3rrs02s8s?sVs黎dsMsM-2`0,0M `!@P,0S t@ЍD pLPr`0,0P0L $$(-P.P/P0P1P2P3P4P4@Pt@LT өL0@ a`04bc 8p?p@pApBpCpDp, 48<0p pp@p TЍ \U0P0 @  0 D   QP=Q ]Q XQ S%R'%R"&R Q5":Q0S ^15:^0S|p0t 0l; ' R*P匧L劧^ Q 4僧0F _Pp PP 00 0傤X0  0| e(Q*]0 0W Q+|`Qa p*k_BHRfS_Ms-s"tLtwttttu>u]uuuuvuv6vavvvA-P`@@@pT@#SR `⣣P @M-`P@M 0@4 8 `@<0 0T4 8  04 8 <0 04 8 <0- ,00T0 00#{ z| }0OQ 0P P0e0CڦtP& 04 [8 <(0 04 8 <,0/ .04$0 0$0(0,048<  實tP6t5% OT.{zr|0p}W  唦 Qp  0 p兦P)p(*p+ P  04   0(,A 0( t  PX$T@Ѝ R% '*  A0 P00t0S T0,{z04|}8 <P $)@ $0S[00[" Ko"4  0 [0$ 0} [0 S R0 80 0 0PP 0 Q: $0 Q P3: Hڟ@P P 000@ 00$0@  %$04&' 8<40@  ! 04"# 8<00@  )(04*+ 8<<0@  04 8<80@00    $0(<(,0@00. /00P4D000@00     $0(`?`@`8`PPXP `@a `04b 8c <S0@0P _=U T0e0 d `,!$h0QdMR 0 00r`P L1 0!XD Dp@p00x1 00X5 p `XTV 0 #{080090:0;0<0=0>0?0@00 p0@tX0@D1P0L0R8?0"<@0L0;80D000H040Ջыx;pzzzz*{[{[t{{W||8|q|v|~ha|, 0S/P/ 0s00D- 1 ^ !(0S00 00 0$000$0 00$00000000///P, 0 /S 0S/(@-@L@ @-@L@Lp@-P@P Q _:00P L00@P L0 00 t0 p@P tL0\ 00 P0 L@PphL08 00 ,0 p֋ы׋׋׋׋ ׋׋,0P @-hP/ыM-pP``A@.TT T  ᏚP a0DS@@PU_@K?0@- 0207400>0020@00 0@-PM `@P0.SpETQP@TtЍ|@-0h ^ @X P R<ʟ | @T@P@Ta֋֋|M-M?`pP@; ?0?0F011HР??!RРT !?0?0F011HР?p?p I PР =0  0 P 0 Р!`P@DQ P K1`P@D @-\1-  \  P(J L\! |p@-P@ 000Sp@p@-(M@ h7{P P{A AQ 0%S 02~> 0!2>401(Ѝ!81010@-@< <aP40( (aP&(}}K}X}0H \/@-@$  |3Ta֋M-M`Q!@02*?P5 ??F1HР?p?p!RРT< p!? ? F !1GР?P?P P' Р0  0 P РK!K1 `@DQ p P!`@D 1РM-10SPЍ@?@?[`P  uPPhJ@  0 !0S \ No^P  A PA [ K R$P RPEPR$^ @<'K 04 0 CC?P $ aE-dM `@ pP(l! PD00 303044S(0@0S(00(000徂开ᑃ(,0,0+P T-0UQ1 SٝpdЍQ(ϝ Pム 0H0L0 0P0 @$0000?@? [P @$000$0 000֋}}}0@-lMP (#@P000 00喚lЍ0}0 sR A-P `QpPB`@ P,0S P00/QM-@0P S SK Q:LS Sqv`AD00@2Q*0!`@0S p0 RpC弰P 7P`0S S S0  P?Qq0p`@D~A-0S ` pQ 0Q@%  Q"  0BUP!m P0100 S 0 S  1 S:00aP 00 S2 S?>P@-0@SP 020C00SЍ0C00 00M-p MB 30s0Qs` @P 0D Q0  S 0@S` Q0   C0R03 0*` R R 0 S 0 `00?o2 PuPS P @00U(` 00 0S0  0PES @DuP `0SP ݍ7@-P P@P=0020C0 Ѝ0p@-P`@P@ pM-`MQ Q< !@P`@00<00@00 0 00 U| U0b Sg Sw?U?gdU0 Ï`pP<0eV@0 0#* R2 R? 0[* >0 S" S/  R [1 S2 S?> S)0 P`p R2 R?0[*0 `V 0pe/H oHP $ T ( $ ( Q  !* 0 RP0 R RQU R" R/.R H < $R@ ( p3`1:< $pR@ (`$  R4 (  8 4 X8  454 85 R 8 嶡 !    H R     ##00?000p `' 0S00 `0S 00 `1P  1P0pS 0`0N 00000W00010Xp\`tX?X0,0\0D0 000,   D0咣*,0",0  ,0DÃ>#/R PK0pW0 ` 00` e 1P: U 1P/0 00 00  00 04 $0(08 P`0T`P 00;* R2 R?0UO*0@0WP0Nxc`ЍX!L0P4 <4 u!L00P pW0 `   , ZD   P R2 R?0Su0 S_ SRS_ 00S0 00 00 @T`P[-`P `Pʓ0 S &810aV1pps'0X0 0\00&vXX0Q0p20W 0 } R2 R?0Sr ` PX⍓0ï p S  :0! PQ00 0  0 0 S_ SRS_ |0 @RP0)  !P0)     R  p0U p0,0 S2 S 0>S# p`0 P R" R .R 0p2U2#:S0 S0 1 1U?#*|֋~֋>~M-M@.`Pp0S`Ѝ R RW 0  0pS 0 SB00 00p]0S0PS 0 S0!01 P  |P  R" R/ R/XP0020C0P `M-M@P???TM˜KAQQ*Sj ? B?0  $0   0|P 44夘$0 $ BR 0( Q( `pPEU 0 c  ?0?0@0M?? 0 | 6Р20 |Zdh0aP 0 `  0|P$  Z~'@~~~@- 0 Dw Ѝ׋ ׋M-xM00 00@80P<D004004 0 b0L0L 40l0<00< 2 0 080  T0000T000800 S80000R0S lpxЍ 080  0/0S d < `032`0 `ⵑ`0< P00`00d0032X000X0`0 `⣑`00@0?D000000,0(0 0$00 0P0 S 0s 00 ($ppP 0 l 8  !@< 02,*H0D $:P0 0$p 0wCPC p,0 #P, R0  R^*R1!l0`Se p0Vt0T l@TP0l  "Pl, qcp`t@lQ R@@^^ 0G0@N@TIL0 CP00CS` 0`0H S`C0`00d00X0`00d0@&DPQ0H PPC`FT 0 s ,0S 04 0 0,0 @V2,00 @PC000000@00@0D00D0A R0,0AײT``Fa| QCZ@ST` zV`@ 87@47 0(g\ 7Q0"  Plf0T B 6@ pp(T OZV @0\050p6 010@df! P 0@ZT0 @Tp .Wp 4 6@6 0u`0 R# 5 0AP괵0T B 5@ ppS Z @0`050`pW&@S Z, $5@ 5 Tp4!`0Q"  P꼤0T UB 4@ Sp  Wp @0150D40A3S0A!0CT0Z\0 @tSp Wp 3@3 0sd0 R# 3 0Ph0T B P3@ ppHS oZ @0d050pW%@4S [Za 2@2 T딢异0 1pR$ 2 0iPGt0T A X2@ Sp ) Wp @0150 pW-@R Z 1@1 T뤡́1p 0RT0 ` T0P 0150`1<\0T uA @1@ Rp  Wp @`00 ($P< 4 `V2,00(P00$@s 00 ($pP) 00C 0B @ BS  ׋ы~׋~׋R׋׋I䀊 ׋׋M-qMD0崁0P`@ 0[R@ T (0S RAЍD 崁 X  080P0 0`F00_0 00 c 0 zP  P (G   E@0 c0 0YP ׋A-(Q(1D 02 a31< A202!@0 Q@+T/ kDp V01P` S?#RL0S0 0 5 0`0? 010-|A2x!WP @q@00 ׋׋ыM-0M80 0PS4  :P;0[Sq  ~/0 MH0 @ P<@Q@ T3 000[$`0[S# S``408 SR00X00S'  ᫆P;80`40@0KS`S`` P @0`0j V V  V0S$ P 00V V Vړ ֓?02[p0S$0K` 00,@K  0 @zPu2[St 库np8?CFMM-0M@`0 40 /00M0(0 ,@ 'P P0/S S00@f /P0 (0,`S APC 0/R (0K, KPKp (0,pS1!00S00S4  @ 8 PP8 U/P U 0/S0`_o(0K, KpJ?W X 0S,00 0(04 0 P ;R,0$0K 0 0PP$0 0?׋ыs@-PPP 0@00 P_0EPlP 0`S0 _Ѝp_ы׋V0P@- 0  0_ Ѝы@- `P Q% pP  0_P 0@S0S 0@0 Ѝ P_Xы֋׋E-MP@8p<`P \凒Ѝ0H0p0`S 40P @0 00p`)uы֋p@-0P0@S.Q.0 00 00pl֋h֋baE-PXMⰠ0p S@`4" 0U?Z M: R<0 Z: P5R 9PPE10P0ÄP 径P60@P`$ 000000U4 0U8 0Z40Z8P0%\*< @````` P ` ```0````W@)0@ @T+0 Ѝ傄PO3@zPB2000 lYPPЍEb11P  0-ba#?l֋h֋(O80M $0 000oЍ/d֋ɋ,0M@000oЍ/d֋@-P @x0<0 P` 0\6/@T@  P 0SA P'P0SAЍp0\s@-@ PP 0 00`6/QЍps@-@ PP 0 00`6/QЍp0E-4Mp( 00 P 0 A4ЍС0(Pa@ 04/@eTu0 @04/@XTh$03/@OTPU 4, )P9 ,00S50P /@P/ @E2`. ,,V : 0  0 $ 0,3/@,T(, 03/#$ 03/ PP/&A$ 03/,ꙁt֋x֋\hM-pPpp@T 0DS` 0 0``00 3/0 S4`0S/0S/-l 00CQP 0 0  ^*   0p@-@PQ#pA-P@Ap`Ut ! 0- p@-@P  , ps@-`@P0 00' Ѝpp@-@Pu {. p@-k , zM-@bo`P p aЍp̠P U0S  000 0 0 000+T0S0 P pp0;00 P 0 pp;A-`pVQ  WPPU Q$N@P&Q   y00 0 0 @0 @@@-@T ! 4 @-Q ! , 0 0X֋@-% p@-P`UQ@@V@T A Ypp@-@P p@M-`R@p P8 U 000 Q  R3 >^\ UR0  0Z.\ UNP2 0 0 0@0P 0U000s0S 0 Z  R t  [Q 0 R R R0&00S/M0Ѝ/ɋP/00 00 0 /M-,[ 1`Pp  P P A0<@S<S 0P  X W037 W @ -@PP@ 7(0 00"80a P0 PPЍ`(s@-@`P2T 2T 0 0000 Ѝp !s@-`@P0 0000 ЍpA-P`@pP$0S! / 00 0  @V 0FSƍ0,00(8`0@4<00 q3333p@-@`P 0 pP$ 0/S/S/0A-M`VP@@ A 0PS0ea&bpP&AЍ)M@P  0   0 0&0pbP :&AįPP c@D0T0D000`$Ph@P AŁρA-`@TV00PQQ # A`P p WQ@  ,@P0  0@W0H-0 ?0?0@0MP?@x ?@M P 00 K0 H P 46P  RP a֋ׁY]<0S/A- 0@S pP`V U P  ߉PP P  ӉP<0S<`0<0A(A-鲌pP`吀@TA"O0S 0S (, U0:80S S080 @0040 (0, T RT T AЍp"@0 P 0@-0P` 0 0<0 `@ 04/@>T RT TA@P0 0 3/@P 0 tЍp0p@-0 Pi@P $0 <0T03/@p0A-p`WP `@P`WЍ0<0 @04/@T0RS %&P P60 %@ B‘0  @P0M-@P0M@ @ " <p|P3!)PP7 $!@P#o$  @"&*(0'P&AT(p0 $,3/@8T $ 0 #6 *%0p$00< 03/%0Ѝ TBPO X :A 08P$1 0  0`P0$`` @$0 4/@T ?$PP0%VZ (0<'P&A(`,0` @0 $0 4/@T  X%D 0 T(0 0$000hL<x֋p@-@P`0 j pE-`@V Q)  PP$@p R 0T@0  'P  P0 S@0S @DŒ0W ЍA-@`p(,P|QT ?oU20SU U U U  @P :TAtЍU A U 0UP PT0  P@0@-P1LM0@ 0;PI LЍ00 R000S Aw BRQ @@01300 P0P @P 0V 0 @@3W 0RA-P@Pp aT 0`PpQ 0R>aA%M-0M0@P !T0Sh 00e Pa 00S] 0S0$0 P0$ @P 0Ѝp( ,%T0@p,@(PE`P 4EP2`00:04TP0  e =@P  r@P tl@PP T0?R$P|A0S T0s0T 02&Alhw20S`~`sM:Q<0R:pP5Q0S Q00(@ JR*l? 0 R 2QU000e52800 #$PP#&A P( BP!(00(0000!000N/ 0T@ U X0??㑴ó0 P(00,000S0jAS ?P $ 0"&*!jTTi10 00 1Q400 52800 #PP (00(0000 pR R0:0 0@Dh(J0L\0[\ pR"& Rooooppppppo ( L    p p pXw/0 0"&*4! A0l\Z pĂ悊M-p`M8 V:Q1 A P0 00S 0S 00S0[ `t PP0P ޮ@P <0 HPo!UЍ\x֋p@-@Pa0  np@-`PM! @P  Q p 0W0P@P 0PE    L0 4U Ѝ-@- ЍЍ/-@-  - ЍЍ/M-@ MQT`` A ЍPP a0 00@T`p0SV0:A000| P0 <Z0#03V0#S   PX  `p\A-10S !VQ<0SQ aq@T PM  PH t1@ 0"dS?XqT P>  ׀P9 $1$A 1001401801L00 S% 0@00000@դ @$@(@,@0@4@<@ˤ F z@P 0@P 0 `֋0( |`@-P`<VUK  ЍQ @0 p@T 00<:T 0S AP @  R0PP  00/ *P000E-pP AM `䀟P@T  )P  Q  00SRAVЍ 0@TP`0`F     W\-@- ЍЍ/0M-HM0P0p j ⻬PA  4@P  M0S Q xA40 @`0SN0SP0 000@tTsZo 00 0  P @0  @P^0000 0&@P!P a " PX:a  Vg V:Ad2d"0``2``}PK P @S0S9 0( 0P 00S`P4@<@D`*00P @ T 000SS <0<@C<0S:A< t岂cqPA 03/`00(10 0!`P 啂@E<吂0S DPP F/P  D6 `P00`~.HЍy. AA&A/߃h<H4 fqЊ\<p֋x֋LXJуL\0E-,M`0( P C@,Ѝ2<20$000  $0$PP@[P $0S p&0` P00%@PI$0SH @P(@$ P #!pPX P:AW ] 03/FTU`VP` $ $"P7'@-P ?$  0"&*T H 79 Q?-,с($0PPʁ:Aǁp$E⨀X-T  N@P p$@P$@PP威&A 0$3/@T d嚁-PP9@L0`4t֋<*Kބ$4p߃A-Mp`@'P @tPЍ&PP2PP RQ?@PP$ 000000V4 0V8 0&< 0W40W80'< PPPPP` P PPPp0PPPPX0 PP P 0 $DP &ͪ@x 00p0 3PZU  j`P pp@PP&Q l aP - Q`00PpPl֋h֋#?\7x֋!wu\-@- , ЍЍ/M-0P<1@P(@Ѝ0 00$ (0Q %  R@ @ p @p,pWO*0SS00  ,0D #0 s0Qs0/o"X R,0<1K B0410p  0 G0 .0`0 + 0 00p0` ,1S,! S0,1<1S< `0P `VQ ` VQ  Q ` ` [o v 0  v@Pc M-@PpK0`SP \S/S {PЍP0S /S\S0S  ER RPzP0$  $0000000S0SEP <e{Z 1 ! zP X  zP0 0 p@-\`0M@=@P PP P++o0Ѝp@@-p`@4M<PP @ @P l@P + @P  _@P 0 ++4Ѝ00@M-PM@@pP<0P0 0 0S [0P 0L 60P 0C0 $ PA @H Z3ᴃ0UP` U P?P@0Z%0U0PS0Z000 00c U  00?@?0v<P0 0 0 '+%+ PЍ  P@ X $ Q QT*0P  0$P0 ~ * PU  S00  *0 00 00 0pP@$0 S2 S?>T*0S 0 P0 0 0  0L @[0  P0 P$ R" R/.P* 0   PU 0 0!P@u$0 S2 S?>Tl*0@`sA-p`@d;PP @ L bT@P 0@PP e*c*A-@p `~P -pQ 00!d @  00 0  0!pA-@PKoSP0` !:0P(p05 0 0,0,`@P,0@0 ,0,`w@P,0 <0'`P&A ဠPP0P 88凛:P@ P8 7pPe 0P 8w:P@``[p@Y`TU <AA-p`@PW5 o0SP.V/o"Q(:A#1 R V꼤ФФؤФФФФ䤅^ S@A   Ap@-P@TU p:pp@-P@u0S pPU/oP"U{&p@-dv:@-@^Tn k:p@-@PRT8 0` p0S S00Vp@->Pp@-P8U A @0@T RA0D@0<@@0 <pp׋@-$6@-1@-,p@-@`P@ 0DP \\\00p@-A-@P`p0 ڗ@@-@-p@-P@TUL0 ApP P@ 0 @@#0A-Pp@T` 0 pp0S~# |#z#w#`p@-@P`Pp 0 PPh#p@-@P`Pp 0 0 PP0 P PT#A-P` p @T 0 ``C#@-@ 0 000@2#@-@hT Pt:oM-Mp TPP `V @P W`  H@P 0S#KЍ0S RV@ 5@P` &QW`00 S/ Z 0S " @0000 0}PU:Z* 0VS  0 `6/`V&0 W Q UPQ `0 0;/Z Q@ QA-@Pp`UT VW@@ 5P&A 0,0p 0  A0M-pX 0PSPWPU QЍ``#@@D0 Sb``[Q0 00p@@Dp@-@PhTU00 A X >A P 0@jp@-@RD0T@ 8 T21!0$uWuh@-u 0  赆h@-@.@ 0S< $04#0S @1hD@-(0 R  u!h@- 0 uhA-pp@P`X A 0L Q 0S , u@@ PAhD@-@Tlhu0@Ɇh@-@T A7&@P 0@׋p@-PtaK*N&P 7ptT*pA-`P@AUV`` A /"pP&A p#0R! 0 PE("P@Ѝ P0 ` P P0 `00 Q0%0"0%0 `%S3#SQ0C0 ;s0 S:P 00 0S0C 0hDA-HS0S A83q&P$Cm&P7/P0CP00P P0@S"02 "1100pTtL&P 7OP [P" P 10 7FP0 ! 00Lr`0Vs0SOP0@w6E0@s0S610@SꨳXLLLLLLLLLLLPPPPLȲL4mHP0P10@S񟗟<<<<<HHHHLLLLLLLPPPPLȲL4~P0&0@s0'0@@0@A4P2P00@S0@r~P0 n0@10. 0+ 00?_ R000C?o 2R RS 03/~`s׋8 W׋0@-t!@@-o@p@-P@ 0000 00000000pp@-@PUTU A Q AYp 0SS S SCQ !Q^`0 @00@ 0@0<@C Q׋׋8p@-@PUT@@ A @`0SA   x0@0<@p׋׋8s@-PQ@R 0SO 00`V BV@ VE (V, 0000000 0HLV4`0V8&l0`H0PHV V0 000S0(0$9 00000000@0`0 00%0P0  0%@0DЍp0 00 HR: #R0K BRt 0P000000 0 0 0S4 00S$0 S(#< 0@NR> kR 0        00 @ 0 eP0 0S0000000H0@0D     "$   0 @00 00000000 0 00 @{      0 00"<0a00M-`PxM@ 9P, R0u%%% p ,#     \( S$0 ,̠S(#<p   0@xЍ   * \ S0,̠S#< p  00S00(0h0S S  )*@ )0 l )0P⅁P P ArцM-@PQ0M Q A Qؾ0h…QZ  ^R- RJ RW0 $0(00,00 4 8 < 0 0  0 0 0 4 8 < o' n 0`4 CRpCn먦`P  nPEPEW`tn 0d4 8 ,nP000ЍPR 04 8 <$(,"(n0BS괿ܿ`…`…`…`…`…`…`…`…`… `…`…``…`…`…`…`…@…`…`…@… 0@400 n0 4$  340 0 $ 0 ( 04,8<kn `R00  Ran `R00! ppWnP{0 X$0PSp3 p#Kn`Pp CnU`$  0  4$.nR 0  4$  n`P#倃s0%00nPU ` 0pHtn0G~SP,#0Go~Pm  R  000BS񟗙…hÅąxą   )0S ТaS0  `,(0h t0 $0(0( ,m,0`0 $0(00,00 4 8 < 0 0  0 0 0 4 8 < d} \m 0`4 CRpCum묠`P  mmPEPEW`0Av/`PUp0 $ B0 }PUsw埊h/(9GU Sa]:`etNywgމÇSU:ȇ χ+CpQp@-@Pb™@ppM-P`VU Pb:X OoB[@Tp T  {k@@Z[@!;# *@EV tb gkp@UPP5@-@`3+RQ00P0S,p@-P0@SM X0> 0PS @`P Ѝp0000$h⫷P H0L0 H0 L /p@-@P` @pp@-@PT Q  PPP Ppp@-P@岵P@h @P@@`Ʒspp@-@@P឵P ph%Pps@-@P`P0S 0Q`奷0`0LPPH`Ѝpuv PP`PQPM- q(M P0`SP@`Q @aP`0Sh?P`dq@d[`VP `7 00)ppV`1q3d5+:U-  dy`p ! H L8\(80 SH00H0 PP PH0L 0 H0L p`*R q gpPH0 L Q$00@P0 00p$h␶PH0`L0H00 S L05*(Ѝp@-@P` f@pp@-@PT Q  WPPP PpM-` 0@4 8 <000S@0p t0 Rx|r0S 0C S ̅tυ̅ͅtυtυtυtυ΅tυS  04 8@e-PP  0 P P 0PtT 0pX 0\PW(I-PPM D-P ,0- .40=jP  0 0 0 W0 P 0PS 50S S`֏PPP0S ST 0 0(  !RT 0ỏK ?&ABPP PP 0 40 X$0 $P $( pP `&A  j 0 pp 0 呲+ A A [Ѝ&A&AA-P`pVU Q(?x0P 00 00000 0@ 0$0&QPPp@ *A-`@V P:AT A0PpT0X0\PU@0 SS 0C S хЅlххЅЅЅЅхЅS  04 8pp@-`Ph @;gPP;PppA-@`PpAT PM:W R U RP @  PPU5M-`p@$V ~P&:TW00X0SP  0 F!7`'P 0AD`P U  P @@ @0t`S@*(P&A-P`pU 6P: 0VWX@   FPE!pC'PP 0aFu0Q@T  HP 0VQ(pP&A-@`pT PP : @PU  P 0S:0aFQU &0@S*x@-a lIL\p@-@(MPVT A hKGP A^(Ѝp`጗PᇗPA s000000 000000$0S0000>;U0 000000@p@-PU A @00SNA @J~0@@0@ph׋p@-PU A @00SNA SA@2~ 0D@0<@@0 pp׋p@-PU A @000CSNA @ߤ~L0@MP~@0@Ap 0D@0<@@0 h׋p׋@-@T A @0 RNA RA @A-P@PE@D`0@&p&W@@@-@@DP@%@-@@DP@%@-%@%s@-P0 0R S0@ ?P [P *P9PTЍpP@ ]PP -PPD_oR TTP ]P P` P]0P0P``VP%0s0STp@-P@@(p@-pP` pW 3% P .P |%P@x0 PT`@T TLeP_@`T@ Ѝ@T_@`@-]ފ@-\@M0sP 0 00< x< ⻱P jЍt,OA-PaD P 0S"A30S6A/0S2A+ Q A/ <#0."\ !:,@A@At` 000SS 0 PVAP0 |勺 AA-Pa@ 0S6A00S2A, P R  B/ <#0€"\ !:Q,@A@A-` 000SS 0 QPVAMP0 |E AM-@xPU  P0 PP`pPP 0S 0 pQp@-P @ 00 S(0P  @ P 1 0p T R 0pp p0Q0 #0׋P/0S  04 R//P/0S0S/@-0S0SPS0SSS0S/S/P 0S @-0 4P/P0/ R RC/ $0@-@yT @RA-ʤ0`pP 0| vЍlr@doP\lTT@P 0L0UPP( 0( @xvVc[Uwgމ@-@P@`@E$p0p 7/p*WQ@P&Q 40$p, 7/PU00 Ѝ Q@- @0  Q 0# 0AS 0hΈ0S / A-P0 @4 `8 <000C0 04000C0@pAg0᳀X0W:pGpW:@ @P0@0C0@@-P `P@ R( S ^00 T:Q(Lp @ W(@DUL000 (p`֋M-`@pfP'T  V R QЍ1p1@1P0S(R؁`V(0pW/0S ` Ra 0@ 80@D@ 0P8t1DPUNhh1(0d1,0夈0P 0S J03/2` &,*  Ơ ^`PpD0\  # 3P 3 "R D`\ #3V3 "Z`` 0R  0(0p@-@P`0 H@p@-M@pP`000(0 00vPT00ЍM-MpP  `@ T, W P @ P  0R0 0P  0U 0 V: cPU ЍV Z*000\p@-0@ P`Pp0p@ A-pPM@`bUW00V0Sn0X0T0Sg cP+hp/bPp0) S5Q:PP p !PP0P@S0 00@ƬP7Ѝ ZcP!@0Q -PQ0)S*0* C* 0 0 0 !!2- 82cPQXā00Q Q,A-`@pP cPAh`/6bP`QW80 W002:P H0/oL#2>0#"0R >AЍP!0pP&A pAXP nl@P  0RPAM-`pV 0Z0W0S X|@ @D0 S: bPP0$Z* @־wM-xM@00T  00 0_ %p0`000%PP T$T %1"0< @p`p`$ 00@ T` 0 QSpp0p F T   00$ 0 0&#*60000"6":& 0\#3P#\@\ \`[`11\+:Rp11R 0: 0 000 pW 0'vzp0 p(600 0S #6:"&pp 0$ 0$P" p0 0S #6:"&`` 0$ 00@0[`+&f $`a[&xЍ0P0P0 S P$T ώ0p@TpU.x0QTPUT0U@@0``0S`@c0p0 P [[ PPex0 T@ @3 q@P *@p PP@``P@`T/ P$p&6p%* XW!pXb(,X[ p$pQQ0 p$0 0 000@ PLP@T P  04aP:]@`֋戊(@-p @P `0 0 ",Ơ!P *p#6qP  0Pd ЍE-$MP@`T 1!`P@̠ T$Ѝ0 PP00!@0 .pp g]P 0 !P0 @5-xs@-P @P0` * U R  0<<P#d Ѝp00 0P:-BNA-@P  P@DPQ <@\0\p,\^8`4P .,UV  00c  0#D Aʑd}@nM-M`P*0P A0% 60 00@T [:A<TU 0SVp0F"p0Z!:W [&@Ѝ P    0 0Pp Z: R Q  Pp X p W 0 0  0S 0@pA-@P`p 0@P  I@P0 q0@-`000 P@P Gc`SpPU P&  _P!0<0D03/w Ѝ )@kT HcQ 8cP ^в׋(0ʉp@-hPl@p@s@-@P 000S SS ЍpT 0S 0&S h`lPPᬄM-M 04` `oᨂ 00 1P 000@?@ pP@P U0* T0"&*#6 0  V0 ,*[# 0HP 04 ?@ B B 0"&*0@t0xx   B00@"&hЍV0* T0"&*#6#M-Pp"` &3 PP P XX0 S&ЍBV$ZF@P^@1P3@TPT3#[Q00 00 0 00P@ 0S BV$ZF @PQ@1 P1@TP T3#[P 0@T 0P :M-oPp0#03 F%VJZ(P0GPUU03P Ѝ W0B*s 0qP s 0hP0P 0wp `V ` &fj"6"&  00 U R  $Fvs@-@R# Q /@00#f0LPsj%V 0 +P 044 PP%! "` @00Ѝp ʑd}7@-@ P $yaP Ѝ0P ҉p@-@'T P`P@p  0@-LM`0p    `0C@P  !(XP (⧊PP@LЍ P @Wa V@P0S0S  ]P@( 0 4`F@<H40A-00p`PP@&x@PP@0SXP 000000@M- M @PP Ѝ` PU ` ;P0PU #03/P UT 0S 0S`pT#@0S0S ` 03/P0TUPEY P  J` 03/P U@ 03/00h@-@@0 QA-@APp`0dPP   x  `0PP  0 $0 #?p@-@Py@pp@-P@|U 0S*`P |cU0  Q0 Ǹp#?A-`p@@T:PЍuPP  ᭸0`S 000T40@00Xp00S `0 4哸 P?/P\⛥\5#?0E-CM`0p /P00 '@P0 PPP 0 Z@Cߍ\\@-2@P 20000000 0 ?#?E-4M⫷@P Pp0`P0 `p(00002Pp(02R$02 020202,p020|2 0x20t20p20l20@P`?X2XXrT"T @0H2p@PP3 0>  @P+00@0 !=@P0Q000!1@P2 0@PaqV :4Ѝ_1@_T 0&S8<0S`^ AT^ PP% 8100100 0@P @@ @P0S 3/@P P  &A&AD`&A x֋\ |l8׋P׋<Z6\IEi@[`\@-DpCp@P =p B#?7@-Pv@P @a Ѝ0@-@MT  - @܍@-@MMT /`P,p<+R0S0S 00@ۍЍp0 4@`A-@T X@P`pP@ ض0P0P ж ̶#?A-P@UU00T`aP px`P  尶00SUpA-Pp`/U@^@P P%Tp`P5M-PMp`8p@P&Q[ X[ 0S*?P~   &PPv  Gh 0TP0CP0L010 0@  1h +PPZW70S4  X1W$0P1(0L1,0H100 0<00=080 >0<0D H W8 @ 1 rL  p   Ѝ>h0T0CP00P00S  hq P d00`pLl ,P P&Q4x\X@݅܅lo.hM-@M 000S ЍT  0&S 0S\]0000; P R $! ]PCP8P4@<@D<0S00SP`` ׃P pV  `PP00Sd00 0P` P <@<@DNJڊ\`@-Pxp@T P  7YP =U U <@0 8(A-|@`pP 0F0C P P  R  YP 0㓅#PU @M-`P0MP 0Ѝ0QS 0Z0[0S@0S r0S  0S =|@0SP00pTZpp0U 0 TQ Q"ZQ W:z 0 pp|PU 5@P Pp `0Z0J  (0 0(0年0  |:P P @7(p 0J$000$0 |P00$000 00P`e? pPE  E`}P4P  0PPƣP"SR ,[W!;R8 6W@U00Sx 0 R @ 0|P"0pU `V0  0C0 BzP  BZ}YW@Q UbEfiVa"/x@-@P`pT A 00 0 00@ Ѝ00@-PM 0 0000 00!0 P@P) 0@0!0@P0@0!0px@P0@0!0HT@P  0@0!0 0@Ѝ0[<44444PM-Ha@Dp P@ UT:6 U&3 ళD0T$0@ PT($L @@P kWP&T T4@0T8$L0@P|~{@T P  SWPYЍP Kᑥ!OQ@00C@0P@0(E-M/1Z,2r@`D@Z  (WPP@ 04 8 < P P Z:A@ߍXiP| 0P /@`4OJ@0$FJ 0 pP fZdZ&A`ZAJHP (L( 2/@  @PP00 P Pt Tph2Z,P @P H)Z A0uW~Wwً0x֋w[=Hc@-pM@`/PᎲS0WVT A^ߍ0ESX P  0013?Q10SA335:P XY X@0P @P Y A jM-8M@T0 Pq,YEP,0Si P`@PYU#OV1Tü4  $ R  T R  R  T R   `@H4   050P^ 00@Pg0T( 0 0#~@PS@PT P00( 00  00P#R-hKY~@P,0[S p0@0`PP,0;S@T801PRS 00C Sx!2#1Tr4`0@r085`SR0 0 2RP P FzpW007 XYP pz` \0`$00P 0  tUP   $0S  xP !` 0 CyP X00`P0Ss@P@P|Q@0!pDP,@@@P000 0DD@@yP 0#00000!0'@P @ `$ 0 P 0(0, 004 F`t32x32|3333333 3333333333 33$33>(33Q -0S #P0R@P $ 0ST 0$0D@P 0@P0 0PUDW:A P(00$0S4 W&A0@T0U -? 0"&@P@P4@00%@P  M-(MP0`R00pHL10  YxP\UWPP hLRPj@P DX\0W@0h| U  h8I/00@ (/P \QP) Pa(SPP$ pa!SPP% paSP*@ƜPB C`@応PP;V, ឞPAPP(ЍPpQ L0p.S Q Lp0@[p S/RPQ LZ 0 P@僜P L 0  9꒞P0 P0HILOwgRQ@-00P0S $(`,P00C 0@ \^600 ` P@!P:Ѝp @-P@`A @JЍp@-M8P@`p-U A  @PP @b-Ѝ0@-M@P 0 Ѝ0////////////H 0BS/$0@-A0`Q!V(P8@, ` pFW0`  B,H S$0S1# C  0M-P,4`@\rP 0 *QF*4Š SU*0sM@ pP$pP(@peW H$V\Q*Q#* Ġ4S"1L 0C P\3#Q3\$`8PV#pF(5`\`p\*Q* Ġ4S"1P!P1L 0C ^ @`P 0Ca*Q*4Sc*p3m`^*Q*4Š S*bP\*Q*` Ġ4eS"1L 0C X:W N^'`䠑펒Q\p*Q*P Ġ4U`S`"1L 0C ?V@F^} ^P|`nPE`A`\q*Q* Ġ4`S1L 0C `"PU_@ P0`0C*Qm*4S*p^*Q`*4S*P3#Q3PN0CSm p`s@P``0C*QB*4S:@P0C*Q4*4S0C @ N^ 0C*Q$*4Š SR03_2S:[ 0C NPMPE\*Q* Ġ4 CN PU0C2MP@u P 0S P00///0 S@/M-9 0  0P 0#0 0#0 0M (< H  % . n (  % , ǎ @ # @ " @b%@`XH@@ 0.00#0@<@`0H@@, .@n@`H@ @" ,Gǎ@@ #  " @b%@`G@@ 0.00#0$@< @ `G@@, .(@n$@)KDO@D @" ,,@ǎ(@(`HG@@ #  "0` ,Gb%@@ 0.00#04@<,@,pG@@, .8pFn@ @" ,<@ǎ #  " b%0,0 0#0=" !(h # ,LlɁ !  " ,b&0,0 0#$0 =" ! # ,lɁ !  "  b&0,0 0#0=" ! t # ,TlɁ !  ", 4b&0,0 0#0=" ! #.ട n  !  " ༴b& !, 4l΂00. !(400 ".l4n0 0,0#0P$4 !,4$l΃  . !$  # "$ b(0,.,30 0!,3lΎ00" 0# 0: .!#a  ,. x#  # " `ßb. 0!,H3ʂ00. !,3a0 0"0#04   " b- ,l˂ !p00 0#05   " ` b- ,$``l˂ !`@00 0#`0 5   " b- ,@l˂ !,@00 0#@05   "(@ b- ,hl˂ ! @H0 .000050000 0 0 00ЍxjVνp $|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆA-@p`P  00 0PUT0P@0 @@00 00p@-`P@ 000@TD0@000pA-P`p@᜿UV00W0STA00S@000CSNA Ὡ00^0@00000000剿 A@-p낿p@-@`PhT A @00SNA SA VD000D0@0U @ cp׋ Q00 Q0S/p@-\`@TpPL0 0@0t0@@cR,00礩 00Q000ph׋׋|׋x׋@-M@P `h0pUT@@ A W  0SA "Ѝ y@M-`@P p$(q V00T0U0S6@ QA.[ XZ00 Q0S'W  O K0? 0S4 0@00SNA SA Dp 9喑(0@@D00D0Ѿ A׋׋M-`0PᲾ&0VS00U0S AO@00SNAJ SAG D0SL 8q8  @ DT=  Ot@,0Z S  (0S  00S@@ !PA3 5:0ި0 @!0 s 00bR000CS 0L0D000< D0iЍA Ot@Ah׋׋|׋x׋p׋ l0R3?  2/R 2/R /4R$ R s/// /03?*03?0CQ//03?'S<Ͽ Q 0 3?R  12/P//A-@T @00SLPpW@0@`0ѐ0pS  D00D000< Ah׋A׋p׋M- M @P K P0'``00 P`Q '0 3/pWP2  $000 00 U$ U( V$ P`%\ V(&l p 0P`0000 D0CRs000S,CO Ѝ 0@kqE-`$ApP(w@V@V@W@T @ Q` V z 03/cu Ѝ0S0SZ`Q@P `PpO:QPPX0 R*Q0O0 3/P500 f7@-<@,P P(0( 0$$0PP Ѝ0@0p֋qЊ\<M-`PM0D 00$$0,00$0S 00C0 BR 000(080 0<0p 0@040D0@00@00 P0(000"H  2L0080,02=0 0 H0040808 S0 S8 y40X 041!T15S pb$ s  L[ @ K@@`\  !Z$ Z JJS441T1P ;l ŒL00CPER    (0D SR?[#  K Z  ̠J ㈀  4S<441T1P ;n 00<R40CPEN H"BX! 4PE1 T1%R 1;`<2  13= 0 R$1墅4T1Xb+a" 4 20 X41T1Pl ŒHPE LR:A0 Z,0S'-$- X104T1Q;`00PE@HQ41T1PlPEŒAL00P41T1Q lPEŒ@L00Q41T1PlPEŒAL00P41T1Q lPE@0ŒL0Q14T1X00`@0CPE@AS % S c B24024X41T1Pn⎀HPEN 0 R  $ R $ R-Z ,0 (0 S% CQ! [#0 B0K0,  P C: 0C Q@HPE $  PЍX 401 T1%R7;`2 040R$11碅4T1X+c"! [ #00K00Z 00 0 02C1 0 BPE 0Z<S= 0H@ XPE` 41T1%R;a20HAXPE0 41T1%R a 0 0A 0 PE H BRA$1PEࢅ4T1X+a" 4 2?A;PE0B BX041T1PE? R0PX 12 4T1Q+`  @PE H 0Q41T1PlPEŒA L  0P41T1Q lPEŒ@ L  0Q1!硅4T1Xb"PE0A "Bs ,0 J>0,0 000 000<00 X04 T1,01H00,00080 0@<00@00 PD0 0$S004=0 $0SH *0DS*1R 1RH0 000 000<000\0Pv@- pA-PQp `p @X @8>+G0  2>P@ G@pM-@S`M 0S@XЍM  P#PQp[ >P=P r  W  0S ЍZPp 0S #P TGPDU 0XF  qGP'埊A-@P` pᥣ00`0Vd`  000 0zpP 0 0n0 000000 000 0 0 0 000 0000jzZNM-@Pp` W0000`0vVd` 00 00 0 * 0 |$ 0 h 0 X0 0 0 00 0S4 00000蚎N(PA-@Pp 0`00p Wt`p0  < ` ` ` ` `[0000蚎A-@Pp2 0000p0Wt0`p 000`0000 (00)`0 000000000000000M-4Ppጏ@` ᨢ0 0p0Wt p 00 0 0 } 0 w V0 o 0 00dc0 T]0000  PeQN(PM-M@ PR 0`S A0a!SR  rPT4v 0L4$00 VPPE UpPT>^($ 2/Q/0A-0 P`P 0p070G@Seeeeeeeee p @P 0S DP @@@ P  02/3? R@S@@-0Q Ѝ P@-0Q Ѝ Pp@-@`PPUp0U3?`03?0p7@-P@ P P@T @ Ѝ0P @0s@-Q`P0P@@ aP P PU000ЍpU 00CS0@@T@Ut@0@- 0P0S Ѝ0@-@0 P0SSЍp@-@P`Q0P5 2/ S0CQ U1Q 1UA0 :0QUe 0QS0!0S0  \Q VAp 0V0p /A-`pP@ P(P 0 3?2/ 0 3?2/ @- @0P  0  A-`@Pp0P0P07@3?@S@/xBP @U NB 0U@0@-@P@@-@P@A- pP`@P  1KPV00Ѝ03?S P 03?S M-M0@P$@P`0H@00 T?0S7 0p PE /R0CWW00G`W yP @Ѝ0S 0 / 0`P TW@@UPE@  @t@t @A-pP@`2Pt Ѝ0SQV0S t0Q?0Sqq 7@- 0@P P  Ѝ0 R0 B Ѝ0@P p ,0`$0P////厊Ďڎp@-@PpP5?S $ 2/PU40p p p0@A  S " /p@-P`5/Pp0@2S$P P I5/0@?S?0p@0FT5/0@?S? @5/0@?S?p@Pp R/P/007;@ S:6;@ S/!Q P0 7+A B5R8Q/7@-P@00SU Ѝ0P @PEP P@P@@P00A0@S /0 R/R/P00a0@S @/0 R/R/@-gp@-@P `PP@p ӝ-(0LR0 4#00p $/@-@  ⷝЍA-@@MPU@@Ѝ 0`` 0L`0 sp @T WD EA5/p@ 0 A D 0  P 0sC@p/ 0s@-P@`T SPЍpV 00.STT @0S@`V5P/s@-@`APT ]SpT @0S@VЍp0@- R; R30P\/0 R 0P S   ^ T P E 0  0\0 0\ 0S00P  0 R  00@ \ PP  T 0000 ^@@0\  0@@\P@9S  0 0P S   ^  P} z\  0R0 0D 0A-`PM0@pVU00X0S AW  @Pg P AЍ rPA@PA-Pp`w@P0@0(ЍS P 0U ?PQ 0P@Q @\0S  @0 ZS@p@-P`@> 0p@M-(`p,oP@XP@ VPP  1P 0W ] ?P[@Ѝ @@-P`p@> 2/RT 00 Ѝ 0  @@- @P 03?S 0 0 03?S ЍA-P@`P0`/S p0 /R pV/PGЍWp0 00P @T:V  0/S @V0DP0/Q@T@[p@-P@> p@@-Pp`@> 0p Ѝ7@-\ 0@PP 0S 0 0P 0S0 Ѝ0:40Asp@-@`PQ@P pV P@s@-0P@P`P ЍpF>@TPT:P@-p0 P@P``U0@ ЍF=000SU 00WU@pGT:U0@-0t0P P 0P Ѝ@- P p B@- p2O@-@0RP 0S@4OЍE-p0E@PP K=P``T:P ЍF= Z X4>P @PPA-`0 @PP #=pW  >P 0Q Ѝ P00C0P@DmA-p`Py@P   p P P@@p@-` <Ͽ1@R  QVP!P3U C R :0R L B7pppp@-`@"2PPp0@D3?23?0 03?23? 0pA-Pp`?@P #P6o0A @M-P`p@04OB  $P6o78:p` p@-P`@Pp$ 0D2/ 2/$ 2/03? 0p@-P`p@P 0 P@ 0  Ѝ@ ЍM-@PF<P1 0 8P)p' z  u@PPp5_P`p 0P40@  F4 `0Ѝ7@-P@P Ѝ0 00ZP @0<Ͽ  Ѝ0@uM-MP 0w`P8P 0 3?000; 2? C00@   R* pp0 @Pp 03?03?  0@p  0<pP0@T@D T` 0100  0'`P W ; 03?0C0C3? 0Ѝ$04O 0@ 0 3?0M-0p`PP#  0P@ p PW   ❘ 00 P7?0 p PЍ00 0`M-M@`pP303?S$0P3? 0 00 } PP ;? 0P5_W'P U! $64007$0pЍ 0(3? X 0TP0#03U0SP 0 S(0 1  ( 05 #  01 5 073?00$0 0 12/50 3? 0 0 05 0p0402000 M-0@aqhMaaq 0$00a 0(`0 T#:1  ? cR7 c㡗 8 ᚗ 0`0$0d0 5X ⋗hЍ0QpC W p!10 0$0%0"$0%$0~>$0 @eW 11: }5@PEP0?[ C ?? m5@P@  0c5@K 0#EgܺvT2M- 0`M4 8 <3? 004 8 <3? 004 8 <3o 04 8 <3 04 8 <3? $004 8 <30 4 8 <3 04 8 <3! 04" 8# <3?% <0$04& 8' <3?) ,0(04* 8+ <3?- 80,04. 8/ <3?1 400042 83 <3?00405 46 87 <3?9 0804: 8; <3?= 0<04> 8? <3? 00@0 00000D00D \00@#0!?\  -  `!"@l  "D$P @-`A`$`.a$ b! a" @ @a,nQ"P@͌aA`P%PnA  @nA$]@l  n!!Me!?(,2/   H  T  X  @ @ HL H P $ \ @ \%a#"," PL!@P! X a a T  L@ P "  "| h!! T ``!`! @ @ " L "ϟ  Šf,, H@pƠa,@a,@@.( @ .%g#"," P@& l!"P Pl+" h^ &P.PPd..P b  b ^'PPe(nc&l&PP``! ` ``! mP$P`P%``UhS%\%`pVaQ% a[%$ Pl͟P `.`E`&gC$L$  `F eA$  eK$(@- @(  ,  Šf,, d. d. ,,'  ,  Š`,, Ơn, n,0l,& p%(a#","pp & l!" l+" P 4| ppe(ec&l&ppf ba& bk&`@`8{!pp(d ppf  f m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPn,0pc93#1#p04p0yx'+u'000p&0p0%p'a#","00 p& l!"ppl+" P 0pc93#1#p08p0yx'*u'00P1p 0p`5p'e3#<#``p6 b1#ppb;#0@0`pfic&a&p`겠zJpW^ [P^8pⲀᲠ ^㲀PU$P. P! l h# d$ `#  T @!T!1*  @/o" % RP# P2U xЍ^ xpt^pᰄNPP $  * B(   Ap `@ P?:T@:@D$`@@ @@`A0 p45 @`@```4``0p`VpA P@@@x@PBU@Dt@TBE Q@`pzPPE ! 0@` ,@Z)*(@P@T$ RP AXPlpP[PPFUʯuP\P`PVPPUkP@PQPaPHEQPPz`R ( \  P0a@A̠ \L =d35$3M-Rp M HpP 0P?U\EPE@TLD@D,Q) R``5V$V0  R0u0p``W㺉P㶉@0P@W?U\EPE ЍVmFW=0`F 00RRR0 R  R0  R  R 0   R0 R RR0 RRRPR0R 000 0 000 0P00@0 SUPQV}@0pSS@S@ S@ S@ S@ S@ S@S@S@S@S@S@S@SPS@@P B@T0P@W 0R @o/J0 S: 1C 0  $0(<0//M-@bMB0@ PČ TȌ ̌ $P0(<00@000 80 00@ @@Q0 p`$0P!`P` !@PD O, " !@$ϟp' 0#',$#<4qď`qP`@$ !$XX!hh`H "lO0# ?\00(p, 0 0``P0,`L_! @$ ϟP%  p' "'",$ q0$q`000 00nP% 0@$%88$HL08X0L00$0X0Ο0(0$0P!(0 "0?<00墿0P4 00@(0,.@T,$!.`P% "%",$0Q04Q@0,0000,0].00,.8 8,ȠP08T0P0`T0! "0?H0?D00\8p< 0 @81<1@X0!,.D=D0#Pp'"',$ @qDq@484,80#,#8 8P  "@O /H L< 0# .<`+p(+ld'| tP T  0# .#ȠȌ.80 0<00|0@0<0X`&@0\p'0?`p0?d000 `D0H``#h&D!H Pp%( '|t`0d`000 00. 0,.8 ,Ƞ0D0 0H0D0h H0p'0?l0?h0,000lPL0,X0P%00 "p@$"<4$LDp!t!P       ! ((!L (` L ` 0#p@$ /0?x t0x!4080|!P\0T 0P@%$ P0( 0!`\ ,0 ,0 &#,$ 11P0$00(0$0#(0,@xQ@$0!HH#88`& " /|Q * (p " "\T X!\!   ,  *, (*(((P (T P  0 T  4 0 P%4  /P\ /X (!  ,Pd pPL"`p%d,p`&( !H LP    p' .'((.` (d `  8 d  L 8  L ! ᠿP!T! h l @$< 0#P@ h `%l (&, $,̠Čaa0#@$#$H8l0l0@, "0?hp0$p1 /(t1`t0x0`|0,0&D0 H0pt00.$0x0P'$0#<4<0$0%\T81 <1`<00$00(0$0*(0*h!h! p<0P%0#ό0?tP,Q !@ `& + \ T+h l  , !,`&!&h|<|x@<P%@T@+P  p @,P`. p p '&\T",$aa  @$ !$! DHDP%H "P/P T`!d! Pt dP %0` @4`$ t00(&̠Č#<4@aDaP . "."(@(0#,`?pd0$0141(`X0l\0`&8h0 L0,pX00.0\P'# %\T 1 $1`0$00(0$00*(0`, 0*ȠȌ#8 8pP% Xό`Q,`dQ ` !@+  , \ T,̠ČH`L  ,!,+! +h0h\40P%4,Ptlh l @@` "P!`.p'& ,̠Ča a@  " P%"%X(  8 ` L 8  L , ᠿ0!4! P T X 0#P!< @@ P `$T (&, $,̠Čaa0#P%#%X8T0T0@, "0?PX0$1 /(1`d0p0тRQɼg jrn<l>+h;ʄg+kAك:O[y!~6_`x0,|0&D0 H0pd00.$0p0P'$0#<4<0$0%\Tp1 t1`<00$00(0$0*(0*h!h! p<0P%0#ό0?dPX\Q, !@ `& + \ T+x |  , !,`&!&hx<xp@<P%@h@+P| $ X @,\`. X p '&\T",$8a13?01? 7R3?8 bx b0  00000#40000000 0#40 00001 00#4 00 00 01 00#400000100#4000 Ѝ0A-P0@`M00p0p 0h00d00`00\00T:`Ѝ`GV`U  g@#EgܺvT2M-0P?p000%@g0"0%0W0Z0S`@ ( 8r@@D@p `$  @yZ? ?@(Mr7@-@P >13?01? 7R3?8 bx b<0  00000#40000000 0#40 00001 00#4 00 00 01 00#400000100#400000100#4000#0020 0#40 00'0020$0#40$00 Ѝ0P)A-P0@`phM`|`|p0at`tp0alpl`bpT: hЍ`GV`U   J@g jgrn<:ORQh[كM-@XMTL 0S0S 00XЍ08` S 00 000

 T5X:0 P0`W 0pGeP0 0S 0 0 p&rQ0S X>T>00&b$ 00R4>5PE2:  30 0 0 P4 0W 0pGePUv0S` = 0SV$ 0   Te:P0`0U 0S`0   TT`9P0`0U 0S v  0&$ 0   Te9P0`00; U 0@`S`0   Te9P`000 ( @ W1 !Z R P  0AR 0R 0 B0 !}p0   9@0 pG 0C @0@0S+0@0000; W" H00 0S P 0@ R02@0505070S W0   o90 pGS v 0 0 0p0(08`Sl0L00T0/>0T00 l0pQ0P040h000`d000h800P6cPE0 h0h R0*TL 0SWA 0pGePP P|Pm6c0EaPC0ZW) pGePPR6cPEH30000S S>l0L0 0T0l00/T00pl0` 0P0`35l0`P00X0X00l0d 0P0 3$00c1 WR9T0L0 R1W 0pGeP06&aPE\7 @ P0*huW pGePW pGePP6c0E cPC0p 0 008`mґ"7  R*PŒ < BRP `D,QP<Π B R *ŒQ `؅Ό  B<<pC^l@PNQ*pG Q4`U *`CpQ0C= Q#* 4 `EP8pC8Q `Q0!%* @`FpQ U*`CpQUCU@CUCPP0P0 PPP00CPP@^P`8P0p`tp8^80 `S^&dp^`0@C f@  _[S S0300031 1^ᲠW( 0pGeP 6aPES6bPE@ @H4I0H000H0S00X0P0 R1W 0pGePW  pGePS@  @ 6cPES0300031 1^ᲠW 0pGeP 6aPE@h56bPE0H00D0H0S SED  D 6cPE ,00 0CD R500 0S  D0 BS @0B  00 C\N(05 B000000 R !40 P 1A@AS@0S00 00C 0000RWy  pGeP 0Sq @ 0  B  0S000S 0S>0000XWV 0pGePU0  C0R00000 0C00S 440 S06?R 7000 00PP 0`0W" 0pGePU0S08KP`0 $ 0(3/P4 000 $00!( ,000 BR1! pG 6k`V p 4.k0`00( 0S000,0R,!R@- jG Q0  A A@ $@(, P/o  " bP  Q  Q(  $  R/o " ba!   Q 0 S: S Q/-CPC 0CA0 0 <0/-0 b0 32 000E-p`$M@ P@ j  |xp 0 W FP$ЍM- SpM#@     pC 0"10"1 0`"1 pG \0 pGlj 0pGRS!^P*i@ \=xpb @ H6xp[ @ 4/xpT  )xpN0 @00CS p 0 0C Z # 2R`p5 p` 0 VX00 W0S0 \PV0 HPV0 4PV0 PV\H4  pЍ \05 FH1 H4- G ) K\% FH! H4 G K\H4   0A-:jPVPzQ00S@ 6/TPPU0A/R  R0PD <# "2Q00 /G/A-Sp``@( PKiW:T X 000 d2P \2PW 04 8 <00000 W80S0rsW1 0Sm `C cf2`#1>1ঁ 0 ` R R% R` ` .#R) R/ R W  0 (s 083^0  `    $,W0   $ ( , ` $ ( ,Č`@Ȍ̌  (/P*M-00 c 0<` 0 #0a0 2/0@-P@M h hЍ0A-`p @R00S@P  @hWPV@P @W Pp@-RP@"0a00000T01 qh00C0000000p ehA-S  pWЍ00XP@ @ @DW`0 U:@E0 ``P S*A-@~00R0S@P U00 pEW 3 #~ R `G `@ U00MM-, 4p0 ARE3D:< @ 8L\*ЍMЍ/ `A@ 0 0 PD <0 0D S*H00D S:L0PJL C0R:  pG@ P0 00fMM-8`ApQH 406: @0<D00CS*pЍMЍ/PQ1$:@w@0 PD 0D S*L00D S:P0PJP C0R: l `F@f P0 00 %EpMM-0MP` P\0`0@ R  0 A0\ 3XR pD$,p ( A R$:[\0 K 0\0 $@ d00DZ0h00DZ`d0l Gl00R,: l00h00d0 0`00\00X00 `0ЍMЍ/d0pC d0@$@PE,0Z0  ,$U0 E,$Zp@-`P@/@"@pM-@ M  0厱 $(0 ( a0  p1 尰 P 0 Q 0 Q  R 0 0cS0!`AVV P0040MP?oQ26 Q0Z01,P,0000,PS  0S0S 0 0$P ЍPP,P1,PPEUPP,02S0 "2/N2S0 "2/m0 tP/mPSP dP 0P//n0@SOPPPOOO / / / / / /p@-P2 E0CS 0@20p茒 @0S0/ 0 S00\0S / 0/0 -ddQ S0#$R0#R>2 -0A?o2 0D00D! 0@-QRQD0!6!Ơ! 5a0Q001c00000 03a 1001cQ00000M-p PAa Q`*M`4`0# 8!bRR`""f &"e&b0  L!  e&b0  L `#bf! b0`00 L`L  L#GGŧM-`M† Z`P& `p@ / S& r0Q-p@D) Z^ ZJ @ `r 2 + 3,30+p@Dp p@DQ Z@D@D 0000Q0@D4 W Up5P R U0 3 5 ZPX PX  E R  0 PZ/@DP@D 0 6 @R5 PZ/@DP@D R5 R5 @QC0 0S ZQ 0  RZT`ЍR 7 B5S50Ί00S0D   0s0xS00 0S000S 00/D000D p p9P0@W@/ /Ds@-@  `PV TPЍp!-\ @-`@-@ d0 0s0kS mS gS000iS  0 BR00D/P$0/A-@T`$`0Po ^ʎ P4"P Z, \A AR:p @D H L4G [ K0G0"p 2A2 $  >G> BNp  BNp S  P/h ^ 0@@_]p@-@0 1P`MPPpM-P00@0@TY0DSSU_:APDQX:PB`@DT`P0S4#110E;C0CURQBNQ7PEE00E0P0( NQ*:L@Q*:S0P S0P0P0\?SjS@AU``R`BV0D `N@V*PE0SS\ QA 0@NQ:L`Q:```Qtp!`pS`P W&P@H X P @P0C#1Qs#0k E@`Q`Pc0P@0Q0PYSX0 P QN 0@!Q@3@#Q@3T@N`T:Sr@ETo`@D`HTt`@$H@@Cp`p` PpG W Q!P``0C#1C$P@Q& 0E`[`P0\S0 PG @T @0@`D$EUA\PE0 .,0\#11C0URQ'NQ@@00P@`0``pppTpPPP P:PE0PЍPPEPPE0@-$ ^P vo)@-@0OP0 0S 00 0ЍM- 08`>@PPЍP pppT:40s 8X' 400E?o2Z0S  IPPZ 0 p 1W:40UX VP0P#T 03?0AP  Br/03A-`pP@TQ 0P`1@E-@PpW 5_P_ Ѝ`G V `! !(@P)A-P`Qp@[`df0@P0T  T # 2RW :pW`0?@ OP@-ꬒp@-`?P?@U@P    y^p 0#  BR / 00@- B ^@ L QT^0R l@-0@ P R P @@ p r RQ @B/D P0/-P^\S0q R0/R/M-@P`p200 .R#R RA 0bQL$B Q(qppprlrrrpp0q\RU ?R [R b^R00@^R |RW 002p0CS2 20000Ѝ} b \Q ]Q m k Ayi0Ce0 R<12be @KIG Ntb= ;a0 0)S 02- W0_0Sl0*R  ?Q00 }D 0-PO Eꌒ֒풊7@-P RRRRR0^0C?o2 2@00S0S!o Ѝ0@-@LP8P t P@l 0 0QB/p@-\P@00 P @P0*  p @ Dp@-P@t@0 SRpUp0@-0@pP`P Ѝ b0S R 0C0S R R0  \C/RA-``Pp@0# 0 CP#PP  LP TDS50 APP  0DR0c0@DP@0 S 40 C5R5 ,p@-@P b❰PP@pd0\/- ^ ^\ Ap@-@P0@T 00S l 0p U PU0\ @A^0 R   0p 0@ً P/0@-0\ @A U PU 0000A S/ P/0A-@p`P PU@H@ PPE0\A P/S / 0d0S@- * 0d0S$0/@x}@-/0<# 0Q] Ѝ @-@D0D#30 00#3Ύ 0# !4ׂC0   /l @-w#,-@- 00.Ѝ Ѝ/M- M P` p@p[ d[\0T`P`-0 :5P@@U Ѝ>>FM-0!0!P#XM`0%0S  R V050X030H50F%S V05p@#-S 0S7 0 C R p "00C \.0.SP40P0 C R &*S)P%@P0+S S #S *SppWpg@@@@@@7#0pC:#0CP00C Pʯ0zSgSLSP ZSP h Cr 1" lP0 lRPL0xSbS%S XS V%03050pS% X0ƅp>Pc0CS}8}8}8}8}8}8}8}8}|~8}8}|~8}8}8} 0 S50 BRW0G Wppg`pV0405 0` FRWpGpp`P,S50lP 0@p 000US ISk MSE DS w p!@000 @iSV mS0 aS p A@ @[0 @vpo 4o[t 0 @dp x wi0 0PP@@ :@$Qd00 ! R Q00R @@ 0@0 >@@0@@4S 00,$0 ,0@$0 CQ *R.0 R , lR  BR  LR  [ 0>s B/o"0 pXЍ 0 Fp 2 @0ESP@@ lP ZP hP LP 0  PEtP zP0 00  @; ?0p p 7D_ڊ,@-@PD"@-AMM 0@P ⵻AލЍ-@-@- 0d0SL'H0_@<' 0d0<00S 0%@/3@-@l@(0@- 0 00 ًً(ً ً@-?!!SA-`LnVp1p!P@ZP@ 0P:`V耖A-0Pe?e~'c up/ o`.!%@%AEe$B(C,DFeGe~'c $up/ o`.! H%$IME$J(K,L NEOE,3( ,ŕ ?0 P5, 0c0,00(,P5,0< 0R: 0Bx0:%E0 %X %$\ (%,œL ,0XjT` p $p 0(pS,pSpSpSx' 0p pJ刏 !(0 pS S@$pSS(pS,pStSxS|' Xp p/ 8!'X  SpS S$pS( pS, pSt Sx S|' \p / ᴋ~'!\  SpS$pSS(pS,pStSxS|' `p Ϡ/ 0|'!` x R*<0, 0C0C0 000 ,0:%X E%\  %` $(%,Ń,0< SP*0, u @C ,0S:PEEG4|00sq 8< BSQJ*4S5 00SE`5S+u<00404P5 U0,05$uL0 5X0L0 SX00:(Q@J ,% H -H,\à̌3< Ơ'ʌ6%: H0@9,7 ɠ*nj @ T>`\員*` .. `ᡀn\(\ !..!_Pp!SP%..S@pLPHp.@p"p/ .#P% .,S0P0L X 4_0,`Q6*, Au 1uA\0A34, ^:4HR ,..!;4" " 1 10aq́;!1P0  .  !-"2#,<1 0P,,!5:S%.0,Q "# 0 ">## 0 "048<S00@0C00<08 CxxD00CD0G y7=O'y7gVgV/'cE-P` 0DMSQT  @  @ @Dp @P@@e@ @P@@e@@R図@DЍT0$00(0%@P 0 P 0CP0pP 0S 00 R0S 0@00C0=“ۓ\x\#@- 0x h 0lt=P 0h 0 t 0h@T `P 0 0Z蔋~WA-M   MЍSM-!ΰ0 P <   \<  @b3>>  @T ЍM*P B b5 32p> ` !B!b6; 00P 0UP5RZ0X U ;A?o\20S PE 40 0@SP,U  $juy~@-@@P xȲt0R?\ X彲T00S80D 0@0<0<0me 00 Ѝ؋؋|؋׋wgx؋(OD΋E-@0P t$M` dp0 @ S$Ѝ 0000S  0ꍔM-[00 0`p0G0P @@DUZ0@SЍW/SB 0 #pGp@ 0K S0A00 0 .3#0`PV7P `p 0Z0' 0U$ C`G UZ'W0C 0 A@@TS 0 #@QU@@ [ ` @ 0 ,0` `*T0[ 03K2 #0*\ 0C^ L 03#0 0S 0tߔ0p@-00000`@ @RP <[H R 0DT$V KIp@:-eM 0  h 0 P  0Q*0C` 0\0eߍ 0Q: P 0  B"1!00S׋x؋0M- P`p0F&  k S( UW  B@k W  #W@e@e @ T Z R0C `F  0P 0 0 P ,g@Ѝ 㒀 @U@DM-pP0`4@Qh 0AS@|T84ȭȮ 0 0 0@0@P 0 0 00 0@@00PT6 @0 JQ 0 P @@u @t@ 0 @P@00P 0 ` 0 ` 0 @@P@Ѝ 0 `00P 0 @x@P 0 `0 S @ @ P0 S l 0@00 S <@@0 S@ R0000P ^ @Pr R0000P ^u @OoB@ @DOoB[ 0 001P[ 0 0!00C0 a D5M-P`0@p0 00 PЍ00 P M-P`p0@0 00  P 00 P ЍE-p M\@` P   0 000 Ѝ0  PPU00\0S=@S@-oMM-`pPMU@@P@ߍ[P!0P @A-@`VQQPCQ22QQ0 (QZ +30ASDDDDDDDDD$QP D DD0DDDDD@DDDQP@ D/M 4 (Up 0  ep M00?Up@0 T?pȀĀ0SUp 0 Ep   x0  ld0XXp LPՕbb(bytb4bbŕ؋؋؋fb s@-`@L \0R0PP0F0 l@0 l,Ѝp@8ЍpcSc؋M-@PpPp$P000 0 EP0l `P  $`M(\0T00  -ZZ_/j/@-PP 0@@$0M`  00L0!h0SP  00L0!h0SGPE  QL0? 0 0 0 0 04 XqH{# 00 0 0 0 00.  0 0 0 0 0  P e a^ L6Ѝ0<00S 3/Ppp 0 0 0 0 0 HE*$6/[)[4]tD&@- P &#P\A-@P`$`ܟPP T0 ! PЍ K1PPP,00!0 0!4 0 (@6 xL hL0 P00PLP@T&PT00  `P쀟 pU0 pP P TOP,0S 00S PP `X0P @0H0 @ R@_/j/Ї0чBBEݖTffPQ/@-  @z+.? -@- 00 ЍЍ/M-@PLppPP(M<0 R  R R 0S T T"TTZP(Ѝ0<0`P ,L`PT0 !& @ R0T!5PἁU P P 0hƯ P0ST0 8!8PH PP T0   RP0S0S 0 n[ {P z 0 0S   50 0Z0U0S P_/j/T[㗊[%+A-P 0@ 0M`P $0ЍL8PU 0S \PX pP &PP᠀UH0 pPp`0` 00 P  4 0P D00D04ST,ً,bbLkA-XP`Vpp0P $@T  R 0<003/p`00؋@- 0 D΋0P D/$0@o//-<^ /%(-<^ /%(M-`LXMP+ PL@P 0 9P 0$P0D LE0Ḁ0p0p SP @TP XЍd P  CvPpP@$@P0 `[E-pP0` `@<P3 7P/ PP- H 00 0 0 0 0 0<0 0S  3/0S   ЍE/T  YE H#P Ѝ@-DP A؉@-t1@l1P `P/P T@(- PT詙p@-@1P PpPpTdP 0@S (`0S $0 p`0S같؋؋A-q0S@001@1P oTP  `P @`P@00P@|U D0 0<003/@P $0@   @VP؋W؋p@-t0t@`0lPS 0S XH1`P @A1P P p@J@؋؋0 0 0 0 /Wً؋؋00?P ?PP//)E-2b0p CPR񟗓tׇ؇,هTه؇؇tׇ|هS00@40$(@!1!0@2"#p1@p0 0@S 10S ps@D@1!0 t$T h1  Ѝ;0T1@ ?0D10S 81`0102#(!   BR1!! @ AC< V  ÷00 <0<0@<0<0@<0;0@@΋׋׋)Mbu))Ι׋׋׋؋D΋؋|؋)؋؋f׋ߙp@-0P@?T`OOt@ C dC?T@/Tr0R$ 0 p~ O@TD @0 p),ًM-`P 0@0#  00S墥00Ȁ(`0@0p` 00P  | p`VC QC PMC HCЍM+<ً0bb8ًb4ً*,ً0@- @` p0  t@ X 0P s0@?/O0 S4R$@TD0 @ Ѝ0bQ 0"S B R00Q00S 0"SS00/0@- "<0R80R4 r B ЍE80@-@$0$ ?0#30؋؋؋Mb0P 0/؋M-@$$@v/P  2 2P@%B+0!@0P`N! "#/$ R$% ( PB , PB 0 PB 4 PB0@q 8B ,q0 B^ 04 8 p<3? 0 0P05_ PRQ  <000CQ 쀈 ]BC D0l0lv0` 0X0 *ЍًQH$ً΋ًb*(ًMb,ًbًً ً ً@-L0D00S8[@g",0,}P}#E@J(ً$ًv ًM-p4@0 ST0S t$ CQRP `@/r  BR p(40S40S MN$`4Ot@0s00XV0S003pMl003娃p pDdHL@0V3 3 `30S 0S0H#0000G@ /P $#p00# R* 00 P 2p08"Q 00 P2pV\b qrX q^`B0\$"0 00"0r S =11001p00R0002P@A001q 1 1l!0 @ 10 # 3 07 R S4*d``^ T1 0CS0R$P$e KMW!@0 R 0 00 /r O0?s00CSR @0 X0U*׋׋׋|؋׋؋؋Mb׋׋)))׋؋؋))x؋׋ךD΋嚊@X؋@-\ 000P SDD @ 8404,00S@H؋)i?~)׋M-죟C0pS000J-P $B-P 39-PS Q*t?0h)-P`c Q@00弅 R 0ᰀ030 C03[ : P 2St +00W2"0S 2 R 00# x~ Dhy W  P2 bH2HBDl<i 424 L (2 0 "0"0"0"02 2 *1!@ 1! E 1 1@A 11@1 1 @?,1 ЍMuqP  l"<0R80\R4r  D+< t0P  1 ЍM1 0 ׋)))ᛊ)(,b׋׋b0b'bb՜|؋ff؋-׋؋؋؋׋؋)ًl؋׋؋׋؋׋؋׋)W׋lD΋ךx؋8MM-0`VPPCSPDQPU0@S0S0S   Y?3 0#SЍ Pv 0 SP-@? |2| +P l2 kP X/ H2 R 0 0ЍM+ЍM P}p  > 0Su Q R Ro R0Sn -> V ->1Pf`tp`@%j>T+0 @000P 3 1 3;?$0S4%04  > 8> f  x>  t> 0 BJ`D0C `-&ًًcSc,b؋؋؋fbO0b(ًY؋D΋,ًًt׋׋΋*Mb؋PM- d億0P 0x4 0p$0l$0 d4 0 S 4@PЍ((00P P 0@00#03UPC00S x#00@S hs001S0T000083S&낧pP PPRP@3# 3 00u 2 u똲 B 2 +0@"@0p0 Ux"0?0S40 82pp1P 21BIpW  OP !1R0!01v!1R0!01 1g=0!01 0T\q0S 00@H10P0p3/0S0S S SA 0@ R |)0) U @PP0?@0ID΋΋b؋؋؋؋؋<ً؋؋؋읊ًW؋0bxЇ΋0؋؋΋$΋pp΋p؋ ΋,΋0΋*΋؋M@-3P!T0   @ R  //׋A-b;P@ ~PP` ZP@` p9T /T UP;TG@0@DF&M-0M T0`0T P0P@ P$pT80$<0 0p@pppp5 P@ 0 S0C 0 @0Ѝ00#s0A@$ 0@e + ( Z V``$0,#$,0(#@Ѝ 0S/S00Z.R0SeTt@.RZ .R,G ̱!aqd!t F 0,$00"@$P(p,`   lD 0;o P0L 0l DD`HpMPNPOPPPQPRPSPTPG@Ppt@: 0 00l 3@Pp0P@p,` l0@e X*dP`0hp\#Td0|#tl0@01!wv $xy(,0f ejg h i ($kl0(<,0l+To{0L00 DDPHpM0N0O0P0Q0R0S0T0g6 p@$ZD l0; 0M N O P Q R S T 0l DDpH`L@P@t@3  0l2@P+@)0 l@0e X*h0d <"4R$Q S$R S(dS #,`T ` !L QX MPND P\ O PH $P(,0lh+T2 R D l: 0l4 p@' l0@XM*d `h0, $dP<9R!4:R",< S$> S(#<@0`0? 80%#l0Q@0;0@0=0l,+T80S05 pP$@0p`t0x0|0d0h0l0S0p4`0T婎P( #+@P 00#0 0(00$00 0Z@P#0$P(p,`0T0 P0p`0 } @{A,p@-P` +@ +0000 00pM-`3Q p (0_0S @%?: 0 J@` $03 00 @0   _08080_8_P T8b@T  Ph}?A-P@p`U=000_0SM-0P0Mlp<`P? 0h L 9 0SC(@P< 0h Lޞ ) 0S3 0S. `P* L`@T" $1 0@P $ L`V@0Ѝ 000 SX7 Xb X @` P ,00 0Lh孞,0S@@ ܌T0< R Q 2/[%@ 2/LP7 @TP ,00 0Lh~,0S@@ ᭌT0< R Q 2/[  2/P @001<0 03/@T|@JPV 0Lh寙OT y00v ,0 h( Ⱉ0P0 kdX6 (P10<0 R%@0Q 2/0 R  02/P0T B<@0X<000S  3/P@ 0 he @%1͉w~p@-@0 1P`PPpp@-P@0 00    pD@-0@ S  0|F00 S p@-j@PTA}O@Q Mk0S1@0000484 0 00P!"/`0<00S 3/P&p0 0P  , R d$P:m0 Ѝp0M-@P 0l!PC `0T!0p>0 &;OPpp@ A-PP``@p <P2>>p0 %;1PAp@-0@4S$ S ,S 0 (10HS S SPP0Ha 6/U` p0 Hp@/s@-P0<00SO`GP  < S TFED 3/&p Ѝp@T:T4m@j@B0P  P/ S  R @-@ 0 @@$/A-pP `@P 8Qp0嘃#2 SЍ 2/  0V3?003?003?0@[M-0 S S `p@PQ0S P`8ጀ?s00XP0S9 xx`PG0HP@ 0 0Rs0S0US0S,$  @@  0 SSZS0S%xDDS ` RppDSP->0  Q1!0 0#1Z>0?jS7@-@ 0 <PU 00 5/P}_ Ѝ09SPU)0  P s@-0` @P%P  0` B@oЍpM-0Mt` 0@`PXPpHPTPPP%@VC 0P0 0Ѝ00wPP %㪉 P PU D$P 偂P$P$ 0ڈp5P @0`;S000$P RS$x̛0P0PP VpP P0 `0 嫈;R0`NwP `W|DwP c $2P$$ SPY DEs ᅈ$-wP L $P$$ P $0 ,00(G6((L c wP  $P$ $${0 ,00(.h6((0 P0GUpP0(p,xP$ہP$$ $P "/ 0,*%  "(( 7P (0S p(lP Z00꺟Ɵ͟ן矊ğ'pމp#܉埊7@-@PTP$P 0 P0Q Ѝ0@ Ѝ0@G]g|@-@ H㦶PSЍ  0 㘾*p@-Q`P M 0AS@ @PPU ?P?PJP@ 0R@ ݍpp@-404P@T(@Pp@Doo\o0  RS?/0\oM-p0,@P(04000P` 2P 0<00S  3/P Ѝ0P$S00 S*0S 勺@Z<0 强PЍMNM-@XM@P< 0Lpe`Lճ0  @XЍ.0 .R0@/R 0S/ @- 0    @ @ 0 S0P \ Ѝ@0    0Ѝ1&@-0@0$$0`@Aލ Ѝ@ Ѝ/7@-@HPH0P0<004 P`  Ѝ0n4wg@-劖w[P 00 S/ P R00/0/p@-@@M0 `$0 t10TPP @@ЍpT  @ d @$ 0Yu@ 00U$fPT@_Yo|V0M-M@P p0P Ѝ0B [@PS 0SP Z 嬄 ᪄0S @P  0R`S`Q'㦗P00S$00S d Z+ 0h0 @T ᙲP000@VP Q`lA@V0\ꯠ9SA-@p `P00 00Up`0  P1:HLP` U0 /0P0C0 wgQ/M-p@`0A60@@T:A0G P 0P8/P 0 R EPET  Z0D&S@ЍPꫪM-Md@0X100( , MT 0Pp$0 P 0S*"$ 0T E TD* 0!0K0 `0S%000 (0S00P0S(0 00.S 000 $0 ! 0ZPP00P 0 p00C R Z\RPP0@,0`V  /=\$0CU 00㆖,0P`0  Bp0W    Bp`W`pC\WZ0``DPǠaM-S MP 0 0$Sq0{SP SkP@0@0S00a0 pp ![$: X1 800 S40a0S $`J 0 /0 pS J 0p`@ P'0 =P 0j0 0CSl X X QT00 p10 1 Ѝ pƋDa&Pqp@-@ Px`P P 6`NvVP ᶂp [/0@0`@-@M0@` t@@@pPP NPP 0 4@@PtP ጂ00PЍ<0M-Pd`ddp00U0AT<0S 3/P0@pPɋaaDȋ0 PA-`P QAtml@tpP  @. . .#?p@-@80PH*P0 *Ppp[@-``@PP   0#)P P: 0)P ЍpA-PX@P@L0@3?SF@PAp` ⴍ0S7 P00S2@P. /T/h/D.D/D/D/D/.V#0 FP)@ 0 >PI@ .P@` JV ʎ0S 0S @ЍV `Vp 0 P0Syyp@- P@ᩎ`PH P8  4 , Pp p@% 0A- M#00P@`iVe )`]V} Y K)`   L P)  d @0 s)p<`7WZ 03 H0WW ,FopFwpW㨂037  ) t  0FSX  ( c t V?136. ! 0)`4V (W,`!0)`LV/ 0wJ7 V  0(P h00 PP0S ЍSF҃<mU*%vX);QdaXt(wVX*. ѡJȡM-`HM 0Q$00$S00hP 05 E |yx@P  `qHЍ[ /(0@0T$$a (@PA@ kOU4 H 0 ( @Y ;4pW |,0Pd @XD (D ,4 u (P (P (pPU (pPp s(PD m(P> g(P8 a(P2 [(P, U(P& O(Pp' pUppW D 'D ' @"  ` 0 @Il @0RSF  UVD  3 #1Q  R d@. P07 70'P@`(70S(0$ 035 0W ,0G`,0@@D  0 0(,P,DpJ( n@@pW  ,pU70S XDp0@ t0$0S0S 0 S00 0 UᡊP (U6gUp2<08 l'Pl08pS<@p  @0='Pi l0Sl@䡊r2U[셉\VX*aXt(mU*ע1Hoݣꢊ 0p@-0 0PS(0 $0 S0@$0 00%(3/P. T00@d00DS$0 (3/00p$@@4@0S  @4 )@@@ S.@@ @ @(@,@0@8@<@l P L 嫔ppˆˆM-0@MQ0t0V 0C806夆$0600@` 006儶 0&6 p \\\!  ((! \\\\\t\x\| _P!,PR\\ p\\ \ \t \x \|! ppp0p!r  pp\\\p\p\p\ t\ x\ | ' $ppp4p4z'#0 0 $B(4Ÿ4b@r80PQI*A P3 P:A  0#! x1l!0#0! 0AXXQQ>4 " # 0"80!>#! @Ѝ!1  . .!-"2#0  0pg& "&5:ej! 0O'y5z=Na'`ֵ녱y7[ީlywcy7gVgV/'E-@M`TP訠 0- T TQG@ R90 00 00 P00@Ѝ0S% 0RS0 :01@ S0 xp@ 0Z : 0 0 '@P/A-`@P@PVVp1x#T@DPE T@0P0`FM-`@PU<|p pP P PM-MP ` p000Q0#s000"$#0r"4Ƞ40  r P TZpP@ Jp NKK[m@KXЍ@ U(PT0S I@$1Ϲ@-  (      Ѝ@-@0P( M$ $   Ѝ @-M@#P 0 00 000000ЍM-P@M(70!0$@P @:lP `P0 2/p $nP pW*` $dPl 8040{ $VP $PPQ4{@@ЍO訁~0bSA-@pP`P600S`1 0S0 0S-0S0S0#`P BDJ__0_`   PPp_ _P_p`l]E- 0P0@ @ 2E0S t$`Xp p VP 80 0DS0*0 00 Ѝ  P 0RDA-p`៮PP%@@@pW% = S" `0`S 0 S0 <0 $ pW 7/PP  0R"3/@03/P=E-(`pP:@P Z 00 0Ỏ@P È 0, ЍE 0 ᤋP ЍK@- Mp$`P @Ѝ@PP PPu ᑈx T@1t @4? 0004 0oPx PFet:@-<042/ 0$0 0 0SЍEA-`@ 0p PŋP  0!0a1\:(0S @0@$0Ѝ@[EA-@P`p2P8P 00(0 0ЍM-8M0`0S0` P0Xp`\ (h`PP@P ` <0<0@0 040408000X0(00,,0LPp H00D  0S0 Z 0h00S , p 5P0D0*֢& 0 404 ,R/Q  R$R00 0P}$0B -Ptpp H00 0S0R0S D00D00垌P 08Q D00D0和P U 08Q 00@Q D00D0Po 808 4 < @0 0 0,00 0S1 000S, 3/P( P00, 0 @0< ,P0P0 D0"000S0%@C~0C000R: 00, T 4 w 0 QS@00R]:0,00P0h0000L 0P,0h⯺xp@LZ+@ P` J0 0 0j2  0#1 ?0, #ό1?s:1(0?cS001V0S-@`Hp$(A J%!f4崥r Afqx 0pG 0Q $T:100V000 0 `0 4400S8S<#̠R@RD"̠ 0 QD80 Q00 0 X (0 d00?o0#0Js0h0R,00 C?0S00$0{xp@+Rq 08 <#@D"   00S Q  QS @XЍ Rr  "0oo`&p W'c?o0#R 00! !0S TzT00 S 1 #R:MpBBpS: w`TUV`d @D0E[ 40T;t00XE0,00 00000400 0200 C,0?00R񟗦0~}~}~~~|Q [`aW:qW6A 44 R0 4  4300 0 00ZVŸ $̂q  QQxr@R!R",p@  p  @  0   Z+ 8$P P R R",   Z``  Z \,0 0,00`F*# 00`00L0@00 0$00 0 0Z0 $00 !4240 0r(RR",qQtQH !    p@ p @  p@p@ ( 0(( [$0 0$0 00`G@M-PM2@p (P PQ  0@ @P0"PU0@  0 !@S0T$1. `kT!0 10 0 0 S  3 #000 @ 0 뀰K`@`FTP 0  10 1@  $1 S>0 0:(  0#(0 00(1 S 0 ))0 `@≒ 0 " "", P!$ U!(! 0 $!p0@  03/ލ0 0 S  3 #00@0 0 @DT $ @-0_0_ 0 0Pm蠆@-0_0_)0(0Pm蠆OM-`PMpሺ0@S 8 ll @Ѝ 0 qP 0 *T 00 000 0 0      8 ` RH%` d R<%d h R0%h \ R$%\ l R%l p R %p  R% x R$x  R$  R$ | R$| t R$t  R$  R$  R$  R$  R$  R|$  PRl$ h$X  rq rq Gp$Z,p  0+n 0Q5 Zp% j 0J870㚻+0ఄ 0   R  S): 0. P=‹p t rqp  R R : R   R * R  8 匿P\00% p 0 00TQd*Se\pW pZ:^/1ap  $ R0,00IP {pIp  $ R 0,004P {p(1D0D0H0H0L0L040400S`p V0*. 0P00000`p0\0C0QɸƸꁦd&!"!&<"!!""!!#T#|####$""ADDZp@-P`@PpPp0 <0p@0/M-(M0P0 uP 0000 <003/PP  `88 U`,80S 3/00<0 0S  3/U 00S07 R?'s0  R/r $/r R 0@$/r EPP \Q P R R[ q R@EU/S0S 0 Č0Ͽ$/\r @E $ R $R R RtQ p$ $Q $ R-  R,v R}  $&$ ZtfP  %0E0 T*A`PA b@p@-@PpP@`@P T`L0H VTP0 HPLPd@ 0 PPdH`L`p@dA-@`pPTU \P 0\  R  R7/P0 0@0 S0R @-@pP lM`WI t 0 `U 0S$0 S(#< 0lЍ  "r !#4"cP40P80Q4 0Q8!00V0xx0pp   c Ꮮ lЍ@j,lЍ@ыg jgrn<:ORQhك[ @-0 Č0\4 <! P BQ t豨Ш0@Sp@-PU@P@0U @4@03/@\Tp/po}M-0@S0M@0Ѝ`VP@P 冷@V4 S0pX 0SV/ 0V04 AV-:㽶   04寶[(N Pu p0P0#rV  V Ÿ 000$"'X r$0 ,00(F(?(,\ !ɾTqPqHR @Os(ɰ/`OwgDmh/ME-gMP 1pA弁3/`P3W0.Q 000T00S@ 0 h ٿ 0PU \̶` f#1 E0 0CRQ Pgߍ^P0 000C,0P/ R/III@-0 ; 0ЍHE-`MVP0-S =@P<'8!V0000Sp$0Ѝ`F0S fS3pV@!cpPY0   BQ PWC 0Nb 0S$0 6꒩@ɩa㩊Q  S0@o/ /0S 0 _ @2 /@- b@PI/0000 ,= 00DV::A-PP`p@ U P0PPL$apa@VapaAa`DV::Q/R/0@-P0@?>@ 3?;;30 000}SP/0 /r R@/@-PM-(M, Pp  mP@@堵@(Ѝ U``'?S`VUb@P `0 @0rPU 0 `0C03@0rPE     0'31l0'320 03<W$00800<H00S.H0??0??0$1SnP 0 000P$10$1>a(p,0W4006 PpP #㓣`P0FW4p5<0 080000004 00P 4|"fPV  800`4 0,`( U[s0dPh`l$0`0"0S<08 <`V 8P?`P03?V :I0PL`P=R倱p 0t!pfP<y 80 040 00 "R$^BSS1R*0? P_@QP:P`p Pd@ 0b 0 0@P`  8`"(`"$`""`"!` pf01 0 0ɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[-ƅ ȅp˅Džȅp|ģD.˅Džd }jjjjjjjjjjjjjjjjjjk kkkk&k-k4k;kBkIkQkYkakujdjnjw[555 ֦gR1=C.)Dv1'HĶav1'HĶa????>>>׉׉׉2ecd؉i؉؉ ؉؉؉؉؉؉؉؉؉؉؉e؉s؉؉؉؉؉؉f׉׉׉׉׉׉؉'؉@  މ މsgb>q>SwgXegz4  (0@ @     0 @            (@@   0              ( 0@    !"#%')+/3;CSc @    "%)/;S      !#'+3Cc 0      @     =}???= } ?} ?  = f!e$EQ@YPS؉QQRPxPPPbR*QzQP QPQVQPRPQQP-T2T7T2RHUNJNy}C7/r1CM &qLFܻՇ stp9DKP/;U'&LHt7&x/iHB.׫VjbZHڣykI)OGI8z!A ,irﲡF'm2A`Bti#L˘wP2*˲:=Egeo@>@mJl$m0VL?ir;1?ir;~b3>O -;6PߥR1=C.)D4ubwF%wt8i9ir;wt8i9ir;QǤ#>LIdcIυhЅ0|҅ԅӅŅх'hUh=OtUR1hI_2%-'?M(-'?MtB@wf~*@.!Ê"[NYd9ir;(s*K>;Gہ5'?Ms愣J(bp؅څم؅څVd^^8(H@ @ b`A`'@B[l{я㏊.?Qbu &N5GWgᚉꚉUյ@x}uu@x}e \:E4k؉q؉x؉؉؉  @ @    @t33P]eheteeeeeeee<ePexef(fdp(8|, T0,$/0, - -|A8PL4L<0,4/x4@莂؎r؎؎؎-,Al-----.05.H...,/.L؎//؎@//@%6>%7> &>%82>%9>>%:aJ>&V> `2>%9b>#am>( ax>&> `>%:a>•:`>%;a>%<a> a> a>$ A>(>”<>…;?…:?†:?…9,?„<9?€;E?;Q?:^?„:k?€9x?9?ƒ9?„9?8?„8?7?„7?M@`?M`?M`@?M`@? M`@@ M`@@ M`@@ M`@,@ O`@;@!M`J@ @U@ `@ M`@j@ M@`@u@ M`@@@ @@@@@ a@@@@!@`a@`a@`a@4*`H@4*`H@4*`A4+`H A4+`HA4+` A4+@*A 1A  8A @?A0FA0MA0 TA` a]A0@dA@mAPvA`A@@aTA` aA`@aAp aAp@aA@aAaA0A`aApaA`aApaAaA`aApaBqa B` aB a!B@ a,B@!a5Bp!aABp"aJBPQB@aZB@ acB@@alB@auB@a}B@aBaaBqaB"aĚ˚(mQ(Qm(s*K>;Fe;Wke}dH=f5@NfO+'0`&+,] ,,f,J,J,Ůaaab bbbb bb$b/b:b?bDbKbWb]bebmbubmbyb~b vb bb bbbbbbbbbbbbbcbbc ccc#c)cwgwg iii%i6i;iKiPi`idisiwiiiwgwgŮiiil`iiUiiixMilJfijj"j*j2jM6j>j0`MjjZjwgwg 0c9cKciQj\cdcuc}ccccc cc cc&dd%3d>dŮTdbdhd ydddddd ddd#ee2e=e PeYeketeeeeeeeeefff#f;fGfYfcfzffffffff g g!%g*g"Xgcg$gg'gg(gg)gg*hh+=hGh,Zh`hwgwgd1+,EF$t.h?\`dxddmncrc32cxxhash64 sha256 blake2:&;&e&f&c&`&" %%%B&@&j&k&<&%%!< %!!!!!"!%% #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@ !1Aa  0@`@@A@!  @a`10  @BootOrder1234567BootCurrentBootNextBoot####SecureBootSetupModeAuditModeDeployedModeVendorKeysPlatformLangCodesPlatformLangOsIndicationsSupportedPKKEKdbdbxdbtdbr<NULL> #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      BestBetterGoodDegradedU-Boot*XHCI Host Controlleru-boot*EHCI Host Controller  *  +,;=[]  fdt_get_dma_range__of_translate_addressfdt_fixup_memory_bankseeprom_rw_blockdo_gptusb_setup_descriptorpca953x_read_singlefs_devread__btrfs_map_blockv7_outer_cache_inval_rangedo_bootvx_fdtbtrfs_decompressbtrfs_next_sibling_tree_blockfree_extent_buffer_finalbtrfs_read_fs_rootbtrfs_find_last_rootefi_free_poolefi_runtime_relocatebtrfs_lookup_pathzstd_decompressallocate_partitionsdhci_setup_cfg_ehci_create_int_queue__put_mtd_devicemvneta_txq_initphy_device_createata_scsiop_inquiryxhci_get_endpoint_intervalxhci_setup_addressable_virt_devxhci_ctrl_txpca953x_write_singlemvneta_setup_txqsfree_extent_buffer_internalefi_free_pagesleaf_space_usedsdhci_transfer_dataadd_mtd_devicexhci_address_devicexhci_get_input_control_ctxrecord_transfer_resultsdhci_send_commandmvneta_rxq_initahci_port_start_xhci_alloc_deviceabort_tdxhci_scratchpad_allocbtrfs_leaf_free_spacemvneta_setup_rxqsbtrfs_search_slotxhci_update_hub_devicexhci_alloc_container_ctxreset_epsdhci_resetxhci_configure_endpointsxhci_mallocxhci_bulk_txsdhci_initxhci_wait_for_eventfdt_find_or_add_subnodexhci_segment_allocxhci_queue_commandbtrfs_free_extent_statexhci_ring_allocsdhci_set_clockxhci_ring_freexhci_inval_cachexhci_flush_cache(((((AAAAAABBBBBB[.128,.192,.256] enc key iv src dst len - Encrypt block of data $len bytes long at address $src using a key at address $key with initialization vector at address $iv. Store the result at address $dst. The $len size must be multiple of 16 bytes. The $key and $iv must be 16 bytes long. aes [.128,.192,.256] dec key iv src dst len - Decrypt block of data $len bytes long at address $src using a key at address $key with initialization vector at address $iv. Store the result at address $dst. The $len size must be multiple of 16 bytes. The $key and $iv must be 16 bytes long.Resetting CPU ... PXEEFI bootmgr flow(%0*x) %0*x reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: CACHE: Misaligned operation at range [%08lx, %08lx] %-30sRTEMS! FIT images not supported for '%s' - must reset board to recover! ## Transferring control to RTEMS (at address %08lx) ... %s: %s FDT creation failed!FDT and ATAGS support not compiled in (fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s (empty, defaults to 1600K) %.5s (empty, defaults to 0) mvebu-resetmvebu-sysreseti2c@11000->i2cmux@70->i2c@0Cannot get I2C bus %s: uclass_get_device_by_name failed: %i Cannot get %s I2C chip: i2c_get_chip failed: %i %%.%ds marvell,armada-370-pciemarvell,pcie-portCannot disable PCIe port %d DT node! Cannot find PCIe port %d DT node! Cannot find ATSHA204A on I2C bus! %s: has to be 2 characters %s: invalid setting, supported values are: %.5s%sInvalid data for field %s Plan 9confaddr## Transferring control to Plan 9 (at address %08lx) ... filesizeQNX## Transferring control to EFI (at address %08lx) ... Base path too long (%s%s) Retrieving file: %s Expected string literal: %.*s Expected string: %.*s bootm_sizebootm_lowpart_%xwhole%s.%sextlinux/extlinux.conflabelpxefile_addr_r/EFI/BOOT/fdt_addr_rtftpPXEClient:Arch:%05x:UNDI:003000bootp_vcibootp_archkernel_addr_rbootfileNet%x:%x#size-cellsERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x undefined instruction software interrupt prefetch abort data abort not used fast interrupt request SoC: MV78230-MV78260-MV78460-MV88F6720-MV88F6810-MV88F6820-MV88F6828-98DX3236-98DX3336-98DX4251-Unknown-A0B0?? (%x)Z1A1 at %d MHz mcu_56Error: VHV gpio lookup failed Error: VHV gpio request failed Error: VHV gpio enable failed Error: VHV gpio disable failed Cannot add window '%x:%x', conflicts with another window MCUserial#%016llXEEPROMcannot read EEPROM: %d bad EEPROM magic number (%08x, should be %08x) firstbad %s EEPROM CRC (stored %08x, computed %08x) secondDisabling MCU watchdog... omnia_mcu_write failed: %i EEPROM regdomain read failed. Regdomain set to %s regdomainbootcmd_rescueomnia_mcu_read failed: %i, reset status unknown! Setting DDR speed to 1333H in EEPROM as requested by reset button... 1333Hwas already set cannot write EEPROM: %d omnia_resetboot_targetsRESET button was pressed, overwriting boot_targets! ethernet2phy-handleatmel,atsha204aCannot find ATSHA204A node! Cannot disable ATSHA204A node! %08X%08XERROR: %s image overlaps OS image (OS=%lx..%lx) Expected include path: %.*s Couldn't retrieve %s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s pxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%sNetBSD## Transferring control to NetBSD stage-2 loader (at address %08lx) ... XIPLoadingUnknown Image %s %s Uncompressing %sUnimplemented compression type %d bootm_mapsize./bootmlocalcmdNo kernel given, skipping %s Skipping %s for failure retrieving kernel malloc fail (FIT address) ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s fdtfilemalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT Skipping fdtdir %s for failure retrieving dts fdt_addrfdtcontroladdrError parsing config file pxe_label_overrideMissing override pxe label: %s Missing default: %s %d Bytes = %4d-%02d-%02d %2d:%02d:%02d UTC %sImage Name: %.*s %sCreated: %sImage Type: Unknown OSUnknown ArchitectureUnknown Compression%s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x %.*s.%s.bootdev%.*s.blkHunting with: %s dhcpUnknown uclass '%s' in label No bootdevs for '%s' Device '%s' failed to probe fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not set bootargs %s. 2024.10-OpenWrt-r29197-ab4c7d6af7u-boot,versionWARNING: could not set u-boot,version %s. device_typeWARNING: could not set %s %s. reg/aliasesethernetethaddreth%daddrlocal-mac-address Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s /memory## WARNING: fixup memory failed! ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated Cannot increase FDT size! marvell,armada-380-ahciCannot disable SATA DT node! Cannot find SATA DT node! verifyWrong Image Type for %s command ## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x ERROR %dE: can't get kernel image! Can't get image type! Can't get image compression! Can't get image OS! Can't get image ARCH! Can't get image load address! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Can't get entry point property! Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) Resetting the board... u-boot,efi-bootmgrbootmeth_efi_mgru-boot,distro-efibootmeth_efiu-boot,extlinux-pxebootmeth_pxeu-boot,extlinuxbootmeth_extlinuxu-boot,boot-stdbootstd_drvloadaddrMagic constantRAM size in GBWi-Fi RegionDDR speedUse old DDR trainingExtended reserved fieldsExtended CRC32 checksumatmel,atsha204marvell,armada-370-xp-system-controllermarvell,armada-375-system-controllermarvell,armada-380-system-controllermarvell,armada-390-system-controllermvebu-system-controller/boot/Invalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-VaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImagekernelKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot Imagefdt_legacylegacy Image with Flat Device Tree spkgimageRenesas SPKG ImagesfsplStarFive SPL Imagemenutitledefaultpromptlocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseednoneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedlz4lz4 compressedzstdzstd compressedInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdoseEnea OSEplan9rtemsTrusted Execution Environmentu-bootU-BootvxworksVxWorksqnxopensbiRISC-V OpenSBIEFI FirmwareELF Imagebootdelaydistro_bootcmdUSER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32%-12s= 0x%0*lx hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u The address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dDriver Compatible %-20.20s%-20.20s %s Driver Address %-25.25s %p fdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%svbe,sizeMissing vbe,size propertyvbe,size %#x exceeds max size %#xCannot find random-number device (err=%d)Failed to read random-number device (err=%d)area-startarea-sizeversion-offsetversion-sizestate-offsetstate-sizeskip-offsetcompatiblevbe,Unknown request: %sFailed to process VBE request %s (err=%d) vbe,errorvbe,errnumvbe,requiredCannot handle required request: %s flushVersion: %s Vernum: %x/%xvbevbe_simplefwupdcur-versioncur-vernumU-Boot bootloader-version## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX Trying to execute a command out of order %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands aes.192aes.256enc-nDriver uid uclass Devices %-25.25s %-3.3d %-20.20s %-51.51s%-25.25s Flags not supported: enable CONFIG_BOOTSTD_FULL ** Booting bootflow '%s' with %s Boot failed (err=%d) boot_paramsDRAM bank-> start%-12s= 0x%.*llx -> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit eth%iaddrcurrent eth = %s %-12s= (not set) %-12s= %pM IP addr = %s fdt_blobnew_fdtfdt_sizelmb_dump_all: reserveddevicetree = %s serial addr width shift clockarch_numberTLB addrirq_spsp start Early malloc usage: %lx / %x changed to max of %u entries of %u blocks each No UEFI binary known at %s zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] bootzID %llu gen %llu path %.*s BTRFS: failed to list subvolume: %d OFFInstruction Cache is %s List of available devices |-- %s (%s%s) | |-- %s -e-sUnknown parameter: %s Class Index Probed Driver Name ----------------------------------------------------------- rootcyclic_demoRegistered function "%s" to be executed all %dms function: %s, cpu-time: %lld us, frequency: %lld.%02d times/s Invalid ELF image Automatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified host:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... usage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** No current device Interface: %s Device %d: No valid FAT fs found Filesystem: FAT%d "%s" ** Unable to create a directory "%s" ** unknown Cannot find RTC: err=%d Reset RTC... ## Failed to set date after RTC reset ## Bad date format ## Set date failed: err=%d ## Get date failed Date: %4d-%02d-%02d (%sday) Time: %2d:%02d:%02d %s: Bad cell count for %s ERROR: - must RESET the board to recover. ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) no-mapfdt_root: %s serial-numberWARNING: could not set serial-number %s. ERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconfskip_board_fixupskip board fdt fixup ERROR: board-specific fdt fixup failed: %s ERROR: fdt fixup event failed: %d - must RESET the board to recover. timestamp/imagescompressionUnsupported %s address size data-positiondata-offsetdata-size/configurationsAutomatic boot of image at addr 0x%08lX ... ERRORinf no %s devices available IDE device %d: no %s partition table available Device %d: unknown device ... is now current device %s device %d not available %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s %s: Cannot find udev for a bus %d printupdateCan't get eeprom device: %s EEPROM @0x%lX %s: addr 0x%08lx off 0x%04lx count %ld ... Working FDT set to %lx fdtaddrimage is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failedControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s New length 0x%X < existing length 0x%X, aborting. No FDT memory address configured. Please configure the FDT address via "fdt addr

" command. Aborting! mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s boaFailed to update board information in FDT: %s Can't get hash value propertyCorrupted or truncated treeUnsupported hash algorithmBad hash value lenBad hash valueCan't get hash algo propertyCan't get image data/sizeerror! %s in '%s' image node hashalgouboot-ignore-skipped + error! %s for '%s' hash node in '%s' image node ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC FIT image found Bad FIT image format! description%sFIT description: unavailable %sCreated: Can't find images parent node '%s' (%s) %s Image %u (%s) %s Default Configuration: '%s' %s Configuration %u (%s) %s Description: %s Kernel: %s Init Ramdisk: %s %s Firmware: %s %s FDT: %s %s FPGA: %s %s Loadables: loadables## Checking hash(es) for FIT Image at %08lx ... Hash(es) for Image %u (%s): Bad hash in FIT image! Unknown image format! ## Executing script at %08lx Bad magic number Bad header crc Bad data crc Bad image type Empty Script Could not find config %s Could not find script in %s No FIT subimage unit name Can't find '%s' FIT subimage Not a image image Bad Data Hash Could not find script subimage data Wrong image format for "source" command Data (writethrough) Cache is %s determine a file's size - Find file 'filename' from 'dev' on 'interface' determine its size, and store in the 'filesize' variable.flattened device tree utility commandsfatmkdircreate a directory [] - create a directory in 'dev' on 'interface'fatrmdelete a file [] - delete a file from 'dev' on 'interface'fatwritewrite file into a dos filesystem [ []] - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatlslist files in a directory (default /) [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsize - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2ls [directory] - list files from 'dev' on 'interface' in a 'directory'ext4lsext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4sizeexitexit scriptbootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s) EEPROM sub-systemlist eeprom read [device_specifier] addr off cnt eeprom write [device_specifier] addr off cnt - read/write `cnt' bytes from `devaddr` EEPROM at offset `off' eeprom print [device_specifier] - Print layout fields and their data in human readable format eeprom update [device_specifier] field_name field_value - Update a specific eeprom field with new data. The new data must be written in the same human readable format as shown by the print command. DEVICE SPECIFIER - the eeprom device can be specified [dev_name] - by device name (devices can listed with the eeprom list command) [[bus] devaddr] - or by I2C bus and I2C device address If no device specifier is given, the first driver-model found device is used.echo args to console[-n] [args..] - echo args to console; -n suppresses newlinecyclicCyclicDriver model low level accessget/set/reset date & time[MMDDhhmm[[CC]YY][.ss]] date reset - without arguments: print date & time - with numeric argument: set the system date & time - with 'reset' argument: reset the RTCconinfoprint console devices and informationdcacheenable or disable data cache[on, off, flush] - enable, disable, or flush data (writethrough) cacheicacheenable or disable instruction cache[on, off, flush] - enable, disable, or flush instruction cachebtrsubvollist subvolumes of a BTRFS filesystem - List subvolumes of a BTRFS filesystem.boot Linux zImage image from memorybootefiBoots an EFI payload from memoryblkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries bdinfoprint Board Info structuresourcerun script from memorybootflowBoot flowsaesAES 128/192/256 CBC encryptionprint monitor, compiler and linker versionpanicPanic with optional message[message]helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'alias for 'help'iminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)boot default, i.e., run 'bootcmd'bootdboot application image from memorystart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsfwupd,vbe-simpletotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structcompatdevresdriversstaticuclassSunMonTuesWednesThursFriSaturstdinstdoutstderrshowconfigureseparatefitembedbloblistloadoscmdlinebdtprepfakeaslr-moveaslr-randefi-runtime-randrandom-rand%2u %2u-%2u = %5u %s0x%08x: %02x - 0x%012llx-0x%012llx : "%s" ** Unable to create link %s -> %s ** Supported filesystems%c %s: No I2C bus selected -yReading bank %u: Word 0x%.8x: %.8xreadmReading bank %u len %u to 0x%lx cmpComparing bank %u: Value 0x%.8x:0x%.8x passed senseSensing bank %u: progProgramming bank %u word 0x%.8x to 0x%.8x... Warning: Programming fuses is an irreversible operation! This may brick your system. Use this command only if you are sure of what you are doing! Really perform this fuse programming? y Y yes YES Fuse programming aborted Overriding bank %u word 0x%.8x with 0x%.8x... Bank %s: %s%d: %s: %d [%c]%s%s-aGPIO device %s probe error %i Command '%s' failed: Error %d GPIO: '%s' not found cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %u) value is unknown (ret=%d) Warning: no access to GPIO output value Warning: value of pin is still %d Base Address: 0x%08lx Valid chip addresses: %02XBus %d: %s (active %d) %02x: %s, offset len %x, flags %x Current bus is %d Setting bus to %d Failure changing bus number (%d) Invalid bus %d: err=%d Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Error: Not supported by the driver crc32Unknown operator '%s' Invalid data width specifier Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX Unknown errorloadxy_timeout %s Uart## Total Size = 0x%08x = %d Bytes ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... %08lx: %0*lxbyte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Invalid address/size Refusing to do empty test Testing %08lx ... %08lx: Iteration: %6d FAILURE (data line): expected %08lx, actual %08lx FAILURE (data line): Is %08lx, should be %08lx FAILURE: Address bit stuck high @ 0x%.8lx: expected 0x%.8lx, actual 0x%.8lx FAILURE: Address bit stuck low or shorted @ 0x%.8lx: expected 0x%.8lx, actual 0x%.8lx FAILURE (read/write) @ 0x%.8lx: expected 0x%.8lx, actual 0x%.8lx) FAILURE (read/write): @ 0x%.8lx: expected 0x%.8lx, actual 0x%.8lx) FAILURE: 0x%08lx != 0x%08lx (delta=0x%08lx -> bit %ld) at offset 0x%08lx Tested %d iteration(s) with %lu errors. The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data %08x %04x %02x ? HDXFDX100fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 1000BT statusPHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T 1000BASE-X PHY AN duplexPHY duplexPHY AN adv duplex read failed, assuming half duplex PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %sMII devices: '%s' Current device: '%s' PHY does not have extended functions No MDIO bus found %x - %s <--> %s Reading from bus %s PHY at address %x: Error %d.%d - 0x%x Unknown modeYesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s Rd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: HC WP Group Size: User Capacity: WRREL Boot Capacity: RPMB Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state No MMC device available MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s MMC write: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks written: %s MMC erase: dev # %d, block # %d, count %d ... %d blocks erased: %s get mmc type error! #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device SD doesn't support partitioning userenhwrrelgpPartition configuration: User Enhanced Start: User Enhanced Size: No enhanced user data area User partition write reliability: %s GP%i Capacity: No GP%i partition GP%i write reliability: %s Partitioning successful, power-cycle to make effective no mmc device at slot %x OK, force rescanset dsr %s It is not an eMMC device boot areas protected MTD device %s not found, ret %ld unavailableList of MTD devices: * %s - device: %s - parent: %s - driver: %s - path: %s - type: ROM NOR flash Data flash UBI volume MLC NAND flash Unknown - block size: 0x%x bytes - min I/O: 0x%x bytes - OOB size: %u bytes - OOB available: %u bytes - ECC strength: %u bits - ECC step size: %u bytes - bitflip threshold: %u bits No MTD device found Only NAND-based devices can have bad blocks MTD device %s bad blocks list: 0x%08llx ReadingWriting [raw] [oob] [dontskipff]writingreadingReadWrite.raw.oob.dontskipffOffset not aligned with a page (0x%x) Size not on a page boundary (0x%x), rounding to 0x%llx Could not map/allocate the user buffer %s %lld byte(s) (%d page(s)) at offset 0x%08llx%s%s%s %s %lld byte(s) at offset 0x%08llx Failure while %s at offset 0x%llx Dump %d data bytes from 0x%08llx: Dump %d OOB bytes from page at 0x%08llx: Dump %lld data bytes from 0x%llx: %s on %s failed with error %d .dontskipbadOffset not aligned with a block (0x%x) Size not a multiple of a block (0x%x) Erasing 0x%08llx ... 0x%08llx (%d eraseblock(s)) Failed to get bad block at 0x%08llx Skipping bad block at 0x%08llx ping failed; host %s is not alive host %s is alive activeeth%d : %s %pM %s Could not find device %s Driver does not implement stats dump! %s: %llu %s=%s ## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined edit: setenvSaving Environment to %s... not possible not initialized Failed (%d) ## Resetting to default environment Error %s the chip: %d %04x:CRC32 for %08lx ... %08lx ==> rootpathdnsipZero length ??? saveenvsave environment variables to persistent storageeditenvedit environment variablename - edit environment variable 'name'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'NET sub-systemlist - list available devices stats - dump statistics for specified device pingsend ICMP ECHO_REQUEST to network hostpingAddressboot image via network using DHCP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpputTFTP put command, for uploading files to a serverAddress Size [[hostIPaddr:]filename]tftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocolMTD utilsMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc hwpartition - does hardware partitioning arguments (sizes in 512-byte blocks): USER - <{on|off}> : sets user data area attributes GP - <{gp1|gp2|gp3|gp4}> <{on|off}> : general purpose partition MODE - <{check|set|complete}> : mode, complete set partitioning completed WARNING: Partitioning is a write-once setting once it is set to complete. Power cycling is required to initialize partitions after set to complete. mmc setdsr - set DSR register value mmcinfodisplay MMC info- display info of the current MMC devicesleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)MDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. master/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enableMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.randomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]mtestsimple RAM read/write test[start [end [pattern [iterations]]]]loopinfinite loop on address range[.b, .w, .l] address number_of_objectsprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'memory copy[.b, .w, .l] source target countmemory compare[.b, .w, .l] addr1 addr2 countmwmemory write (fill)[.b, .w, .l] address value [count]nmmemory modify (constant address)[.b, .w, .l] addressmmmemory modify (auto-incrementing address)memory display[.b, .w, .l] address [# of objects]loadbload binary file over serial line (kermit mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)load binary file over serial line (ymodem mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2compute hash message digestalgorithm address count [[*]hash_dest] - compute message digest [save to env var / *address]I2C sub-systemquery and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsfuseFuse sub-systemread [] - read 1 or 'cnt' fuse words, starting at 'word' fuse cmp - compare 'hexval' to fuse at 'word' fuse readm [] - read 1 or 'cnt' fuse words, starting at 'word' into memory at 'addr' fuse sense [] - sense 1 or 'cnt' fuse words, starting at 'word' fuse prog [-y] [...] - program 1 or several fuse words, starting at 'word' (PERMANENT) fuse override [...] - override 1 or several fuse words, starting at 'word'fstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start.statserasewphwpartitionsetdsrMMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registerhalfworddouble wordBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file-lt-gt-eq==-ne!=<>-ge>=-le<=probeoleninputoutputunusedunknownfuncfatext4btrfsunsupportedSee InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudioNo device set, use 'wdt dev' first Human Interface, Subclass: NoneKeyboardMouseMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk onlyDevice "%s" not supported by U-Boot image Device "%s" is inactive syntax error ERROR : xmalloc failed ## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated -bootableUnknown option %s %s%xOps get_pins_count not supported by %s Ops get_pin_name error (%d) by %s Ops get_pin_muxing error (%d) by %s in %s %-*s: %-*s 0x%xSupported partition tables** Bad device specification %s %s ** Unknown partition type '%s' %d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d Failed to get partition driver count Error insufficient memory gpt_partition_list12 Mb/s+- %s (%s, %dmA) %s %s %s %s Bus '%s' is not a PCI controller Buses %02x-%02x SizePhys startBus start# %-18s %-18s %-18s %s Flags%d %#018llx %#018llx %#018llx mem Can't get the pin-controller: %s! Pin-controller device is not set! dev: %s Can't get the watchdog timer: %s No watchdog timer device set! pin-controller device not selected %s not found | %-*.*s| %-*.*s| %s ParentDriver-ipv6Config file '%s' found Config file not found Invalid pxefile address: %s Reading RNG failed RNG #%d - %s No RNG device %s%.8x: %s Cannot find SATA device %d (err=%d) Cannot remove SATA device '%s' (err=%d) yesnodetaBlk device %d: Optional Admin Command Support: Namespace Management/Attachment: %s Firmware Commit/Image download: %s Format NVM: %s Security Send/Receive: %s Blk device %d: Optional NVM Command Support: Reservation: %s Save/Select field in the Set/Get features: %s Write Zeroes: %s Dataset Management: %s Write Uncorrectable: %s Blk device %d: Format NVM Attributes: Support Cryptographic Erase: %s Support erase a particular namespace: %s Support format a particular namespace: %s Blk device %d: LBA Format Support: LBA Format %d Support: (current) Metadata Size: %d LBA Data Size: %d Relative Performance: %s Blk device %d: End-to-End DataProtect Capabilities: As last eight bytes: %s As first eight bytes: %s Support Type3: %s Support Type2: %s Support Type1: %s Blk device %d: Metadata capabilities: As part of a separate buffer: %s As part of an extended data LBA: %s Failed to probe SPI Flash Erasing %d bytes (%d blocks) at offset 0 ...Error! Done! Writing %d bytes from 0x%lx to offset 0 ... Reset SCSI Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** Fit image detected... ** Unknown image type ** Bad FIT image format sha1Hex conversion error on %c Invalid bitlen %d generic_%d:%dspi_generic_drvError %d during SPI transaction -pSpecify a filename or set the ${bootfile} environment variable ext2anyInvalid filesystem: %s Error reading config file time: %lu minutes, %lu.%03lu seconds Starting watchdog timer not supported. Starting watchdog timer failed (%d) Stopping watchdog timer not supported. Stopping watchdog timer failed (%d) Expiring watchdog timer not supported. Expiring watchdog timer failed (%d) Uncompressed size: %ld = %#lX String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dms scanning usb for storage devices... %d Storage Device(s) found Error: SATA device not found Error: SATA 0 not found Error: usb_init failed Error: USB storage device not found Error: USB 0 not found starting USB... resetting USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. storNo storage devices, perhaps not 'usb start'ed..? Error - written %#lx blocks '%s' is not a number %s: %s dev %d NOT available repairRepairing GPT: Writing GPT: No partition list provided Missing disk guid Partition list incomplete No partition list provided - only basic check More partitions than allowed! Partition name: %s does not match %s! Partition %s size: %llu does not match %llu! Partition %s start: %llu does not match %llu! Verify GPT: gpt_partition_addrgpt_partition_sizegpt_partition_entrygpt_partition_namegpt_partition_bootableenumerateguidsuccess! No SD/MMC/eMMC card found %s(%d) init failed Error - failed to obtain block descriptor Error: MMC 0 not found u-boot-with-spl.kwbError: Unknown destination "%s" Error: Unknown source "%s" Burning U-Boot image "%s" from "%s" to "%s" Error: Read not supported on device "%s" Error: Failed to read file %s from %s Error: Invalid A38x image (header version 0x%x unknown)! Error: Bad A38x image header checksum. 0x%x != 0x%x Error: Bad A38x image blocksize. Error: Bad A38x image data checksum. 0x%08x != 0x%08x Image checksum...OK! Error: Image header verification failed Error: unknown boot device in image header: 0x%x Error: image meant to be booted from "%s", not "%s"! Error: cannot read OTP secure bits Error: secure boot is enabled in OTP but image does not have secure boot header! Error: boot source is set to "%s" in OTP but image is for "%s"! Error: Image boot mode verification failed Error: Write not supported on device %s %s =%*s%#.*lx class code = 0x%.2x (%s) unknown header Scanning PCI devices on bus %d BusDevFun VendorId DeviceId Device Class Sub-Class _____________________________________________________________ %02x.%02x.%02x 0x%.4lx 0x%.4lx %-23s 0x%.2lx Found PCI device %02x.%02x.%02x: I/OMEMPrefetchableNo such bus No such device CardBus doesn't support BARs unknown header type ID Base Size Width Type %d %#018llx %#018llx %d %s %s ERROR : xrealloc failed HUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS\$'";&|#;$&|exit not allowed from main input shell. Resetting watchdog timer not supported. Resetting watchdog timer failed (%d) Cannot probe SATA device %d (err=%d) No SATA device found! Cannot scan SATA device %d (err=%d) mallocWrittenFailed to initialize SPI flash at %u:%u (error %d) No SPI flash selected. Please run `sf probe' mtdparts support missing. Offset exceeds device limit device %d Size exceeds partition or device limit whole chip offset 0x%llx, size 0x%llx ERROR: attempting %s past flash size (%#x) ERROR: flash area is locked Updating, %zu%% %lu B/sSPI flash failed in %s step %zu bytes written, %zu bytes skipped in %ld.%lds, speed %ld B/s SF: %zu bytes @ %#x %s: ERROR %d SF: %zu bytes @ %#x Erased: protectstart sector is not a valid number len is not a valid number unlock## error: substitution buffer overflow Error compiling regex: %s ## Error: variable "%s" not defined ## error: subst buffer overflow: have %d, need %d ## error: pattern buffer overflow: have %d, need %d fmtgsubCould not set var invalid op ## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part ## Copying '%s' subimage from FIT image at %08lx ... Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded ZSTD ERROR %d - image not loaded fileaddr${%*s bubtBurn a u-boot image to flash[file-name] [destination [source]] -file-name The image file name to burn. Default = u-boot-with-spl.kwb -destination Flash to burn to [spi, nand, mmc, sata]. Default = spi -source The source to load image from [tftp, usb, mmc, sata]. Default = tftp Examples: bubt - Burn flash-image.bin from tftp to active boot device bubt flash-image-new.bin nand - Burn flash-image-new.bin from tftp to NAND flash bubt backup-flash-image.bin mmc usb - Burn backup-flash-image.bin from usb to MMC gptGUID Partition Table - GUID partition table restoration and validity check Restore or verify GPT information on a device connected to interface Example usage: gpt repair mmc 0 - repair the GPT on the device gpt write mmc 0 $partitions - write the GPT to device gpt verify mmc 0 $partitions - verify the GPT on device against $partitions gpt setenv mmc 0 $name - setup environment variables for partition $name: gpt_partition_addr, gpt_partition_size, gpt_partition_name, gpt_partition_entry, gpt_partition_bootable gpt enumerate mmc 0 - store list of partitions to gpt_partition_list environment variable gpt guid - print disk GUID gpt guid - set environment variable to disk GUID Example usage: gpt guid mmc 0 gpt guid mmc 0 varname imxtractextract a part of a multi-imagefsuuidLook up a filesystem UUID : - print filesystem UUID fsuuid : - set environment variable to filesystem UUID USB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'usbbootboot from USB deviceloadAddr dev:partlzmadeclzma uncompress a memory regionsrcaddr dstaddr [dstsize]Watchdog sub-systemtruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]run commands and summarize execution timecommand [args...] sysbootcommand to get and boot from syslinux files[-p] [addr] [filename] - load and parse syslinux menu file 'filename' from ext2, fat or any filesystem on 'dev' on 'interface' to address 'addr'sspiSPI utility command[:][.][@] - Send and receive bits - Identifies the SPI bus - Identifies the chip select - Identifies the SPI mode to use - Identifies the SPI bus frequency in Hz - Number of bits to send (base 10) - Hexadecimal string that gets sentsetexprset environment variable as the result of eval expression[.b, .w, .l, .s] name [*]value1 [*]value2 - set environment variable 'name' to the result of the evaluated expression specified by . can be &, |, ^, +, -, *, /, % (for strings only + is supported) size argument is only meaningful if value1 and/or value2 are memory addresses (*) setexpr[.b, .w, .l] name [*]value - load a value into a variable setexpr name gsub r s [t] - For each substring matching the regular expression in the string , substitute the string . The result is assigned to . If is not supplied, use the old value of . If no substring matching is found in , assign to . setexpr name sub r s [t] - Just like gsub(), but replace only the first matching substringsha1sumcompute SHA1 message digestaddress count [[*]sum] - compute SHA1 message digest [save to sum]SCSI sub-systemreset - reset SCSI controller scsi info - show available SCSI devices scsi scan - (re-)scan SCSI bus scsi device [dev] - show or set current device scsi part [dev] - print partition table of one or all SCSI devices scsi read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' scsi write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'scsibootboot from SCSI devicesfSPI flash sub-systemNVM Express sub-systemscan - scan NVMe devices nvme detail - show details of current NVMe device nvme info - show all available NVMe devices nvme device [dev] - show or set current NVMe device nvme part [dev] - print partition table of one or all NVMe devices nvme read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' nvme write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'SATA sub systeminit - init SATA sub system sata stop [dev] - disable SATA sub system or device sata info - show available SATA devices sata device [dev] - show or set current device sata part [dev] - print partition table sata read addr blk# cnt sata write addr blk# cntprint bytes from the hardware random number generatorlist - list all the probed rng devices rng [dev] [n] - print n random bytes(max 64) read from dev get and boot from pxe filesget [-ipv6] - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] [-ipv6] - boot from the pxe file at pxefile_addr_r pinmuxshow pin-controller muxinglist - list UCLASS_PINCTRL devices pinmux dev [pincontroller-name] - select pin-controller device pinmux status [-a | pin-name] - print pin-controller muxing [for all | for pin-name] list and access PCI Configuration Spacedisk partition related commandsuuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition table part list [flags] - set environment variable to the list of partitions flags can be -bootable (list only bootable partitions) part start - set environment variable to the start of the partition (in blocks) part can be either partition number or partition name part size - set environment variable to the size of the partition (in blocks) part can be either partition number or partition name part number - set environment variable to the partition number using the partition name part must be specified as partition name part set type - set partition type for a device part types - list supported partition table typesenvironment handling commandsthenelifelseforwhileuntildonenandpex1.5 Mb/s480 Mb/s5 Gb/sexpire-o-zgetprefetchsysmemreadonlysecondary statusprimary bus numberCardBus numbersubordinate bus numberCardBus latency timerCardBus memory base 0CardBus memory limit 0CardBus memory base 1CardBus memory limit 1CardBus IO base 0CardBus IO base high 0CardBus IO limit 0CardBus IO limit high 0CardBus IO base 1CardBus IO base high 1CardBus IO limit 1CardBus IO limit high 1interrupt lineinterrupt pinbridge controlsubvendor IDsubdevice IDPC Card 16bit base addressbase address 1secondary bus numbersecondary latency timerIO baseIO limitprefetch memory baseprefetch memory limitprefetch memory base upperprefetch memory limit upperIO base upper 16 bitsIO limit upper 16 bitsexpansion ROM base addressbase address 2base address 3base address 4base address 5cardBus CIS pointersub system vendor IDsub system IDmin Grantmax Latencysub class codeprogramming interfacecache linelatency timeheader typeBISTbase address 0command register IDrevision IDdeleteeditexportimportrunexistsalloc space exhausted Reserved fields (%d bytes) baudrateload-environmentbad CRCLoading Environment from %s... Core: %d devices, %d uclasses, devicetree: %sWarning: Device tree includes old 'u-boot,dm-' tags: please fix by 2023.07! Did not get interrupt on CBI Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry (effective (%d MHz, %d-bit, 2T, 3T, ECCECC not enabled)FATFAT32 Extd Boot** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %3d %-10lu %-10lu %08x-%02x %02x%s%s Part Start Sector Num Sectors UUID Type ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s %s=%sNULL device name! No such device: %s %s is not a known ethernet PHY extended status read failed, assuming no 1000BASE-X unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) selecting invalid interface %dcmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. usb_storage_blkusb_bootdev%s: invalid max packet size DRAM: MMC: %s - probe failed: %d Net: ethprimeeth%d: %s [PRIME]Enter choice: pre-reloc realloc() is not supportedusb_ignorelistusb_ignorelist parse error in "%s" unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) usb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times cyclic function %s took too long: %lldus vs %dus max ** Abort Unknown hash algorithm '%s' HASH_MAX_DIGEST_SIZE exceeded %s for %08lx ... %08lx ==> HUSH_VERSION0.01No valid hush parser to use, cli will not initialized! prebootkernel-offsetkernaddrrootdisk-offsetrootaddr/configbootsecure## Error: Secure boot command not specified ## Error: "%s" returned (code %d) Hit any key to stop autoboot: %2d  0%2d Problem %s - %s Usage: %s - No additional help available. xtrace+Unknown command '%s' - try 'help' (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available ## Unknown partition table type %x Partition Map for %s device %d -- Partition Type: %s Whole Disk** Bad HW partition specification %s %s ** bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") hdusbdmmcsd%s%c%d%08x-%02xu-boot,efi-partition-entries-offsetmodelModel: %s STM32GD32MKL (with peripheral resets) MCU type: %s MCU version: %s Memory config from EEPROM read failed! Falling back to default 1 GiB! RAM size: %i MiB Board version: %s Serial Number: %s ECDSA Public Key: %s Part Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %pUl guid: %pUl ISODOSPerform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedpoweroffPerform POWEROFF of the devicerun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'usb-mass-storageusb_mass_storageusb_hubshowvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'nvmxipefiloadervirtiopvblockblkmaprkmtdubimd5sha256crc16-ccitt %-10.10s %3d [ %c ] %-20.20s | `-- |-- (none)reg-names(out of memory) uclass %d: %s %-3i %c %s @ %08lx, seq %dclock-frequencyclock-divclock-multngpiosmvebu%d_u-boot,i2c-offset-lencell-indexu-boot,i2c-slave-addru-boot,i2c-transaction-bytes->i2c_mux_bus_drv#clock-cellsassigned-clock-parentsassigned-clocksassigned-clock-rates%s:%dblk_partitioni2c-parentpoweroff ... #reset-cellsresetsfixed-linklittle-endianbig-endiannative-endianbootph-allbootph-some-rambootph-pre-rambootph-pre-sramu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplu-boot,dm-vplbootstdbootmeth_phy-modephy-connection-type%s: %s: error: gpio %s%d not reserved get_value#gpio-cellsSystem reset not supported on this platform resetting ... %s %s: Unsupported now udevice *)(NULL%s %s: %s error %s %s: Max support %d pins now %s %s: Error reading output register %s %s: Error reading direction register %s@%x_gpio@%x_%s %s: Error writing invert register generic_%xi2c_generic_chip_drvMMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd eMMC >= 4.4 required for enhanced user data area Card does not support partitioning Card does not define HC WP group size User data enhanced area not HC WP group size aligned GP%i partition not HC WP group size aligned Card does not support enhanced attribute Total enhanced size exceeds maximum (%u > %u) Card does not support host controlled partition write reliability settings Card already partitioned MMC: no card present vmmc-supplyvqmmc-supplyCard did not respond to voltage select! : %d nxp,pca9543nxp,pca9544nxp,pca9546nxp,pca9547nxp,pca9548nxp,pca9646nxp,pca9847pca954xi2c_muxmarvell,mv64xxx-i2cmarvell,mv78230-i2callwinner,sun4i-a10-i2callwinner,sun6i-a31-i2ci2c_mvtwsimarvell,orion-gpiogpio_mvebunxp,pca9505nxp,pca9534nxp,pca9535nxp,pca9536nxp,pca9537nxp,pca9538nxp,pca9539nxp,pca9554nxp,pca9555nxp,pca9556nxp,pca9557nxp,pca9574nxp,pca9575nxp,pca9698nxp,pcal6524maxim,max7310maxim,max7312maxim,max7313maxim,max7315ti,pca6107ti,tca6408ti,tca6416ti,tca6424ti,tca9539ti,tca9554onsemi,pca9654exar,xra1202pca953xsysconsimple_busmiscfixed-factor-clockfixed_factor_clockfixed-clockfixed_clockinternalrev-miirev-rmiirgmii-idrgmii-rxidrgmii-txidrtbismiixlgmiimocaqsgmiitrgmii100base-x1000base-x2500base-xrxaui10gbase-r25gbase-rusxgmii10gbase-krqusgmii1000base-kxroot_driver/clocks/firmware/reserved-memory%s: Reset 0x%x never completed. mmc_blkmmc_bootdevError when deleting partition "%s" (%d) Removing MTD device #%d (%s) with use count %d %s %s: Erase operation failed. %s %s: Program operation failed. %s %s: Attempted to modify a protected sector. %s %s: flash operation timed out unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d Man %06x Snr %04x%04x%c%c%c%c%c%c%s: MMC: %d busy timeout increasing to: %u ms. %s: Timeout for status update: %08x %08x %s: Transfer data timeout mv_sdhcap-sd-highspeed%s %s: Invalid "bus-width" value %u! cap-mmc-highspeedsd-uhs-sdr12sd-uhs-sdr25sd-uhs-sdr50sd-uhs-sdr104sd-uhs-ddr50mmc-ddr-1_8vmmc-ddr-1_2vmmc-hs200-1_8vmmc-hs200-1_2vmmc-hs400-1_8vmmc-hs400-1_2vmmc-hs400-enhanced-strobeno-mmc-hs400non-removablecd-invertedbroken-cdno-1-8-vsdhci-caps-masksdhci-caps%s: Hardware doesn't specify base clock frequency cd-gpios%s: Aligned buffer alloc failed!!! MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed eMMC%s: %d (%s)drivers/mtd/mtdcore.cBUG at %s:%d/%s()! BUG!%s: unlock failed, writes may not work Warning: MTD name "%s" is not unique! mtdids"%s" partitions still in use, can't delete them Minimum partition size 4kiB, %lldB requested No closing ')' found in partition name Empty partition name No partitions allowed after a fill-up Unexpected character '%c' in mtdparts 0x%08llx@0x%08llxspi_flash@%d:%djedec_spi_norInvalid bus %d (err=%d) %s %s: Invalid chip select %d:%d (err=%d) %s %s: Macronix Quad bit not set %s %s: Failed to enable octal DTR mode SF: Failed to set up slave %s %s: unrecognized JEDEC id bytes: %02x, %02x, %02x m25p,fast-readSF: Detected %s with page size , erase size , total jedec,spi-norspi_flashMTDmarvell,armada-380-sdhciu-boot,bootdev-mmcmx25l2005amx25l4005amx25l8005mx25l1606emx25l3205dmx25l6405dmx25u2033emx25u1635emx25u3235fmx25u6435fmx25l12805dmx25u12835fmx25u25635fmx25u51245gmx25l12855emx25l25635emx25v8035fmx25r1635fmx25l25655emx66l51235lmx66u51235fmx25u51245fmx66u1g45gmx66u2g45gmx66l1g45gmx66l2g45gmx25l1633emx25r6435fmx66uw2g345gx0mx66lm1g45gmx25lm51245gmx25lw51245gmx25lm25645gmx66uw2g345gmx66um1g45gmx66uw1g45gmx25uw51245gmx25uw51345gmx25um25645gmx25uw25645gmx25um25345gmx25uw25345gmx25uw12845gmx25uw12345gmx25uw6445gmx25uw6345gs25sl032ps25sl064ps25fl256s0s25fl256s1s25fl512ss25fs512ss25fl512s_256ks25fl512s_64ks25fl512s_512ks70fs01gs_256ks25sl12800s25sl12801s25fl128ss25fl129p0s25fl129p1s25sl008as25sl016as25sl032as25sl064as25fl116ks25fl164ks25fl208ks25fl064ls25fl128ls25fl256ls25hl512ts25hl01gts25hl02gts25hs512ts25hs01gts25hs02gts25fs256tw25p80w25p16w25p32w25x05w25x40w25x16w25q16dww25x32w25q20clw25q20bww25q20eww25q32w25q32dww25q16jvw25q32jvw25q32jwmw25q256jwmw25x64w25q64dww25q64jvw25q128fww25q128jvw25q128jww25q256fww25q256jww25q512jvw25q512nwqw25q512nwmw25q512jvqw25q01jvw25q01jvfimw25q02jvw25q80w25q80blw25q16clw25q32bvw25q64cvw25q128w25q256w25m512jww25m512jvw25h02jvreset-assert-usreset-deassert-usreset-delay-usreset-post-delay-us%s %s: SMI busy timeout %s %s: bad rx status %08x (buffer oversize), size=%d %s %s: bad rx status %08x (crc error), size=%d %s %s: bad rx status %08x (overrun error), size=%d %s %s: bad rx status %08x (max frame length error), size=%d %s %s: bad rx status %08x (resource error), size=%d PCI: Device '%s' on unprobed bus '%s' mv88e6xxx-mdio-%dXSMI bus read not valid dm_eth_phy_connect failed %s: No link. %s %s: can't init eth hal %s %s: can't power up port drivers/net/mvneta.cWARNING at %s:%d/%s()! %s %s: %s: can't create rxq=%d %s %s: %s: can't create txq=%d timeout: packet not sent gpio-rangesmarvell,armada-3700-netamarvell,armada-ac5-netadma-rangesFound dma-ranges in root node, shouldn't happen sfptx-disable-gpiophy-reset-gpiosERROR: no/invalid property! ERROR: no/invalid speed given in fixed-link node! full-duplexasym-pauseu-boot,skip-auto-config-until-relocpciVVVV,DDDDCannot find PCI driver marvell,pcie-lanepcie%d.%dnum-lanes%s: property "reg" is invalid %s: cannot get tgt/attr for mem window %s: cannot get tgt/attr for IO window assigned-addresses%s: property "assigned-addresses" not found %s: unable to assign mbus window for mem %s: unable to assign mbus window for io %s: cannot get reset controller: %d %s: cannot request reset controller: %d %s: cannot enable PCIe port: %d regulator-min-microvoltregulator-max-microvoltregulator-init-microvoltregulator-min-microampregulator-max-microampregulator-always-onregulator-boot-onregulator-ramp-delayregulator-force-boot-offregulator-state-memregulator-off-in-suspendregulator-suspend-microvoltgpio-controllerpinconfigWarning: Changing mpp%u function from %s to gpio... regulator-namereg-offsetreg-shiftreg-io-width%s %s: Failed to read switch ID: %d %s %s: Mismatched PHY mode %s on port %d! %s %s: Missing SMI address mv88e6xxx_mdio%s %s: failed to bind %s: %d %s %s: failed to probe %s: %d ncipncoutportncinport(null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done Waiting for PHY realtime link%s: unable to request reset-gpios: %d %s: unable to add mbus window for mem at %08x+%08x %s: unable to add mbus window for IO at %08x+%08x %s: Link up %s: Link down PCI: Failed autoconfig bar %x pci_bridge_drvpci_generic_drvu-boot,pci-pre-relocpci_%x:%x.%xpci,no-autoconfigPCI Autoconfig: %02x.%02x.%02x: Downstream link non-functional PCI Autoconfig: %02x.%02x.%02x: Retrying with speed restricted to 2.5GT/s... PCI Autoconfig: %02x.%02x.%02x: Succeeded! PCI Autoconfig: %02x.%02x.%02x: Failed! Build before PCI Rev2.0Network controllerDisplay controllerMultimedia deviceMemory controllerBridge deviceSimple comm. controllerBase system peripheralInput deviceDocking stationProcessorSerial bus controllerIntelligent controllerSatellite controllerCryptographic deviceDSPDoes not fit any classMass storage controller## Baudrate %d bps not supported ## Baudrate may not be deleted %s %s: Cannot set speed (err=%d) %s %s: Cannot set mode (err=%d) pinctrl-namespinctrl-%d%s %s: could not find pctldev stdout-pathNo serial driver foundns16550ns16550aingenic,jz4780-uartnvidia,tegra20-uartsnps,dw-apb-uartns16550_serialregulatormarvell,mv88f6810-pinctrlmarvell,mv88f6820-pinctrlmarvell,mv88f6828-pinctrlarmada-38x-pinctrlpcie0rstouti2c1sdaspi1cs0sd0pcie1clkreqsckpcie2misoua1rxdtxdmdcdramdeccerrmosics1sata0prsntsata1ge0txerrtdmaudiobclkptpevreqsdidtxsdotrigdrxextclksata2sata3fsynclrclkvttctrlpclkmclkrefclk_out1clk_out0cs2rb1ua0ad7ge1rxctlcs3burst/lastrb0rxd3ad6rxd2rxd1ad4rxclkad8ad1ad3txctlwe0txd3ale1txd2oetxd1ale0txd0ad5spi0txclkoutreadyad2ad0rxd0bootcstxclkrxerrmdio slavemdc slavewe1pcie3ad15ad14ad13ad12ad11ad10ad9crsi2c0marvell,armada-xp-pciemarvell,kirkwood-pciepcie_mvebu_baseFixed PHYMarvell 88E1011SMarvell 88E1111SMarvell 88E1118Marvell 88E1118RMarvell 88E1145Marvell 88E1149SMarvell 88E1240Marvell 88E151xMarvell 88E1310Marvell 88E1121RMarvell 88E1680marvell,armada-370-netamarvell,armada-xp-netamvnetamarvell,orion-mdiomarvell,xmdiomvmdiomarvell,mv88e6085mv88e6xxxeth_phy_genericeth_phy_generic_drvmpp0mpp1mpp2mpp3mpp4mpp5mpp6mpp7mpp8mpp9mpp10mpp11mpp12mpp13mpp14mpp15mpp16mpp17mpp18mpp19mpp20mpp21mpp22mpp23mpp24mpp25mpp26mpp27mpp28mpp29mpp30mpp31mpp32mpp33mpp34mpp35mpp36mpp37mpp38mpp39mpp40mpp41mpp42mpp43mpp44mpp45mpp46mpp47mpp48mpp49mpp50mpp51mpp52mpp53mpp54mpp55mpp56mpp57mpp58mpp59pcie_mvebuGeneric PHYmcu_*** spi_xfer: Time out during SPI transfer spi-max-frequencyusb,device-classusb,interface-classspi-cpolspi-cphaspi-cs-highspi-3wirespi-half-duplexspi-tx-bus-widthspi-tx-bus-width %d not supported spi-rx-bus-widthspi-rx-bus-width %d not supported ahci_scsidrivers/usb/host/xhci-mem.cdrivers/usb/host/xhci-ring.cout of buffer pointers (%zu bytes left) nvme#%d%s: No memory for ataid[port] ATA scsi_ahci: Error: buffer too small. scsi_ahci: SCSI READ CAPACITY10 command failure. No ATA info! Please run SCSI command INQUIRY first! scsi_ahci: SCSI READ CAPACITY16 command failure. No ATA info! Please run SCSI command INQUIRY first! Unsupport SCSI command 0x%02x 64bit ncq ilck stag pm clo nz only pmp fbss pio slum part ccc ems sxs apst nvmp boh controller reset failed (0x%x) Target spinup took %d ms. AHCI %02x%02x.%02x%02x %u slots %u ports %s Gbps 0x%x impl %s mode SATAflags: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s No Link on this port! %s: No mem for table! Can not start port %d SATA link %d timeout. timeout-sechw_margin_msu-boot,noautostartu-boot,autostartRemoving devices on SATA bus... Cannot find SATA device (err=%d) Rescanning SATA bus for devices... No SATA block device found pagesizefixed-partitionsturris-omnia-mcu-gpioError: turris_omnia_mcu CMD_GET_STATUS_WORD failed: %d Error: turris_omnia_mcu CMD_GET_FEATURES failed: %d turris-omnia-mcu-sysresetturris-omnia-mcu-trngrtc-soc%s: io address missing fixedclock-namesTimeout poll on interrupt endpoint %s %s: Invalid cs %d (err=%d) tick-timerERROR: status = %x, phase = %d, head = %d Error: malloc prp_pool fail 0x%.4xError: %s: Controller not ready! Error: %s: Out of memory! nvme-blknvme_bootdevFailed to probe '%s': err=%dE Failed to init PCI (%dE) scanning bus for devices... unable to unbind devices (%dE) id%dlun%dscsi_blkscsi_bootdevevery %ldmsWDT: Started %s with%s servicing %s (%ds timeout) WDT: Not starting %s WDT: Failed to start %s Bus %s: Port not available. probe failed, error %d companionFailed to get companion (ret=%d) No USB controllers found Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) generic_bus_%x_dev_%xusb_dev_generic_drvEHCI fail timeout STS_ASS reset marvell,armada-3700-ehcimarvell,ac5-ehciEHCI fail to reset USB EHCI %x.%02x Error: Cannot find high speed parent of usb-1 device unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error Host not halted after %u microseconds. WARN urb submitted to disabled ep WARN waiting for error on ep to be cleared WARN endpoint is halted ERROR unknown endpoint state for ep Unexpected XHCI event TRB, skipping... (%08x %08x %08x %08x) XHCI timeout on event type %d... Evaluate ContextConfigure Endpointdrivers/usb/host/xhci.cERROR: %s command returned completion code %d. Virt dev for slot[%d] already allocated Failed to allocate virtual device Failed to allocate out context for virt dev Failed to allocate in context for virt dev Could not allocate xHCI USB device data structures Resetting EP %d... abort_td: Expected a TRB_TRANSFER TRB first non-control pipe (type=%lu)The request port(%d) exceeds maximum port number unknown value DT_STRING %x unknown value %x unknown feature %x Unknown request Setup ERROR: address device command for slot %d. Device not responding to set address. ERROR: Incompatible devicefor address device command. ERROR: unexpected command completion code 0x%x. Failed to configure xHCI endpoint non-bulk pipe (type=%lu)non-interrupt pipe (type=%lu)marvell,armada3700-xhcimarvell,armada-380-xhcimarvell,armada-8k-xhcixhci_mvebumarvell,orion-ehciehci_mvebuu-boot,bootdev-usbmarvell,armada-380-wdtorion_wdtwatchdogu-boot,bootdev-scsimarvell,armada-380-rtcrtc-armada38xcznic,turris-omnia-mcui2c-eepromatmel,24c01atmel,24c01aatmel,24c02atmel,24c04atmel,24c08atmel,24c08aatmel,24c16aatmel,24mac402atmel,24c32atmel,24c32d-wlatmel,24c64atmel,24c128atmel,24c256atmel,24c512i2c_eeprommarvell,armada-3700-ahcimarvell,armada-8k-ahcicavium,octeon-7130-ahciahci_mvebuu-boot,bootdev-satasata_bootdevahci-pciahci_pciu-boot,bootdev-nvmemarvell,orion-timermarvell,armada-370-timermarvell,armada-xp-timerorion_timermarvell,orion-spimarvell,armada-375-spimarvell,armada-380-spimarvell,armada-xp-spimvebu_spi i2c_eeprom_partition1.5fs/btrfs/extent-io.cvbus-supplyFailed to turn ON the VBUS regulator MVEBU XHCI INIT controller @ 0x%llx unable to allocate DCBA Register %x NbrPorts %d Starting the controller USB XHCI %x.%02x env_buf [%u bytes] too small for value of "%s" ^%s$eth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,\.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" BTRFS: dirty eb leak (aborted trans): start %llu len %u %s: Unsupported compression in extent: %i fs/btrfs/ctree.cleaf free space ret %d, leaf data size %u, used %d nritems %d BTRFS: Couldn't map the block %llu BTRFS: devid %llu is missing BTRFS: read failed on devid %llu physical %llu missing environment variable: %s *** Warning - %s, using default environment spi_flash_probe_bus_cs() failedErasing SPI flash...Writing to SPI flash...malloc() failedspi_flash_read() failedCannot import environment: errno = %d import failed## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' Could not find "%s" partition Couldn't find partition %s %s ** Unable to write file %s ** %s/ %s %8lld %s %d file(s), %d dir(s) %llu bytes written in %lu ms (Cannot lookup ino %llu Ino %llu does not exist BTRFS: Extent for symlink %llu must be INLINE type! BTRFS: Extent for symlink %llu must not be compressed! BTRFS: Symlink %llu extent data too large (%llu)! No mapping for %llu-%llu Invalid mapping for %llu-%llu, got %llu-%llu invalid number of items %llu leaf is not a leaf %llu leaf free space incorrect %llu %d leaf parent key incorrect %llu bad key ordering %d %d incorrect offsets %u %u bad item end %u wanted %u slot end outside of leaf %llu > %llu BTRFS: tree block bytenr %llu is not aligned to sectorsize %u parent transid verify failed on %llu wanted %llu found %llu Ignoring transid failure Couldn't map the block %Lu checksum verify failed on %llu found %08X wanted %08X bad tree block %llu, fsid mismatch, want=%s, have=%s bytenr mismatch, want=%llu, have=%llu bad level, %u > %d invalid nr_items: %u Csum didn't match BTRFS: child eb corrupted: parent bytenr=%llu item=%d parent level=%d child level=%d BTRFS: Cannot lookup file %s BTRFS: Not a regular file: %s BTRFS: Failed to get inode size: %s BTRFS: An error occurred while reading file %s fs/btrfs/root-tree.cfs/btrfs/disk-io.cBTRFS: Can't find root %llu BTRFS: Can't find inode %llu %.3s %.3s %.2d %.2d:%.2d:%.2d %d BTRFS: Can't alloc memory for symlink %llu BTRFS: Failed to read symlink %llu <%s> ?%3u? %4llu,%5llu %10llu %24.24s %.*s -> %sCannot lookup path %s BTRFS: Not a directory: %s BTRFS: An error occurred while listing directory %s BTRFS: unsupported checksum algorithm %u BTRFS: superblock checksum mismatch BTRFS: tree_root level too big: %d >= %d BTRFS: chunk_root level too big: %d >= %d BTRFS: log_root level too big: %d >= %d BTRFS: tree_root block unaligned: %llu BTRFS: chunk_root block unaligned: %llu BTRFS: log_root block unaligned: %llu BTRFS: nodesize too small: %u < 4096 BTRFS: nodesize unaligned: %u BTRFS: sectorsize too small: %u < 4096 BTRFS: sectorsize unaligned: %u BTRFS: invalid total_bytes 0 BTRFS: invalid bytes_used %llu BTRFS: invalid stripesize %u BTRFS: dev_item UUID does not match fsid: %s != %s BTRFS: suspicious number of devices: %llu BTRFS: number of devices is 0 BTRFS: system chunk array too big %u > %u BTRFS: system chunk array too small %u < %zu BTRFS: superblock checksum matches but it has invalid members Superblocktry btrfsck --repair -s ie, 0,1,2MetadataBTRFS: invalid chunk item size, have %u expect [%zu, %zu) BTRFS: invalid num_stripes, have %u expect non-zero BTRFS: invalid chunk item size, have %u expect %lu BTRFS: invalid chunk logical %llu BTRFS: invalid chunk sectorsize %llu BTRFS: invalid chunk length %llu BTRFS: invalid chunk stripe length: %llu BTRFS: invalid chunk type %llu BTRFS: unrecognized chunk type: %llu BTRFS: missing chunk type flag: %llu BTRFS: conflicting chunk type detected: %llu BTRFS: invalid num_stripes: %u BTRFS: Invalid num_stripes:sub_stripes %u:%u for profile %llu BTRFS: %s checksums match, but it has an invalid chunk, %s warning, device %llu is missing BTRFS: failed to add chunk map start=%llu len=%llu: %d (%m) BTRFS: adding devid %llu gen %llu but found an existing device gen %llu Failed to allocate memory for fs_info no device found for devid %llu, skip it ERROR: Filesystem UUID change in progress couldn't open because of unsupported option features (%llx). ERROR: nodesize %u too small to read superblock ERROR: invalid number of stripes %u in sys_array at offset %u ERROR: unexpected item type %u in sys_array at offset %u ERROR: sys_array too short to read %u bytes at offset %u BTRFS: Seed device is not yet supported BTRFS: cannot read chunk root Couldn't read chunk tree csumBTRFS: could not setup %s tree Couldn't read tree root SPIFlashDIRCHRBLKFIFSCKSYM<>:"/\|?*error: overflow occurs Error: writing directory entry efi_disk addEvent registration for efi_disk add failed efi_disk delEvent registration for efi_disk del failed FAT sector size mismatch (fs=%u, dev=%lu) FAT cluster size not set FAT cluster size too big (cs=%u, max=%u) %02X%02X-%02X%02XInvalid FAT entry: %#08x Error get-and-setting cluster Error: no space left: %llu ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** Failed to iterate over directory %s < ? > %10u %s ** Can not find directory. ** ** File not found %s ** MemhostfsDM_TAG_EFI not found /EFI/BOOT/BOOTARM.EFIefiblk#%defi_blkU%s %d:%u%s %d1234567Cannot free EFI memory pool EFI application exitedHandle %p has protocols installed. Unable to delete ERROR: Failure to install protocols for loaded image Not a PE-COFF file Invalid number of sections: %d Invalid optional header magic %x Unknown Relocation off %x type %x Machine type 0x%04x is not supported Invalid load option for %ls Loading %ls '%ls' failed Can't find initrd specified in Boot#### installing EFI_LOAD_FILE2_PROTOCOL failed Creating event failed Booting: %ls Unloading image failed Error: Cannot initialize UEFI sub-system, r = %lu BootNext must be 16-bit integer Loading from BootNext failed, falling back to BootOrder Deleting BootNext failed BootOrder not defined EFI boot manager: Cannot load any image Can't find %pD specified in Boot#### Can't read fdt Booting %pD Loading image failed Uninstalling protocol interfaces failed Invalid FAT entry Error reading cluster %.*s.%.3s~%dFAT: illegal filename (%s) %s: doesn't exist (%d) Error: writing contents Error: flush fat buffer %s: already exists . .. Error: out of memory Error: cannot remove root Error: directory is not empty: %d delete boot option(%ls) failed [%u;%u;%um[%d;%dH[?25%cPartition %d: invalid GUID %s MemoryMapped(0x%x,0x%llx,0x%llx)VenHw(%pUlCtrl(0x%0x)Acpi(PNP%04X,%d)Ata(%d,%d,%d)Scsi(%u,%u)Uart(%lld,%d,%c,USB(0x%x,0x%x)MAC(UsbClass(0x%x,0x%x,0x%x,0x%x,0x%x)Sata(0x%x,0x%x,0x%x)NVMe(0x%x,%s%02xUri(%s(%u)HD(%d,MBR,0x%08x,0x%llx,0x%llx)HD(%d,GPT,%pUl,0x%llx,0x%llx)HD(%d,0x%02x,0,0x%llx,0x%llx)CDROM(%u,0x%llx,0x%llx)VenMedia(%pUl%lsDNEOMS EFI: Watchdog timeout No EFI system partition Cannot read EFI system partition %s/%sboardver%s/%s%s%s%s.dtbinvalid image type: %u list passed to list_sort() too long for efficiency Reserved memory mapping failed addr %llx size %llx %s: illegal free 0x%llx, 0x%zx %s: illegal free 0x%p ERROR: Failed to set watchdog timer ## Application failed, r = %lu ## %ls out of memorybad file path! ERROR: Failed to register WaitForKey event ERROR: Failed to register console event ERROR: Failed to set console timer ERROR: Out of memory EFI protocol GUID missing for driver '%s' Failed to add EFI driver %s Disk %s not ready Adding block device %s failed, r = %lu Adding partition for %s failed ubootefi.varFailed to persist EFI variables ERROR: Secure state transition failed ERROR: need device tree ERROR: invalid $fdt_addr or $fdtcontroladdr ERROR: invalid device tree ERROR: Failed to reserve space for FDT ERROR: out of memory ERROR: failed to process device tree kaslr-seedError deleting kaslr-seed ERROR: failed to install device tree 78Failed to load EFI variables Invalid EFI variables file Failed to set EFI variable %ls en-USEFI: cannot initialize platform language settings Failed to install ECPT Missing RNG device for EFI_RNG_PROTOCOL Cannot install EFI_RNG_PROTOCOL ERROR: Failed to register network event ERROR: Failed to set network timer ERROR: Failure to add protocol No SMBIOS tables to install ERROR: Failed to register watchdog event ///./../dtb/dtb/current/dtbs_SM3_Failed to write SMBIOS table 10/01/2024manufacturerproductasset-tagskufamily(unknown)event %d/%scall %pinitcall failed at %s (err=%dE) linux,phandle#address-cellsbaseboardFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGSbioschassisunknown compression methodincorrect header checkunknown header flags setinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid distance too far backinvalid distance codeinvalid literal/length codeincorrect data checkincorrect length checkRE is too long (code overflow)RE is too long (data overflow)Jump offset is too big okay### ERROR ### Please RESET the board ### No closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\device-nameCould not read count from timer (err %d) %s: zstd_init_dctx() failed %s: failed to detect compressed size: %d %s: failed to decompress: %d Error: Bad gzipped data Error: gunzip out of data in header Error: inflateInit2() returned %d Error: inflate() returned %d No valid device tree binary found at %p %u Bytes%s%lu.%ld %ciB%s done %s.cnt = 0x%lx / max = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x This will not be a case any time ERROR: Failed to allocate 0x%lx bytes below 0x%lx. unknown cmd (%d) at %d ## ERROR: unsupported match method: 0x%02x Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root PathNIS Domain Name*** Unhandled DHCP Option in OFFER/ACK: %d %s %s: Failed to register fixed-link for CPU port Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s No valid MAC address found. %s %s: couldn't allocate mii_bus %s %s: couldn't get reset-gpios: %d mdio_register: non unique device name '%s' TFTP server died %s; starting again %s %s: Packets cannot be steered to ports ethernet-ports%s %s: ports node is missing under DSA device! %s %s: invalid number of ports (%d) %s %s: master eth node missing! %s %s: CPU port node not valid! %s@%ddsa-port Error: eth device name "%s" has a space! eth_bootdev%s.%dU-Boot.armv7pxeuuidInvalid pxeuuid: %s ## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set ethactethrotateoctetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation Failed## Warning: gatewayip needed but not set %d.%d.%d.%dbootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again blksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... TFTP error: '%s' (%d) Not retrying... Retry count exceededT fromtftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device TFTP %s server %pI4; our IP address is %pI4; sending through gateway %pI4Filename '%s'.Save address: 0x%lx Save size: 0x%lx Saving: *Load address: 0x%lx Loading: *DHCP client bound to address %pI4 (%lu ms) autoloadCannot autoload with TFTPGET DHCP: INVALID STATE ARP Retry count exceeded; starting again Abort Bytes transferred = %u (%x hex) invalid dir item size BTRFS: %s: Name too long at "%.*s" Invalid port number %d timeout exit! groupsfunctionnvlanu-boot,bootdev-ethdsaphyphy-device%s %s algo: key-name-hintinvalid/unsupported (required)padding%s %s padding: %s %s %s value: %s Timestamp: marvell,dm_pci_bus_to_phys: invalid physical address Status Error: 0x%08x Timeout waiting card ready CD001EL TORITO SPECIFICATIONuuid_disk=;name=,start=0x,size=0x,uuid=,uuid_diskError: is the partitions string NULL-terminated? Wrong uuid format for partition %d scanning bus %s for devices... No USB Device found %d USB Device(s) found %s.%s%dfs/btrfs/volumes.cMissing bootstd device Env export buffer too small: %lu, but need %lu ${...}HashsignatureSign%s Created: %s Type: %s %s Compression: %s %s Data Start: %s Data Size: %s Architecture: %s %s OS: %s %s Load Address: %s Load Address: 0x%08lx %s Entry Point: ## Loading %s from FIT Image at %08lx ... Bad FIT %s image format! (err=%d) Could not find configuration node Using '%s' configuration Could not find subimage node type '%s' Trying '%s' %s subimage Verifying Hash Integrity ... No %s %s %s Image Could not find %s subimage data! Can't get %s subimage load address! Error: %s overwritten Loading %s from 0x%08lx to 0x%08lx Error decompressing %s WARNING: 'compression' nodes for ramdisks are deprecated, please fix your .its file! Subimage data is not a FDTNo such field '%s' %s%daddr%saddr01-%02x-%02x-%02x-%02x-%02x-%02xset_dir_flagsUnable to update property %s:%s, err=%s Can't find node with compatible "%s": %s Can't generate phandle: %s Can't set phandle %u: %s device '%s' failed to unbind disabled%s: %s: %s %04X.callbacks.flagshimport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %pM%s: readonly variablenetretryoncedefault-arm-mvebu-turris_omniadefault-arm-mvebudefault-armEHCI failed: timeout when disabling periodic list EHCI failed: timeout when enabling periodic list memory allocation error while creating partitions for "%s" mtd: partition "%s" is out of reach -- disabled mtd: partition "%s" extends beyond the end of device "%s" -- size truncated to %#llx drivers/mtd/mtdpart.cmtd: partition "%s" doesn't start on an erase block boundary -- force read-only mtd: partition "%s" doesn't end on an erase block -- force read-only bad length %d < %d ICMP Host Redirect to %pI4 eth%dmacskipethmacskip Error: %s address %pM illegal value Warning: %s failed to set MAC address UNKNOWN(%04x,%04x)Unknown csum type %d invalid dir item name len: %u invalid dir item name + data len: %u + %u Can't set block device ** No boot file defined ** Failed to load '%s' %llu bytes read in %lu ms** Reading file would overwrite reserved memory ** ## Error: illegal character '=' in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue EHCI failed to shut down host controller. marvell,reg-initPHY reset timed out mtdpartsmtdparts=Wrong mtdparts: %s MTD name too long: %s Could not find a valid device for %s Not enough space to save partitions meta-data Partition size must be a multiple of %d Failed parsing MTD partitions from mtdparts! read-onlyFailed parsing MTD %s OF partitions! Could not parse device %s %s: Timeout to wait cmd & data inhibit %s: Error while setting tap delay %s: Error while configuring dll %s: Internal clock never stabilised. Error enabling VMMC supply : %d set_valuecannot reset port %i!? *?[\ %02lx %04lx%s %s: dm_rng_read failed: %d WARNING: could not set kaslr-seed %s. partition@%llxFailed fixing SPI NOR partitions! Cannot add window '%04x:%04x', conflicts with another window ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... Ramdisk image is corrupt or invalid RD## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwrittenconfig with overlays but CONFIG_OF_LIBFDT_OVERLAY not set ## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeCould not find a valid device tree The given image format is not supported (corrupt?) Loadable(s) is corrupt or invalid UEFI image [0x%p:0x%p] pc=0x%zx '%pD'bootmethusb-hubfixed_rate_raw_clocknopsimple-bussimple-mfdi2c_generici2c-chippci-bridgepci_genericpci-genericspi_genericsata_blkusb_dev_genericEFI block driver[:] [] - boot EFI payload bootefi bootmgr [fdt address] - load and boot EFI payload based on BootOrder/BootXXXX variables. If specified, the device tree located at gets exposed as EFI configuration table. scan - boot first available bootflow [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead For the new multi component uImage format (FIT) addresses must be extended to include component or configuration unit name: addr: - direct component image specification addr# - configuration specification Use iminfo command to get the list of existing component images and configurations. Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OS[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?demo - register cyclic demo function cyclic list - list cyclic functions SunMonTueWedThuFriSatbootcmd=run distro_bootcmdbootdelay=3baudrate=115200ethprime=eth2loadaddr=0x800000arch=armcpu=armv7board=turris_omniaboard_name=turris_omniavendor=CZ.NICsoc=mvebuusb_ignorelist=mtdids=mtdparts=fdt_high=0x10000000initrd_high=0x10000000kernel_addr_r=0x1000000fdt_addr_r=0x2000000ramdisk_addr_r=0x2200000scriptaddr=0x1800000pxefile_addr_r=0x1900000fdtfile=armada-385-turris-omnia.dtbconsole=ttyS0,115200bootcmd_rescue=i2c dev 2; i2c mw 0x2a.1 0x3 0x1c 1; i2c mw 0x2a.1 0x4 0x1c 1; mw.l 0x01000000 0x00ff000c; i2c write 0x01000000 0x2a.1 0x5 4 -s; setenv bootargs "earlyprintk console=ttyS0,115200 omniarescue=$omnia_reset rescue_mode=$omnia_reset"; sf probe; sf read 0x1000000 0x100000 0x700000; lzmadec 0x1000000 0x1700000; if gpio input gpio@71_4; then bootm 0x1700000#sfp; else bootm 0x1700000; fi; bootz 0x1000000mmc_boot=if mmc dev ${devnum}; then devtype=mmc; run scan_dev_for_boot_part; fiboot_pci_enum=pci enumboot_net_usb_start=usb startusb_boot=usb start; if usb dev ${devnum}; then devtype=usb; run scan_dev_for_boot_part; fisata_boot=if sata dev ${devnum}; then devtype=sata; run scan_dev_for_boot_part; fiscsi_init=if ${scsi_need_init}; then scsi_need_init=false; scsi scan; fiscsi_boot=run boot_pci_enum; run scsi_init; if scsi dev ${devnum}; then devtype=scsi; run scan_dev_for_boot_part; finvme_init=if ${nvme_need_init}; then setenv nvme_need_init false; nvme scan; finvme_boot=run boot_pci_enum; run nvme_init; if nvme dev ${devnum}; then devtype=nvme; run scan_dev_for_boot_part; fiboot_efi_bootmgr=if fdt addr -q ${fdt_addr_r}; then bootefi bootmgr ${fdt_addr_r};else bootefi bootmgr;fiboot_efi_binary=load ${devtype} ${devnum}:${distro_bootpart} ${kernel_addr_r} efi/boot/bootarm.efi; if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r};else bootefi ${kernel_addr_r} ${fdtcontroladdr};fiload_efi_dtb=load ${devtype} ${devnum}:${distro_bootpart} ${fdt_addr_r} ${prefix}${efi_fdtfile}efi_dtb_prefixes=/ /dtb/ /dtb/current/scan_dev_for_efi=setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; for prefix in ${efi_dtb_prefixes}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${efi_fdtfile}; then run load_efi_dtb; fi;done;run boot_efi_bootmgr;if test -e ${devtype} ${devnum}:${distro_bootpart} efi/boot/bootarm.efi; then echo Found EFI removable media binary efi/boot/bootarm.efi; run boot_efi_binary; echo EFI LOAD FAILED: continuing...; fi; setenv efi_fdtfileboot_prefixes=/ /boot/boot_scripts=boot.scr.uimg boot.scrboot_script_dhcp=boot.scr.uimgboot_targets=mmc0 nvme0 scsi0 usb0 pxe dhcp boot_syslinux_conf=extlinux/extlinux.confboot_extlinux=sysboot ${devtype} ${devnum}:${distro_bootpart} any ${scriptaddr} ${prefix}${boot_syslinux_conf}scan_dev_for_extlinux=if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${boot_syslinux_conf}; then echo Found ${prefix}${boot_syslinux_conf}; run boot_extlinux; echo EXTLINUX FAILED: continuing...; fiboot_a_script=load ${devtype} ${devnum}:${distro_bootpart} ${scriptaddr} ${prefix}${script}; source ${scriptaddr}scan_dev_for_scripts=for script in ${boot_scripts}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${script}; then echo Found U-Boot script ${prefix}${script}; run boot_a_script; echo SCRIPT FAILED: continuing...; fi; donescan_dev_for_boot=echo Scanning ${devtype} ${devnum}:${distro_bootpart}...; for prefix in ${boot_prefixes}; do run scan_dev_for_extlinux; run scan_dev_for_scripts; done;run scan_dev_for_efi;scan_dev_for_boot_part=part list ${devtype} ${devnum} -bootable devplist; env exists devplist || setenv devplist 1; for distro_bootpart in ${devplist}; do if fstype ${devtype} ${devnum}:${distro_bootpart} bootfstype; then part uuid ${devtype} ${devnum}:${distro_bootpart} distro_bootpart_uuid ; run scan_dev_for_boot; fi; done; setenv devplistbootcmd_mmc0=devnum=0; run mmc_bootbootcmd_nvme0=devnum=0; run nvme_bootbootcmd_scsi0=devnum=0; run scsi_bootbootcmd_usb0=devnum=0; run usb_bootbootcmd_pxe=run boot_net_usb_start; run boot_pci_enum; dhcp; if pxe get; then pxe boot; fibootcmd_dhcp=devtype=dhcp; run boot_net_usb_start; run boot_pci_enum; if dhcp ${scriptaddr} ${boot_script_dhcp}; then source ${scriptaddr}; fi;setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; setenv efi_old_vci ${bootp_vci};setenv efi_old_arch ${bootp_arch};setenv bootp_vci PXEClient:Arch:00010:UNDI:003000;setenv bootp_arch 0xa;if dhcp ${kernel_addr_r}; then tftpboot ${fdt_addr_r} dtb/${efi_fdtfile};if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r}; else bootefi ${kernel_addr_r} ${fdtcontroladdr};fi;fi;setenv bootp_vci ${efi_old_vci};setenv bootp_arch ${efi_old_arch};setenv efi_fdtfile;setenv efi_old_arch;setenv efi_old_vci;distro_bootcmd=scsi_need_init=; setenv nvme_need_init; for target in ${boot_targets}; do run bootcmd_${target}; done0123456789ABCDEFcompat Dump list of drivers with compatibility strings dm devres Dump list of device resources for each device dm drivers Dump list of drivers with uclass and instances dm static Dump list of drivers with static platform data dm tree [-s][-e][name] Dump tree of driver model devices (-s=sort) dm uclass [-e][name] Dump list of instances for each uclass'hUh=OtUR1harocsdxbimdefault [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...]  addr [-c] [-q] [] - Set the [control] fdt location to fdt boardsetup - Do board-specific set up fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.[0123456789abcdefbus [muxtype:muxaddr:muxchannel] - show I2C bus info i2c crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length [-s] - write memory to I2C; the -s option selects bulk write in a single transaction i2c flags chip [flags] - set or get chip flags i2c olen chip [offset_length] - set or get chip offset length i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speed+,<=>:;"/\|?*[]addr part [dest] - extract from legacy image at and copy to addr uname [dest] - extract subimage from FIT image at and copy to R j068@|9/4CDT{2#=L BN.f($v[Im%rdhԤ\]elpHP^FWث XE,?k:AOgst"57unGq)ʼnobV>Ky xZݨ31Y'_`QJ -zɜ;M* [ []] mtd dump[.raw][.oob] [ []] mtd write[.raw][.oob][.dontskipff] [ []] mtd erase[.dontskipbad] [ []] Specific functions: mtd bad With: : NAND partition/chip name (or corresponding DM device name or OF path) : user address from/to which data will be retrieved/stored : offset in in bytes (default: start of the part) * must be block-aligned for erase * must be page-aligned otherwise : length of the operation in bytes (default: the entire device) * must be a multiple of a block for erase * must be a multiple of a page otherwise (special case: default is a page with dump) The .dontskipff option forces writing empty pages, don't use it if unsure. #(-27fHa5WiَU(ߌ BhA-Tprobe [[bus:]cs] [hz] [mode] - init flash device on given SPI bus and chip select sf read addr offset|partition len - read `len' bytes starting at `offset' or from start of mtd `partition'to memory at `addr' sf write addr offset|partition len - write `len' bytes from memory at `addr' to flash at `offset' or to start of mtd `partition' sf erase offset|partition [+]len - erase `len' bytes from `offset' or from start of mtd `partition' `+len' round up `len' to block size sf update addr offset|partition len - erase and write `len' bytes from memory at `addr' to flash at `offset' or to start of mtd `partition' sf protect lock/unlock sector len - protect/unprotect 'len' bytes starting at address 'sector'[][:[]|#[]] - Run script starting at addr - A FIT config name or subimage name may be specified with : or # (like bootm). If the image or config name is omitted, the default is used. !R\248>Ž ;] - get/set current watchdog device wdt start [flags] - start watchdog timer wdt stop - stop watchdog timer wdt reset - reset watchdog timer wdt expire [flags] - expire watchdog timer immediately ޑ`VMﲎA_E#Su=Ll~hQb*F07 /$NX46ܴ[v}R^@yԍgrO톚fx%K]?!pcwB &þ5.UzȺ2DT; k(dt HC91ՋnIجGoJ\8Wsˡ>a |q̐ji:'+"ҩ3-<ɇPY eׄЂ)Z{m, TP}bE@ g[jZAO\4sS? Re^( 6=&i͟t.-Ma{>qh,`FKJk*UDHuc0mL5/9WG+f~)7,%ٮMD_Vi`{r !(3:╜Ӥ|ungXQJC4=&/ 蟖GNU\cjqx+"90 .'<5BKPYfot}18#*ypkb]TOF ,':1XSNEtbi{pmfW\AJ#(5>ǮFMP[ja|w29$/=6+  ensxIB_TƯGLQZk`}v 38%.<7*! doryHC^U -&;0YRODu~chzqlgV]@K")4? 49.#her\QFK󸵢kfq|_REH7:- m`wzYTCN1<+& 2?(%nctyZW@M >3$)boxuV[LAal{vUXOB =0'*gj}pS^ID;6!, 85"/di~sP]JG86$*p~lbHFTZʐ񫥷;5') KEWYs}oaMCQ_u{ig=3!/ vxjdN@R\>0",AO]Sywek1?-# ztfhBL^P 2<. Ɯ 4:(&|r`nDJXV79+%GI[Uqcm:L;2<9l1p984hRj22l1xj`41D`$`"%a41D`D x%` t`&1P a41D /s2Pwgwgމ28wgwgv2Pwgwg}2wgwg2 wgwg2 wgwg2<wgwg2DwgwgҚ 28wgwgך 2wgwg ꮉ28wgwgp2wgwg2wgwgd2wgwg 2 wgwg2@wgwg 2wgwg2wgwg2wgwg,2wgwg\މ 2vwgwgՉ 2xwwgwgމ2hwgwg)= 2@kwgwgg! 2@kwgwggl 2@kwgwggՉ 2Lswgwgg*2|jwgwgg 2[wgwg)=2l[wgwgՉ 2fwgwg! 2D\wgwgՉ 2L]wgwg讉2Ywgwg2@^wgwg@Y 2^wgwgމ2P`wgwgՉ 2d`wgwgՉ 2ewgwg@A2wgwga2xwgwg@Y2wgwgȉ2؅wgwgU2@wgwgtʉ2wgwgʉ2Twgwg;ʉ2wgwg`؉2wgwg)=28}wgwg! 2~wgwg2wgwgf؉2wgwgK2wgwgA2Xwgwg؉lO䆅P @t0Ē|~؉L39:;;t~~~~|~؉݄|d̈́t~`~~~|~؉L~T~\~d~l~t~~~~~~|~fT8Y^ 1`cg m sR =Q s tftpusb(ȁmmc|sataxǁ́spiDnand=M)3ZOgi Pxfx}=މ2wgwg@Y2̦wgwgp2wgwg2wgwgK2twgwg2\wgwg2hwgwgj2wgwg@Y2Dwgwgމ2<wgwg)2Hwgwgĉ$: Q$g(~,.02468:&<5=C>R@_BlD "$&(,60L2c8&<5=C>~ $(,.c0&<5=>?  , 7 DPUbd׉x~h 2{wgwg 2\|wgwg 28zwgwg 2wgwg 2wgwg{ 2Tywgwg 2QwgwgA҉ 2{wgwgΑ 2zwgwg 2<wgwg#,>OP', !\?LPtP.,q?P,@al@P\@  $$,,44<<DDLLTT\\ddlltt||  $$,,44<<DDLLTT\\ddlltt||  $$,,44<<DDLLTT\\ddlltt||  $$,,44<<DDLLTT\\ddlltt||xxxxxxx (with peripheral resets)T/\/0AA/5D///A/xA1/C>؎x/؎؎/؎rB؎L/ ؎d0OO؎lK؎8s؎ (5@&P&dvvvvt\vEPPPPPPP*REPPPPPPPPPQPPEPPP&QPPEPϪS؉PPPPPPPEPɉS؉SPPPPP.RPPEPQ QQPPQQPQE QQPQQQQ%QPQ*Q.QEPPQΞQ4QPQ*Q&QEQ8QQnIyCsQ4d5e7g8hVBr3c@p;kAqK{T?o<lDtFvUJzSL|PM}GwO9iN~Hx=mEuR6f:j$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,01jkjkZ[LMV'GXY,-4RHIlmUBC_*+-M$D;./ !<=()"# @!Ars3S%E*J8 ]5PQFGVWlm\]dehiRStuvwX: \     nofg YhiJKNO Z>`a|}~?$%pqDE`aTUz{(H)I&'^bcdefg,L"B&F [#CxyT2/Obc+KPQW^_.N7@A6!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z------------ -$-!-"-%---- -- - - - -----------#--'---,0,(,X,,1,,M, ,<,,4,,7,*,Z,,G,,3,,H, ,;, ,:,),Y,',W, ,9,+,[, ,=,.,^,,>,,?,,@,,A,,I,,J,,B,,C,,N,,K,,,\,,D,$,T,%,U,",R,-,],,L,,E,,F,,2,!,Q, ,P,,O,,5,&,V,#,S,,8,,6,   q  prssr)!-%/'+#u( ,$.&*"tpq91=5?7;3w80<4>6:2viameogkc}h`ldnfjb|IAMEKCyH@LDJBxvwYQ]U_W[S{zAa&':e,23m,Q456789:;<=BbSCFGCc      ;<Sno,-./Dd    WEe()FG$%"#JKjkFfGg"# !` !cABHh*+()$%g,h,&'"#$%f&'u,v,&'Ii,-./   *+./h(),-yz{|}yilmJj45HIKk0167i,j,BC2345@ADELl9:=l=>;<<=6789`,a,HI:;?@b,kABMm>?@ABCn,qNnCDGHEFJKDEFGrHI OoNO*+./01PQ  JKLMLMRSPQLMNO,-NO[T"#PpTUVWRSTUc,}PQQqXYVWRrZ[TUXYVWXYZ[\]^_LMd,}>?X\\]SsZ[de`afg^_\]`abchi~,?YaTtdebcpq>f,jklmnofgdefg*+o,Pp,Re~oE()UuDlmvwrspqjkz{rsnohixytuVv^_~|}hibc`aWwtur,s,XxYyvwx23NOZzyz}~k,l,{|$%,@dd!ȋ(H;DHx>NA0EkE`<}GB2P E2ɉ7ɉ2wg 2ȝ;j2P%wgG2P%wg啉 2핉f 2h€n 8@2ϲU 2ěM=2܉C 2xÀ6r 2ǷJ2pTz0 25RE27ɉɉ?2lGwgaY2 ɉɉa24ȉIȉN @2UϺ{2 ɀzm2t_Y2Q! 0@2\Ί䱀7 2  28z,Rae2ހ յ 2|6Њ2wg܌ 2ƀ匉 2 ǀp! 2ƀ*R2ƀp 2ƀje> 2Dሉ2 ǀ鈉  2ƀ(j2ǀpB2ȀK^2pȀʇ] 2ƀje 2LȀ'H 2ҊJЉ2QЉkЉ"Љ2H*Љwg28͉́ 2L͉͉, 2\pE 2͉6͉I 2΁Mb%2|̉̉ 2x)32 ͉pڊܔ2輀㔉 2!P2nފ9̉ 2?̉d̉Љ2HЉщ 2lӉӉʉ 2L,ʉ ˉˉ 2$ˉˉ 2L,kˉ ˉ 2L,ˉ ˉȉ28 ȉȉR2pщ2DÁU2$4ʉʉS2(M[q#520BDʼnYʼntʉ2Awʉ_ʉ=2ʉ_ʉf2 V2,\x 2$ *f2HK2dvE 2䗁* 2*wg 2Ty7RQ`2HTp黎 2x wglj 2?ljljK 29*R*[[ 2 2Q**Rf2TA҉ 2|F҉`҉ѵ 2{ٵwge2( 2  2zXrR 2"\ 24 | 2 [+ 2ďc++p 2ƀj侉2S꾉֖ 2ݖ22ȉ 2ؼ_y 2艁2帉 2  2%d2ȁ2N2,+wgd @2 |Ápf  f\ VkPZ| *aG-S8r`@` 4`PU`Pt` q04$(4!+(҇ [^pρ&`d}G@ _[)T)x 5Tt(d4uxc32 xg7H f7 P(3 108@F-6$ E36l<łX1<reP+$6@`! ,6 h!ɋS#  5JC~ :8H (I|@tKedigq|Xau"Kw)SCH~ԁS(D< Pl@\$pfN<)k\($t\ЋgzT!tdx842x (29˂˂pLU(LWPRG<䙃YIY58eh(f4Ћ] ]\\΋4mPsLeG'Z2/[wI[g,4X΋^~S+, B+B-Tj8y-d}|-YD nhx  Ȋ[\̌V[V[`\(V\,‡VH\\‡| 임 G TV5* V T1*@WW,X}=@H$P$h+7ldARZZ0qDqxqU qR` A@X qR AX qRAăTŃ q S@AăTŃ qnS AŃ qS Aƃƃ q-S A$ǃX q>S0A\X q^SAǃX qNS AƒX qxܿSAȃ q?8?p???@P@@BBBBBBBBBBBBBBBBBBCCCCCCCFFGGPJTJXJ\J`JdJhJPKTK\K`KdKhKMMMNNN NNNNN N$N(N,N0N4N8N>>>>>>>BBCCC CCC|CCCCC|DFFLHPHLKPKTK`K|LLlNtNxNNNNNNNN$O(OOOOQ RRR\SVVVVVVVV X$X(XZ[T[[[[[d\h\\D]__d`aPeTeDhHjLjmmmmmmmmnnn noo8q>>>>>??AAAAAAAB B,F0F4F8F>>??? ???X?\?`???4@8@C C$C(C,C0CCCHDxDF(GGJHJtKLMNN P$P(P,P0PPQQQR(W,W0W4W8W>,>4>D>H>p>x>>>>>>>>? ? disableddevbus-cs1!marvell,mvebu-devbus = disableddevbus-cs2!marvell,mvebu-devbus ; disableddevbus-cs3!marvell,mvebu-devbus  7 disabledinternal-regs !simple-bussdramc@1400#!marvell,armada-xp-sdram-controllercache-controller@8000!arm,pl310-cache8Lscu@c000!arm,cortex-a9-scuXtimer@c200!arm,cortex-a9-global-timer  Z timer@c600!arm,cortex-a9-twd-timer  Z interrupt-controller@d000!arm,cortex-a9-gicevi2c@11000+!marvell,mv78230-a0-i2cmarvell,mv64xxx-i2c  Zokaydefaulti2cmux@70 !nxp,pca9547pi2c@0mcu@2a!cznic,turris-omnia-mcu*led-controller@2b!cznic,turris-omnia-leds+okaymulti-led@0  indicatormulti-led@1  indicatormulti-led@2 wlanmulti-led@3 wlanmulti-led@4 wlanmulti-led@5 wanmulti-led@6 lanmulti-led@7 lanmulti-led@8 lanmulti-led@9  lanmulti-led@a  lanmulti-led@b  powereeprom@54 !atmel,24c64Ti2c@1i2c@2i2c@3i2c@4(i2c@5crypto@64!atmel,atsha204adi2c@6i2c@7gpio@71 !nxp,pca9538qdefaultZ)i2c@11100+!marvell,mv78230-a0-i2cmarvell,mv64xxx-i2c  Z disabledserial@12000!!marvell,armada-38x-uartns16550a  Z okaydefaultserial@12100!!marvell,armada-38x-uartns16550a! Z okaydefault pinctrl@18000 !marvell,mv88f6820-pinctrl ge-rgmii-pins-0Dmpp6mpp7mpp8mpp9mpp10mpp11mpp12mpp13mpp14mpp15mpp16mpp17ge0 ge-rgmii-pins-1Hmpp21mpp27mpp28mpp29mpp30mpp31mpp32mpp37mpp38mpp39mpp40mpp41ge1i2c-pins-0 mpp2mpp3i2c0mdio-pins mpp4mpp5geref-clk-pins-0mpp45refref-clk-pins-1mpp46refspi-pins-0mpp22mpp23mpp24mpp25spi0!spi-pins-1mpp56mpp57mpp58mpp59spi1nand-pinsNmpp22mpp34mpp23mpp33mpp38mpp28mpp40mpp42mpp35mpp36mpp25mpp30mpp32devnand-rbmpp41nanduart-pins-0 mpp0mpp1ua0uart-pins-1 mpp19mpp20ua1 sdhci-pins<mpp48mpp49mpp50mpp52mpp53mpp54mpp55mpp57mpp58mpp59sd0 sata-pins-0mpp20sata0sata-pins-1mpp19sata1sata-pins-2mpp47sata2sata-pins-3mpp44sata3pcawan-pinsmpp46gpioswint-pinsmpp45gpiospi0cs0-pinsmpp25spi0"spi0cs2-pinsmpp26spi0gpio@18100+!marvell,armada-370-gpiomarvell,orion-gpio@ gpiopwm) 0 <ve0Z5678gpio@18140+!marvell,armada-370-gpiomarvell,orion-gpio@@ gpiopwm)0 <ve0Z:;<=system-controller@18200M!marvell,armada-380-system-controllermarvell,armada-370-xp-system-controllerG$clock-gating-control@18220 !marvell,armada-380-gating-clock T phy@18300!marvell,armada-380-comphy comphyconf`phy@0aphy@1aphy@2aphy@3aphy@4aphy@5amvebu-sar@18600!marvell,armada-380-core-clockTmbus-controller@20000!marvell,mbus-controller Pinterrupt-controller@20a00 !marvell,mpic pXevl Ztimer@203001!marvell,armada-380-timermarvell,armada-xp-timer0@0Pu      {nbclkfixedwatchdog@20300!marvell,armada-380-wdt4`   {nbclkfixed u@ cpurst@20800!marvell,armada-370-cpu-resetmpcore-soc-ctrl@20d20#!marvell,armada-380-mpcore-soc-ctrl lcoherency-fabric@21010$!marvell,armada-380-coherency-fabricpmsu@22000!marvell,armada-380-pmsu ethernet@70000!marvell,armada-370-neta@u &Hokaydefault rgmiifixed-linkethernet@30000!marvell,armada-370-neta@u  okaydefaultrgmiifixed-linkethernet@34000!marvell,armada-370-neta@@u  okaysgmiiusb@58000!marvell,orion-ehci Z okayxor@60800)!marvell,armada-380-xormarvell,orion-xor  okayxor00 Zxor01 Zxor@60900)!marvell,armada-380-xormarvell,orion-xor   okayxor10 ZAxor11 ZBmdio@72004!marvell,orion-mdio  defaultokayethernet-phy@1!ethernet-phy-ieee802.3-c22 Iswitch@10default!marvell,mv88e6085&Z portsports@01lan0 internalports@11lan1 internalports@21lan2 internalports@31lan3 internalports@41lan4 internalports@51cpu7 rgmii-idfixed-linkmdioethernet-phy@0ethernet-phy@1ethernet-phy@2ethernet-phy@3ethernet-phy@4crypto@90000!marvell,armada-38x-crypto regsZ    {cesa0cesa1cesaz0cesaz1@Urtc@a3800!marvell,armada-380-rtc 8   rtcrtc-soc Zsata@a8000!marvell,armada-380-ahci  Z okaybm@c8000!marvell,armada-380-neta-bm  nokaysata@e0000!marvell,armada-380-ahci  Z  disabledclock@e4250!!marvell,armada-380-corediv-clockBP T{nandthermal@e8078!marvell,armada380-thermal@x@pokaynand-controller@d0000"!marvell,armada370-nand-controller T ZT disabledsdhci@d8000!marvell,armada-380-sdhcisdhcimbusconf-sdio3  T Z okaydefault usb3@f0000!marvell,armada-380-xhci@@@ Z okayusb3@f8000!marvell,armada-380-xhci@@ Z okaysa-sram0 !mmio-sram   sa-sram1 !mmio-sram   bm-bppi !mmio-sram   okayspi@10600)!marvell,armada-380-spimarvell,orion-spi P Zokaydefault!"flash@0!!spansion,s25fl164kjedec,spi-norbZpartitions!fixed-partitionspartition@01U-Bootpartition@100000p1Rescue systempartition@f0000 1u-boot-envspi@10680)!marvell,armada-380-spimarvell,orion-spi P Z? disabledpcie!marvell,armada-370-pcieokaypciPȂ  @@  pcie@1,0pci #intxue@Ȃ3`F####Tf  x$okay'interrupt-controllerve#pcie@2,0pci #intxu!e@Ȃ3`F%%%%Tf  x$okay'interrupt-controllerve%pcie@3,0pci@ #intxuFe@Ȃ3`F&&&&Tf  x$okay'interrupt-controllerve&pcie@4,0pci  #intxuGe@Ȃ3`F''''Tf  x$ disabledinterrupt-controllerve'clocksmainpll !fixed-clockT;oscillator !fixed-clockT}x@ cpusmarvell,armada-380-smpcpu@0cpu!arm,cortex-a9cpu@1cpu!arm,cortex-a9chosen /soc/internal-regs/serial@12000memorymemory@sfp!sff,sfp( ) ) ) )  )  disabled #address-cells#size-cellsmodelcompatiblegpio0gpio1serial0serial1ethernet0ethernet1ethernet2i2c0i2c1spi0interrupts-extendedcontrollerinterrupt-parentpcie-mem-aperturepcie-io-aperturerangesbootph-allregclocksstatuscache-unifiedcache-levelarm,double-linefill-incrarm,double-linefill-wraparm,double-linefillprefetch-datainterrupts#interrupt-cellsinterrupt-controllerphandlepinctrl-namespinctrl-0gpio-controller#gpio-cellscolorfunctionfunction-enumeratorreg-shiftreg-io-widthmarvell,pinsmarvell,functionreg-namesngpiosgpio-ranges#pwm-cells#reset-cells#clock-cells#phy-cellsmsi-controllerclock-namestx-csum-limitphy-modebuffer-managerbm,pool-longbm,pool-shortspeedfull-duplexphy-handlephyssfpdmacap,memcpydmacap,xordmacap,memsetmarvell,reg-initdsa,memberlabelethernetmarvell,crypto-sramsmarvell,crypto-sram-sizeinternal-memclock-output-namesmrvl,clk-delay-cyclesbus-widthno-1-8-vnon-removableno-memory-wccell-indexspi-max-frequencydevice_typemsi-parentbus-rangeassigned-addressesinterrupt-namesinterrupt-map-maskinterrupt-mapmarvell,pcie-portmarvell,pcie-laneresetsslot-power-limit-milliwattclock-frequencyenable-methodstdout-pathi2c-bustx-fault-gpiostx-disable-gpiosrate-select0-gpioslos-gpiosmod-def0-gpiosmaximum-power-milliwatt3Tm