ELF@ @8@   b } > =AB8? lTTT> @_ <!{@@D?A=8D,@ 4T8D,@4T___֠AB8? lTTT__{y!R{_;_? ;@_{_q[6S@|c*"kןSA[BcCkD{Ũ_?qT`VTs@˟s˵{ @MSv@a@Av!?T|/uR @{¨_{S[4|@qT1]*zd Ԛ qAT@x#cT@bSA[B{è_{qSs|c7s["Ӛ$Ӛןs"ks*g7SA[BcCkDsE{Ǩ_7@z~}g@ 3?qWTu`qAT@{ k:s!kz!raT@ k:$kz뵒t{˹? qT*@B8 SqT<^_{GBRҨ|{D@B @BTT TT$T"qec@ecc`FA${_hhc Ң҂DbB{,S|m*!Ү@Bn@ᇟ%|&Ś }SBhe? k T@ qT!Bt?qATҀы e@ TqT *b@ @ q`T2w  {) ~! @eSA {è_{cn@R營B|{@ @{¨4_heS*{SAv@a@n@3>R5ҹBk~{ )A@@SA{Ĩ_;s@E!@ik㇟Dn@{SSMSvCMBv@B An@S AzSA{¨_{@v@@IB8Jn@) S??qaT @ ?@B8 SqT8@AB8! S?qT?{_? qT @ ? qT @ qaT<>?qaT{ {({{{@B8 SqT8Հ7@v@@@B8 Sq!T8~AB8! S?q!T?{_qaT<>qaT<>?qaT@B8 Sq!T8`6{AB8! S?qT?J{qaT<>?qaT_@B8 SqT8S_qaT<>{S[c@z@4bXt~@n@a[BSAcC{ĨqAT5R*R@B8 SqAT8sAB8! S?qAT?_qaT<>?qaT@B8 SqT80 S_qaT<>{q{U{@B8 SqaT8tAB8! S?qaT?{_qaT<>?qaT  ?9@Ӑ\C`0ClMBeZ Ś š)a6IvI~TT_?*9KiXkP8^T L%̚ @ KT T՟??_ _#;cLPӂB ÚC# ~ T?_#;cLPӂB ÚC# vT?_q?__DB8՟ lTTT><8աADB8՟ lTTT?DB8՟ lTTT   ?DB8՟ lTTT?`_{@skc[SKC;3+#              { KB8!lTT+TR>"@>@>R<"@<@<R8"@8@8 _        { KB8!lTTT"@"@"@                 { #+3;CKS[cks{           {                            {c                            {Cp                            {#]`IB8?!lTT+T՟?? ՟??՟??__ FB8 T@T+T@T%_FզXA>տTXX@$@֦XզX@$@00_{@@@@@#@'@{_@ @@?AT_@ @@?AT_O`@bAdBfCh&Dj.El6Fn>GpFH@`bdfh&j.l6n>pFO_X|9a:aI6n@:@|R@@"@X7I>@ @2@`XXTA2@Ao} > { ! @TaX !B@7*, ,?TB@7#c` @D@!|@? T _TAB8? TTT0><86``6u?AG{¨_{A@#F "GCRC{è___{ ,s`@:44 4 @{¨_{S4q!t5!!5 5D1`C9aC9dv@`@?qTA@!,@%SA{¨_{S*r @!T@6*SA{è_rT*@*{ @a!46qT`@4`T6~ @{¨t@@{S[ 8@ HRr?k T`6~ RSA[B{è_a @vA`T7}~7a@a6sS@ssksR`@A@34@R_{@@,@` 8f An@`<8b A6@``8^ A:@`|8Z A>A{R`8A:@RA6_R__R_{S[A"@!6a@@>@b@!B`89qa@`b@v9u":Rh* BazqT* [w@u9֚~s`:QzsqsLAT@[BSA{ĨD{ `:a @<`; { `;a @/`; { `t`<{ `{|}=SR{_{ `r@2@Br@p@2@nR @{¨_{<{ @?x? _ҀH@?PR@Rܡrr _@!5_{@C@{Ҩ_A@?4C@B@TC8R_A8#B@C<B@@@@@@C__{`> ?6 @{¨J`@@R @{¨_@`4R_{ R*s RU`4R @R{è_{` ?`6!RC"RR"*4`d?R  @c#RR4`?{¨_c@9ac#R c9 @R`4p @c#RAR5c@9c#RARt2c9 @M5$ {` ? ֙6`M@5!R"R*4`d?R @{è_@#RARЫ4`?@9#RAR29@4p$v  R` R_@@ 0R_{R{__c`AT_`0ET_RbEHT{ {__{Ssb7c ;[@;R 4{az@;`;R 4`b~@T4 R@SA[B{Ĩ_a@A`@3# 4Ub@ 5{{|@_{CS*[cks@>A*>6(Rsb7q`: R`>X6@`ұ6@c7cC@ y   *qTq@ TA  3R@ऀR êr?kT$<{z:An 5xa 4-{v 5 D#{v@9?XqT?qTT z@9qThTq`TqT`f@Z`j 8qc:B:f Ҡ7 `&< qTq@T`?!::CcR RR%7O@a2K@aZ`j!z@9`9~@9`9r@9`9@Z`b@Z`nv@9`9`C9 qXzTcaRB;& qB:@T `.@aj@B:4`zh`.@aj@B:4`.@aj@B:44`.@aj@B:4`.@`b`.@aj@B:`4`&@``@Z`v`C98qTaf@an`v@`vv^46@@ !`7#C98qTB$Ú6"C9_tqHT!$š6@ҕ@56C9C9|@n@KL9q T 4O@ccRcl@R;5;@@O@v#**R G@*#ˠ4*;a @_1T?q@E:T;@g@IT` ` a@$7V_1 T1T` 9`2@@`.@aj@B;[@4` Y` V`B`h !jz!z!?q@Sᗟ?j@TG@T&@ @9qT`@ y3`( yr@vR{a"3`67@`&!K@`[{ca @7@C"R@TqT`K`8a 7@"R@q`T0qT@@`@`aB7@`&!KNa7`@`@`@!` _9a*`@`@a!'`R3@|@u3@`B|@3I`@3@h"86`@@a*`"@`a`&@a"`*@`aBa R`bab R`j77?@3@@u`7?@ @@ u V B~BC@6oR7@`('!K1 RC {StД'[1.T`'`@{@SA[BC _#a!`(~#w{S@t`@t` @tB@T@SA{ètѧ@{S,u@Ri`$R*@96` @`(l` @`6@SA{è_`)^{P+S[cks D)AR$ `@r `)gB{["R_T`)3Jq*+rqT?@A4s@`T`^a`58s@@\oqq T[BcCSAkDsE{Ȩra@@Oq@I@4Z@o@pq T1!Ta@`l* 1TSA[BcCkDsE{Ȩ_{S[Rckv^u zb9y9x9<HTY``@h!8RSA[BcCkD{Ũ_R,!``@s{SU `* R@SA{è_u6 R`&5R{ RR'5a@ @!Zk{ƨ_{#R Rb@BZ+a@ @!Zk{¨_xab5_!{Tҁxe!ZaR#|@!T{_փxc!cZc ct~B?T{S3sb,`@qTaBB~5`@SA{¨_sb_@b6__kT`{*@@{_a@!.a@!0.4a@!. {[;@S*c*#*/5`a.!.!`.T0qTT4qT*``/#@SA[BcC{Ǩ_`/q TqT/@7T/@_@3HT#Rc*1T/@!/@77@//@7s`a@!/?v{RSt`<0[`0`r@9l`v@9o`z@9r`~@9`0p`1l`@Z}b@`X1BZcb@`1BZ]`z@9x?qTw>2R`2O~@5T@SA[B{Ũ_#*?K@Q`z@9qT4#@`|24qT@`bA)2SA!Z[BBZ{ŨB@Q!Q$*a@!|3{S`@`6`@25`@SA{¨_sba@!l a@!4a@!p a@! 0?a@!p5_xraT{pA{ R_R_{`Fe{RҶ{_{`S9eSAR{¨ҨACT.@?3`+eRҜ`SA{¨_{`e{Rҍ{?@T_{SUB g`5B~5@@SA{Ĩ_{cC{¨_@ᤀR!êr_k T{q{xS_ R_(@_{CS[c*! @5/@a3@ (@ $@ @9qAT!@`H`@c!`*@?tb.@a!L=? 1TR`2@x.@`55ҭ??@*qTq Tt ARw ҝ3?@/@B@61`TU?@` ?@ऀR êr@?kT`$7o Fs:Ai5`x\4`(oq5``Dor@9?qaTv@9kT?qTXqTz@9? qT`/@Z3nc?@ReR: @7Ga `^`Xn{ASB[CcD_{S`[d)#9`#Ro@4`aT#R R'_@4`n@SA[B{Ũ_#@`B@i@#Ҽ`DnRe{CS[cks(@@R{ASB[CcDkEsF_֓.@qTwRU!E/ @*rO C#R*cGRR 7O@9 7*l7BBZB9Z|CHv;aT@kT@;@@?B` R{ P`5@a@"RF @{è_{* *`* @!( {¨{S[c#c*OqTqT` n a@ऀR êr?k`T`m R#@SA[BcC{ƨ_(5` 455```z@9qT`bB@`AZ5`D@5 R` 45@9`4{ *6`q *`6a!xl*`6` RbB * 6`@9@4w*6`xbBX+ *R 5`4* 5`<cC*4`x}E*T|@*"!ҟ!TAT?TB __'xfZ&xdZ€xccZ{S*R[c*RtSwS!|@|@''k T~ [BSA|cC{Ĩ_ֈ|} q!Tzd %9<S#9\S#9|S# 9`#9h#9pӥx#9%9&q!Tzd %h"8<S9\S9|S 9`9h9pӥx99!jhZ%jhZ%h"{*S[TbvSRB|@qTa Qڠz!sQ ZR3SA[B{è_֡z`!Z4{S[*5sb*B @Z`SA[B{è_ R{S[*ck+ 7**o@Q? qTs@?qlT*A!!`!X+@SA[BcCkD{ɨ_tSR|@S**`6o@!Q?1 TbD@BZ@*w@Q qT{@qT*M)*`@5 D@Z{Q1aTvSRB|@**T )J  k l}~ kT*** J KaT) vS!;B|@{S[c***`7x4*cC*[BSA{Ĩn* R*SA[BcC{Ĩ_{S[*k1T** 6A`!Tp!*SA[B{è_{S6*`!`!aR*SA{¨_ bRB!%*@6`0"{S[c?TR[B*SAcC{ƨ_RbB*@7*RkTC#*'@!T**@6V*`"XRqbB#ATc*R/*6*<*`d#> Zc*R[*7 ZR[R/*cbB $* 6`d$ `,`{S[^6* `%!bRB;*@7u.*o**6*`X%*SA[B{è_u%X*bBt&p*6`&R{S@4SA`{¨\'SA{¨_{S[*c#q T*RA`!!(#@*SA[BcC{ɨ_* 6A`!!!x&R*7y9[)*R*6*`)kTzdzd@4Cf'**C* 6c`)R{#RCc{¨_{St*[ckB 7uw***R9**RkT7v7@҇@57@z5a!L*M_cR9ZqTcRREbcB*%RR=*7@1T4a!l*93@@94SA[BcCkD{Ȩ_{S*[*RkkTR *@!T*#R R"@s @.BZZs  s sNsK` Z5*SA[B{Ĩ_ֵ*6R_cc*;{S@S`*R@*SA{è_*!R6`+*1aTa@!Z?qT`BR,`@ZDqTa@`"R|,!Z( { `,ii @`{¨,i{*S* RKXXqT! (@6`-i`*<.W@SA{Ĩ_{S5*z*kKTRB$*7u'*6@SA{Ũ_*F5CRs*R`5*4*bB.qDCRRb!!*T*{S[cks @ @F*4`.w RSA[BcCkDsE{Ȩ_6@`$/@Y^tTR R? 4?@`H/R?4`/ i?@`0@@P:F7T|R`R?7@`5?@se#T@:RqTb`2*4`2@Dh  Z`L17@ZR{S[c*`*@b.@a!x5'1 T 61SA[BcC{Ǩ_`5`&@ `@9q Ta@`7T`@A7@@3@`8H 4`.p`>@w:@C#`5c#5һ''@qTq T`h6bh R`2@`w.@@B'@`2'@@Oh5`3R5`,4@D>h`z@9 qT`4`~@94`4w;4`$5st@ ZWT''@`<7`@Zb@@ZBZbAT`5P'@5Cc7'@`/@a3@'`57@`@Z?T``9 R_{S[V@6`9`*\<=z6`8::6`:*@%Rb AB`;!% Q*`546a@R!ZFRz*74|@#R R'D4'@`;[@*SA[B{Ũ_{S/@C|T_ q TDT`@Z`R @{¨_ {S[*4*5`@;@Z t ;*@5;s?SA[B{Ĩ_*[BSA{Ĩ { B^`Z @{è_{SbB2O/@RaSA{è_R{[S*@(>cc*4@l>SA[BcC{ƨ/@`.*BB> *B)@!@>* *BB(?@H?3C**@?5tД0O@kT@?+@s8sx{[S* `5cc@*[BSA{Ĩw&5ccL@SA[B{Ĩ_{S#[*9E*``84@?4*~A9*%`(*A9`C**`\ 4@?`  4@?q"qT%$՚6*7A9` QqAzT * A9`LvqHT$՚@6c*`*`w4@?Q qT*S*`\U4@?'@@7@`8S@/@`8"qaTc*-5/@`*G*7G@qlT@SA[B{Ǩ_3@`8qT**{RSt[cks*`s4@?oUz_*@6`SAcC`[BkDsE{Ȩ\;@@Xwk^*R7k@q,Ta!<*7BBX+*Ҫ`$9*xwVk=*R7k@qTSA[BcCkDsE{Ȩ_qT*]*****qT*G***``V 4@?BB+*X`  @?BBL=*I`XBB *=`[|{{5 R**BB|*$`[|{R***o*7o@qLT***h?@@@:5Z@:5{Z@vqT**@!Z_{S[*i7@*@@?@@`RSA[B{Ĩ_{Ss [*ckzZ.+r*6"1K: TssF*nz5*'@4ss" *[*V` R+@SA[BcCkD{Ш_;@bB *h @?qT@4` ` .c*4**`5z*y4ss. M)_kTss ?@B|@4ss ss R{S**5B @*BSA{èk*a! `, RSA{è_{[UzS6`R@SA[B{Ũ_*` v*3j * O*R7O@qlT RqT**n*4g*3p*{ S5@9k @{è_R{ S5@9k @{è_R{ S5@9k @{è_R{Sv@5aT@s Z5BBh=RA!xq ࣀSA{¨_ {SA![*`7*BBX+g?@SA*[B{Ĩ_aRR?s`~@d??j 8**cu{ /@ @{è_C5{S[*c*#*`7RkaT3**_s**1T_@kT`59**#@*SA[BcC{ƨ_{S(@7*Rq!SA{¨_֠C{CS[ck*s*C"X@C@@?Q?pqTXa`?HG@@@]'*4*@S{A*SB[CcDkEsFC_?U U*6@T8 ?@'*6@Tla3*j@$ qAT7+@*T**X@#;A*BB@4@dAa*;5@Г<9a@D5a#*/#C9{ 9**`49R"qq ]zT RR9R*@ 4Zq T*##C9CB9*@x*Ru@5*Rp5*Rk*5 qT*Rc**RN 5*"RI5*BRD5*R?@5*R:5*R55*R0*a4@4MgKc4* 4_q!T@v#c@_ qAT@!gZ q`T)T?T@3Pa@[*9c@ 5B944 QqĊNz@T'TKbK@@c#* *K3K@`4@H/cg@9@_q@z`Ti4@Z`TKK@q`TB94@G`k@c@o@\C@?@C@C{CS[6A,@! U7#*gRFRR_{ASB[CC_C{CS[ck3*? @@;6 @S X aR!8?IT?#*'RF RR**7?@*BBx5AzT@pzC@@yG@ w;@v?@a3@*{ASB[CcDkEC_ҹu*{S_qmT*`@@\d_Q@Y@*SA{è_{@ *T* @{¨f{ @8?qTq T@ @p_a@ऀR êr?kT@h_ R @{¨_5@l@Y_5@@DP_R@K_4@`_5@_qT B{S*3[Rzssy*k,T*SA[B{è_{S[UQv q T`@*c@@9?qT (`6`@!"R! f @T7`LT@xSA[B{Ȩ_Ҕ Qt4` @#qT`@' q`T`@+@hsB*c97s?[qu4`@#qT` @' q`T`@+s?z{ST6 B@ ~"RRSA{è_R-*&ᶍ- a۶m*C|f{_qmT`@ {RRcQ@)^@*^R{Ψ_{S*[c**u q TlTqI T`@!3~`5` @Һ`@Ҷ`@Ҳ@@-@#*u5'@]w`Bx0B,B@. qT`@Ab!XT5` @Ҋ**?v@5@- `@Ab!,A 5*vRSA[BcC{Ũ_`@Ab!X3`5@*v 4@,, R`@a!#`4*u4@,`@a! 5` @I**u4*@-`@A! 5` @3`@/`@+@@/@#*Gu5'@v`Bx0B,B@/y`@A!40 5` @`@@@L0o@#*u5'@v`Bx0B,B@1Q{S_qT@@l1OB@hSA{Ĩ_4B`@-5`@B 5`@R@\21R@2+{@2SS@a2@`:@@3a6@@83a:@@\3`B@!@3a>@@83aB@@\3a@@|3a@@3a @@3A@@4A2@@X4A>@@4A!4R@4* 9 L 4A*!4*=.*f@$545@l5qTA*!50R@6A @@P6@ @t@t6@@M&5#@@6tCA9@6pKA9@7lGA9`hW@@$7dRSA{ƨ_A!L*@5_qT{SSQ[BR*`@!v !ed` @**[BSA{èSA[B{è___ qaT{R`@S` @Rҵ**w**@7QRSA{¨__{cw C)@D)l8+@AR{è_{CSTQ[(t4`@3qT` @7 q`T`@; R9@p DFB(5m`RtyRm{ vqT*7+s@* @{¨_ֳ{S_qMTt@ҡ!P *@5TU2NR|@@*SA{Ĩ_x@|@@A6*6Hs|nIv*4@3R|d@q{A!h 4!,4A!4qZ @{¨_@R R{_qT_qT{_`@qTqT5RqBB!A@!{_qT_qT{_`@qTqT5&R@qBB!A@{S[֚cWka@,[@TSAR[BcCkD{Ũ_`Y# za@@XktT `>ht@"bTs@R_**# QR  c{S_qT`@A*!|`5 qTs"!R`@pRSA{¨_RR!R{S*[UV~֊cRRqT**)`@@9?q!T4`@4a@@|SAR[BcC{Ĩ_7RQs"8R{R{_{R{_{UR{_@Qq T_SA[B{è_{S**[!`@! R1b@bQ_kLT@qT!!T"*SA[B{èR{S[*_qT`@A! p46R*sN4R`4RwZ`@VZ Rk Tv4@RnZSAR[B{è_RTR{STQRu qT`@@9?qT@9aRqAzTqu@Tq3T@RX1 TQ"O`6s27Z@**d6TC qATEBХX B c RaRRd@*SA{Ĩ_ B{S[_qlT B@ Y@x 'O@ @ RSA[B{̨_`@*6 q!T`@A! 5`RqMT@ #@,O @HN*@N3 A!$Rs H N@A!3Ht  N4 9ZA!< d N3A!2s  N3A!(s @N3A!s @ N3b > v@P*43@l oY5R? VYc@RhA!H! @DY_qmT{BR`@Y! K{_!R K_DRUDR VDRVDRV$RU$RV$RV{S_q,T@p R@SA{̨_$R`@i*7@@*p 4a@@**! Rq*a4!QAa8A5$A  ?T R_@9?@T4Hc8c c5R5T{S*@@/[c#N*@4Wv/RUе/XkLT#@SA[BcC{ŨXqmTXX s~@@aTbT#@*[BcC@SA/{Ũ_R@/[ YиQk+T@5#@SA[BcC{ŨIkaztҖ /!ZBTИQ @/6kTaju8kҖ@е/*{ @0!`@ @x0{¨lM{S[ck+_qlT>`@*Ba!H[* 5 QsBRR4`@@9?q@T҅;5@45<?q T?qT4R@8A5Qs"8R4@ @;6R`A$ 44;@A!0@<1+@*SA[BcCkD{ʨ_@x0NMA!055`@x0 M;@@ q`T`@;;@"@BZ_kTT5*@x1*ԻqR?jT@02`@AB!25q T` @v 4`@qTA@cZ*4r@02u`@*A@BZ_kT@2g<RtA@x3W|`@AB!855qTaNAAE*6F@D5AO@6=@5`@B!T* 5q Ta^AA)*7qTkAck@c<*6@7*Ak@?qT@T67x<"|@`@k;zQ@9?qT;a@9?qTkT@p759SyRPa@9?q TZk@k;@?mT@8?qT;;@;@6e?lqT;3s R;@@9?tqT;"@8_q`T59@y;k TaJb8jT;@@9?tqTB8k@ks";@k@ k`zy9;klTs`@@9?qTkqmTw @qT@9qTvAAy@* 7@9qTqTqATA**A*s*@9qT`@*:s@kT_k@9sqaTk!TA*ҧKA*k* 6@9qTa!|@K@D8OoA*k@7@9?q T5!qT`@BRғ*k@*q5qT@ABZ!8qTsQ kT9R@T7 k TZsRqTX/ ҿkTjss"@8?qTIK?qT|@?q R$BzaT?kR q Tw @qTs@Aֵ*@7S*ADs@`5m7& qm T@X:s@a4 ( ZRA*^* qThTqTq@TRk˹T@:q T$qTA*kT @9@4R!K &!@9s~q T@9>BB0BB41sQkjTk@R!K &!@:z4k@6A*RA @!Z@ ZsqT_@$9TkTR!K &!@4:Wk+TR!K &!@P:Ls@a42@D:ER!K &!@p:<aB!P$5a @A(*7Aq-Tb@Ӹ6#@:? 6@\;`@@9?q! TAqT` @@9qT&Ҡzta@Y4*AT*Zt`@!Z@@@;!ZA Z@@!Z@RkTA @@`>!ZBqTA$@@>!ZA*@?Ab!t? @5qT` @<ZA J`@B!h@5qT` @R҃`@R~A8| `@BA! *` 5` @@9qTAUеn*@?@*kjTA**6o@?F***`B`iqT`@RD`@R?A}6P@qAT`@*A6B@L`@Ab!; 5 qDzTq!T` @`@ҾsрAA`@AB!3v@5 qT` @ҧ*A)RRQR+QRRRQRRRRR}RXRSRR{S*[**7`@7`7?q`T66@RFT`@x`@$`@x`* R*@5 @SA[B{ɨ_?1@TH{S[ck_q Tw@*_qf"TB 5` @A!$4sBRt@B* 5S@9qc`RZ2v*Z$/@`SA*[BcCkD{ƨD^qTsb6RR6RS4@**c0v*S@q"2!2!SSW@A4 4|@o5@94*C/@$R\S@72SW@kT/@*CsRK4@9q TTqTqTqTuRc~*4@T%4*]*[B*SAcCkD{ƨ_5RURR[@A!%dq*P:[@T*@%55![@*[@@P& *@1T@& qTqT*@1hTq[@*R3R@=4[@*@1 T@'B1T3RkT@'[@YB1 T[@T4RB1T_qT{SSQ[R*`@!v !&Z` @**[BSA{èSA[B{è__a!A!{@+R@{_R_{S[*@5@qT**@X+qSA[B{Ĩ_ր@*@+**4*@ , R{c5@n4@,j R{¨_{S*5@*"RSA{èSA@{è_{S[*5* qT@R*5*W-R~S@4-wRqTzaT#@#*RN5s*-q!T@RRq@SA[B{Ũ_ R{ _qTh5@@@-R`@җ*@-*R` @:` @q* qT#*@q* A:T'@*/*4A@!0@0 R@SA[B{ƨ_`@@qRqT`@*VW"0B0'@C**}~*4x`~@1}R_{ *@9?qaTq@TlTqT@9 @{¨_@y@@arS"qB "@@9?qT?qT@9?qTARa8#|@_qTh#8Cb4!_{Ss.[*c#|@Ra@v@ 5`@ Ts @u5^q`T TqT q T4RqTqaT *|S#@SA[BcC{Ũ_qqqןqǟ**|qT TqT qT5qTqATෟয়sB9qT@2_q!T{* `@W*qLTqT1 T@2MRq`T qTa@b@x @R{¨_R_{ Ђ qT*7+s * @{¨_ֳ{S[+zs 4sTSA[B{è_*_q T_SA[B{Ĩ_{!P St@[*ҵ534s2N RYn@`Rj@P@@A6*6HGWnB qT @* qaTqT@*"*@4@X5+ RRRq`TTqaT@5@x@*O5@*)6*@5@@A@_@pC@l@C@@A@_@lC@p@C@@A@_{M`4{M{_C{SKdZ5*?CR[|@_qT?@!` 41[[?@[@8@{@SAC_֠s "CR[[a!d!|@**@8a~@ AA!C5BAA#C 9_A!R @95@F _!B {@STCq TSs`@95SA{¨_ր@9sQLsL{c3k9c$S[Rs@{ TL*@`4*L*q T, Ts 4q T9@@@ T qT@5@5 R5RLQqTs@9/s {A7@/g7@R R;*g4B@<9`~@;@;@Rgg딒"6qAT9K7ZX6{@SA[BcCkDsE_L`4{@;S*RA@9q qT`@Rҋ@; RaL@4L}҇qATT@L< RSA{¨_R@<R{  S*[cksA1Y@qT@*qT @'*5*?kT*@<=jEKTj@K4qT@A!>@5*@>xAR5T@?3Rl?kT*@fjKYejKlqT[B*SAcCkDsE{Ȩ_֠@A!?*5@?J!ReA/T@@T<\@A[XP A0R 9@VC b @9`R`9@psQKqT qTR/JK*rTFKo*rTQs k!T;K*rTo@7 Q5 Qw5.KrATs@@!R9`R`9s@9`9 R` 9T`9@9 O9`9YwK*r`T KrTw@! 7 FB BBkT!QQ! R !\w@ ?@ w@q,TJr`TF! !!kTJ4qATBA9NqCEСT 9@A! @9`R`9@T@ qTRa9qT!Ra9q`T @9D!Q!Ra9 qT@9$q T!x!DЁ9Ra9q@T@9!Q 9Ra 9q T@9a9aRa$9q T Ra(9q T$Rd,9 q Ta09$q T@R`49RR`89R`<9`@9 R@9|@`9 Ru9` 9h&8`h&8  O9|@|@ah 8h$8s@'xJr`Tw@ !QwqaT@4AqTx ?ֿqqaT2aO9?kT RfA ?cNq!T@ 8?@?!0Y$qT!2dRRRRRR$RDRdRR R@9`R`9 Ru9` 99a`9 O9`99g qT@A@AK RJ@4J}ҝqAT5@Pm~@** 8 ?T <RX_qT{S[cFA6@A@CR~@ **~s@@RSA[BcC{Ĩ_`@*RS*7@!A!A qT @_ R{_q ST`@ `aA@8 z @R{¨__q-Te DQ*R 2P_@ QqhT{`@[*SҠ@qT@@ PݗҠջBRB5T@T@8 ARSA[B{è_Ҽ*@`F`j58__q T{RS`@PS*7@ҧ @ңT"qaT`@qaT`@ qaT`@y`@9"qT#@BqT#D@B qT`T"@8#$@xB_@ RSA{è_C{CS[#_q T`@*S* 7Q?qhTXaW@VA @QA@Ke~@ATRU qT!@D@TT**@ 3R@ #@*{ASB[CC_"qT!@D@ qTD@y!@yD@9Ahc8B3R{S[*c#6@A@C67Xj10[ oqaTa@@( i@@RR* 7`@A!A"qaTa@@@ U 1z/ 4q`TV9qTKU5 qTa@ya@9cR/@B*5A~@3A4#@SA[BcC{ƨ_֟qTa4s4"qaTa qaTaya9 R4*s _qT R__qTR_@ QqHT{R`@S[*)R*qT@AR!A @qT@r~@!TR@SA[B{Ĩ_ qT5!"qaT5 qaT5y59_ R_qAT{*`@S[cQ|@s7@WA @A<@A7@@p G RSA[BcC{Ĩ_b~R_{S4<@y@y?kT@`@ya @yb@* @SA{¨@{S[cks_q T@*@P99@@@99@ P9@P9@P9@O9@ Doy@Gy{7`@@99iT@@99? q@T @_@@9?qT_?q`T@_@@9?qaT_?qT@Ҿoy?qT@Ҹ<{~q)T!)Bx`4@$ SA*[BcCkDsE{ͨ_R**^9B9qAT? qaTRR9Z9-ZkTRT***9 5B9*B9@s)9**k9q\* :qk@As@!O)G,@*q! TZ[@*{R7**oy9`4<R**@99?k TkTkT`( kITAB9 @9!@B9 9@A@@@oAy @{@zkaTkT**7@oAy*qaTX*/R**84<R**xZZoAy_kIT99?khT*qTA!BҺ`5*qhT*qT@<R]>**sy84@R<R*N*@J99?kiTkT*sAy*{@{@c oAy *c*c<sy8 4[Z*{{ZOR*x84**<R{ 9"9k"T@5Z`Z( _kT *9  ;G @9;@yk TzhTK#@8`x*G@*7`( C7@ #@y?CTC@;@9; T$@*7@P O@y@y!  K@!<O@@y5qaTR F7Mq@T@q! <p R!RC@7@7\ q!T*OO@ !L!`@y+_@! !@y+B B<qT 5*@_qT_q !!!qT*!!t R*R  Kr!)B5? qaT7x @t7u{SR@?T @9qT !@9a4R`R@SA{Ĩ_`5b_q!T{[Sc**ks@@9@(D@$D@ D@D@D@D@XHyR7x6@P9@T@@9qT @G7L@)@  @aqT@ qT >ME RSA[BcCkDsE{ͨ_Q9Rq!Tq TZx Q*<RQqATqTZxRk`Wk<8n`5i5QqT QqT @qaTE6@@scX5qAT6R9R)6L@@)3 d? @sc@5`5w@(@kmTk-Tz:e"@****?5***~@ 5o@kT@@**** @s@@ ?@@Ck T`7*(@@xw@@p?kTd@***?y5**$*6@T^-@@***@7?@*Q@C@*B<Ko@k-Ts@_uB;6sS)@w@s@o@qTqT@@9@(@w@$@ @s@@@o@@,T{S* qT`@}|R`@jҀ RER@9c4aT5~CTR@SA{è_cQf$qT<c<aD5 Ҡ R{[*S*c!4@bRK@sQkkTqT @?TkO6BqTk@**SA[BcC{Ĩ@D C RSA[BcC{Ĩ_R{S_qT`@'jO`jO3R@ @*SA{è_**!q!,@ !@T 5Z~q {S?a! `5zz`5zB9~B9c2vC9\S@ vB9B C9|B|`@BTSBKbj`b@!IAKa T@{@SA _bh`4a@!K`{@RR{_ {S[ck+@@@ &aA9@ "b @@ab@d !|S6!<aA9@bf@ ED{R `jO3ajO@ RX 0@9?qTgPR @{¨_ a@ R@QqT{R[jOS*qaT`@ҙ*` @ҕ*jO** }q!T  RSA[B{̨_~a@Q7;@C@v~**6Yk x0B,*B k__qT{S[`@Y` @U`@QjORjO** l}qAT  R@SA[B{Ĩ_4~**XkB, x0B* (k_{RhOS*@A6 3R@*SA{è_ֿ qT@ *x* 5 sx_qT{S[`@` @`@jORW jO** DP}**XkB, x0B* ?k@SA[B{Ĩ__ R{ `jO6}q-TjRR&R D ]? R @{¨_**# QR=G{[6֮4c**k994SRkTSA[BcCkD{Ũ_Ra  `8"qATt"sB@ t8kaT`*( {S[6*֦4@s`T@SA[B{Ĩ_kTb@ a@4c@"s@sR{S;J`@T D5SA{¨_{R#S* [q T@ @h T@!!5 qT @qT@a@* B 6{4Rd@*SA[B{ʨ_t@ ` 6`&@Bq& #<7_`@/RqE:+@pqT+@ 8LT+@ 8F+@a@!R+#)qE:T+@a@!4R{S[cQ#qlT*TB_qT @ $š7@|@w5R9 QF~RS75~}?klT*@h3j"4#@*SA[BcC{Ũ_`@pT@a@K4`B@&~`@*j"R{S[cks    _q0Tu@*  0@/T@9!`/qHz!*@4a!3q!!92!!3-!!:(7 *Y4!!4:s Qw5B4@@C+C@@a@* Ԛ9 d:;R~~SA*[BcCkDsE{ͨ_;R<RC%4 @ *QbW4t@qT@@a@* š  Qє Д;gc@ Ú`@|5B RC5C@ ;WR@43@_q !9!89!%_X9{R&t9'j9 <73@@@4`@O8`@W A*57@`?3|_q !9!89! \=`@4Ch~* 4_q$ 0 0! =cc@*?@7@@`TO@H_q#c9B|!?@!9aB x>BJ*@5`@9qHz Tw@ ><3[?7 ךkT>bs@5O@c@|@_ TW@Rg@|@_ hT`@S hc8qaThc8qT`@[3@S@3c@c[@g@g3@`b@ š`~4`@C!~a@3@#|;;@a@ p7@a@s|s@R Pa@d9 o**Y44b@_q !9!9!* ];R{SR[56c~ <JRz|֦7s5 ? RSA[BcC{Ԩ_`@ a@4`@ @ .`@@@ (`@@@ ,"`@H@ Req"B  Ala@9?q@ THT?q T? q@T?qT  ?q T? q@T?qT d a@a@ Da@4 a"@ a^@4 |aZ@ a6@ \b@ a@4c@"!R`B@|    @ pR~@Qq T_SA[B{è_{S**[`@!=RC@bQ_kLT@qT!!T"*SA[B{èR_qmT{`@S@hT@` 0}g|R@SA{è_a@ 5fo`@ T}4e`@_ R{S[ 7 ;SA[B{è_ր@T $ sR{S[c#5g@  -b@_T  d;R#@SA[BcC{Ũ_**@`5?q`T@D7@  `@@T  ?;@  {S*t@O?k@T@* \ -%;RSA{¨_@{S[c_ qTlT_qT_qTSA[BcC{Ũ__q!T`@SAO  ,0Ҵ  :`@?  0`@5 @/! *  R@R!! 4!! `4!! 4  @ @ |@@#'4  qTqT Xa@!Z!@#'h5q!T`4   :a@!Zl{R R`!2anB?qT ,a@ b@,B| S&a@ "a@ a@ Da^@ aZ@ aB daVB  aZB  a@ U/a@ Q/a@  @{¨K/ @{¨_  {S[c**ksT/!OqlT R6@5a!5@R+:R!`/ 4R{@*SA[BcCkDsE _A! 5 q!T@R:@`4 <9 @9@% 894R!!D`5@ 4Д.6Б`@CT{4C@qC@a@!9!409/@5 qT @ D* @ \`5q4RxR4ҷ`4!`/* 5 qT!!59R!!<`57R @|@C a@x4B6ҽ>4R Pv9RrRRXR҄o@9 4!!hs 4!!n* 4!!h*@5R kT g@}C#KFR5@ 5@RC@G@o@CGO54 RK\*q!,!x0!qt5:Rw@RR@R9R R 995 .!!4!!,qr!! @4!!,qla@2>4R P8:su@RkK`@zSR`@3y*@61T#cp4R  h5c@R"R 8c@R"R:#ct35 oqT @q!*! XR !!9 5!!f@*@C#ER5@E5@qT@c}@7@  0!~4!!4p* 5B qT899W@Ҥ?z4*4R"q!TFa@o@*G@|T  >8`@q3R! !|@OuC@K@ 4cFRqO@*5Yg@C#bQFR5@*5qT@RC@QG@TU4@*G@~! 0GG@Ryq@!! 4!! `4!! 4!!5R@R3O@C@5xcҠO@*q#,cx0c y4C@ZRo@xRRc3@`@Y5x*4 *!|"`?q5O@x**5j@@ B!{ \D5!!5qaT @Rғ|@CBR@ҍvB) qT *qT P @C@R kTt@ZRKk T Rco`@K*!cw*6s@* L!+a@`@ 9z4t PkTzs@9sRczyc9a@s`@{@x*6  4R`@`B)*YRQ@zb"RB $h`8J$h 8 !u@KkTRczxgca@Sk`@[8x*6* "`@{"RB< @#6 $ @{¨_` @"RB`<7R{[*c&9&9S* + q`TTqT q`T[B*SAcC{Ǩ_ֿqT5a@ RR&9:qT+R&:qT`@u@#@& T+R8** 7M4! Z+M4 Q+`)i94J+`(h94 $C+`M4H :+`M4d 1+`M4  %(+`@*@j94 8%!+44a@[BcCSA{Ǩ]a@ RR&9:qTC 4v`@dR  Ra @&94RkRK`RHRERB_qT_ @{¨_{`@ a 4Ra@6 T% R %R{S*[*@BR!=@bQ?k+TqT@!T @*SA[B{èSA[B{è_R{S[ RU5@6=,@sb@bb!@_TSAR[B{Ĩ_a@b@a@ 0,Ss.@sb{S[c_q Ta@# RsW*4a@ |,>4R[B*SAcC{Ũ_'@@!4@"$@#(@c!,@ ,+@?|@5T{R@}R:7'@8-@!4@"(@@?'@@!4@",@@?jSkT%7#7zva!{g,q{__qT{SSQ[BR*`@v !<` @**[BSA{èSA[B{è__**?qmTR)_{* ``(#REF*#G'@@@ X/ @{Ǩ_RARyT#@4#@6* t/R{S*[_qT`@@9?q!T@9qTTQc RqT7s 0R6RkT* Rү*4R;~ 0n@*SA[B{Ĩ_`@R5a@`s"{RS*[VRcRkRsR*QqT@"A@9?qT5 0B`@q T`@A! `4`@Ҿ 5R qmTQb*q* R `( 5`%ҥ4TClR"aRB4R7?%?q`TT?qT?q@T?qT?qaT` 5 RVR 5 RRA@8a5 5 R*8R:R4 1-4 RSA[BcCkDsE{Ǩ_ҁks8?kaT@94sDT *5s d2T 3*Rwo@kT |3RҎ@"@y@"Ra@ 4{S[*cRXRk+Rz@*QqmT`@b"@9?qT!7R~ QfB`( 4 RAR\`%6TCVR"aRB4R> R+@SA[BcCkD{ɨ_?qTT?q@T?qT?qT 5XR5R;R@8557R q!T+@SA[BcCkD{ɨx;@@sB!!P7t(R7@q;~ R;R `%ҥ6TCYR74;2QBRڸas( `7_qmT@"@87 R_ R{@SA_{S`@t( B.ү 88R97A9 a@T8B5RARR'9RaR_{S*[cRqT@@9?q`Tb(R'`KqT*SA[BcC{Ĩ_R?qT@85"sQzv*Qq*{*RRQqT&@@9q@TqcRןjT*(B2@84qTqTqT{:B2#RjT *p8(R{__qT{R`@Dc`(ECR @{ƨ__q T {S*[c#q T97@9sURR@`@9qaT`5"8RkTҵkT@B7Ж ֚4R0R+3@*B5x4@4C9*!!qcc\qaTW'R@ #@{@SA[BcC _R3@NB R_C {SR[**C@QqhT`@B6 R{@SA[BC _` @RKCB@95*#hB5qT qT'@CB8 @ҍCqT`@ 'Ra @#C*`6+@*C"@Bx{S[c#_qlT`@*!! *@5QqT`AcCRB7q@T`@&#@*SA[BcC{Ψ_`@A!P ޽ 5#@aBcC QSA[B{Ψ`@!D3ѽ@5R#@aBcC QSA[B{Ψp`@!h3ý`5"R`@!8`5BR`@!!X*5s s  1sC7s~RzRXRRs~ !T5 1@( 1BqB`@!T*@5 Q qTuZAcs@A6 ,4R}@/@ 95 L ZA|{SSQ[bR*`@v ! 8@?kkT @**[BSA{èSA[B{è_{R'p**&Cƌc 3s* RfS@ @R{è_ @R**@ @*@_S{S[c#*1T@ *#@*SA[BcC{̨_C*CR*4@* *C R*`4@*C ,C4kT?q3sCC RAR9R8RR{S[_q T B ~ RҥRSA[B{Ĩ_`@!$`4s@ RRT*$@ 3 ^X@@T@|q @zTR{ _qT_qTR @{¨_s@ RBiR4 5 R B \-@ '{S[ @9 #6 R'@RF5*q4T*"BCRaRR";[B*SA{Ũ_bR@3R3_qT{SSQ[BR*`@v ! 7` @**[BSA{èSA[B{è__{S_qaT  % 3R*SA{ƨ__qTs@RJ6 H%BRRRƽ4 @R*5R`!&{[Scw#$*BcRRҘ 5u*F7C*F1qT4#@*SA[BcC{˨_ %%`O`6`!8MBZ$qTj78TtqMT$S@ fqlT"_qT@!t{ _qAT  $ R7@R*01@T5@  * @{Ĩ_ 3R x { *S2k)TsJ` @{¨_sVSj{S[cks_qLT[B*SAcCkDsE{ͨ_u@*WQ!X2* 5q T` @R ` @@94_@@9?q$@zT*?qT@9!4R _@@9 5 q T`@R*`@@94_@@95q@T`@'`@@9`4_@@95#***5c@!RR_'4**u*5c@K@'@'B ***|$w4RRHRRrR9RRHRr****0&B L%.X35 qT` @` @@94W@@95&BabB&R Q5&BKB`@!?@"mT  &3!y4!!&t`4!40o$5 qmT&B%RB` @5v@@9qT7R#g@T@9@574&BB4*K!5&B[@B#@"Ta@F@4&BA K`?ր5 &`@!!&/5&BkKa7_T @B?T3 ;RC D'GK;@?WT;/R.;@ '3Re B;@ˀ sKC@s,T7@K?@ a G@CB@ !|*K5@ C$ٺ5 @*B65BT@*BqK@!40!!d7@A ((]7@*a} (a š"SRqs`@ҟ5_@#R Rg'4 0)?`@!4`@҇*&B K@5_@q@*#c\$9c ) 4*DRA`?`4&B@@*@ P*s5D!!*D`5q!T`@'7 *`@# 7 t+` @A!4.4` @!!+)5R&B LAdA#!|@B|@6?q`? {S*_qT`@b! `5 \, RqSA{¨_`@Ђ! 4*SA{¨c@ R`!!,_ q,T{S*[ck_qmT`@qT @cC$Rt=*7*+@C@ <5*~E"ET **L6s RSA[BcCkD{Ψ_qTq TXҺ5 6,Ļa@!Z!7@+@tє/@ Úc!ETżqT `4 u,a@!Z7@~w@_{[РDS*c'5HRr6ЁD?q T 7EqT`@#ߞ'@ C@9qT#@'@@9?qT#'@@9?qT# qT` @y qTe@ЄGR'*hb84#`Q$qT`Q<q)Tc\Q`<qT 7; RSA[BcC{Ȩ_? !|@7 SBh!8ha8`*"B7DD**^AТD$CDc8**E5+@g*5+@ЁDRdBs*4* P8+@iqju8@!! ?k T ( |R-R{S[_qT@SA[B{ʨ3`@!*!d>Ѹ`Qs"7RqTqT  ! R@SA[B{ʨ_Ru@qAT @ p>?t@k `@!!p? `@!!? `@!5Ra@ ?%ARS#a@R6 H!RCB2RR$R*4 '@ֶ6 ?T'@*Q*Lq{RS[v@A@@2&@5&`5@aSA[B{Ĩ_{*S[G'_qT#B !QR5*'@}Ҁ šwu <KT X @*SA[B{Ũ_ R_R__q-TC {St R[UQRc/ksRBC(R9B`?Gq T@@kJT`7A@ɶ7@#@(@59@9 gB)kT3Rq{@SA[BcCkDsEC _Q?4qTKa8`! ր@Զ@϶@ @q@ @q@ @|SqaTq q!T`*qRRm@ @qן@R @R@Rܽ @R׽@Rѽ @R̽@RŽ @Rǟ@Rҹ @RҴ@RҮ @Rҩ@R@'* @*5GA @T*õq@T qTqaTR*K9qT*BqATqd@z* R_{S[RVBxD?kT  5(@s``5SA[B{è_{S[D9  7 DRSA[B{è_*VB*qT KaTRVBB@.qjTKTD929D929`R{ e@4f`VB@V @{¨_{S[TB"|@PNK"X@|$IT \ JR@SA[B{Ĩ_~*6  =Ku@SA[B{Ĩ`RR{S[cks_@D9 6R d SA*[BcCkDsE{Ǩ_6 6R a:@? T  t:@  `D96aB@ ` `:@?ITub@5TTBDNQK  ~@ҡ!zb. R ޻wb@뼒 ךW`b@ ?kKTK**TB*R*4*K  »*`b@ kaTZR@7{<7@뼒9{vRR{[SVBG@ aG !Ta.N X"| aRN (a6N a2N h޺aFN ںbfN abNպaVN XѺazD ͺR ɺ!R źaJ@ !QafD <abD ajD paD bDLm@!!P *5 qT @@9?qT!6R!@5qj`TqT6RqTRҚj`ZR3sj(rVB"xDBkjT!5"(@A@@?kTB{R4*3R~@+ x`@@Rr?kT5ֳ! IT$?TҔ"+s)Y{|j;8{@+`!xxV4"@@?@{ @ xDkTiW){!9j;8Y [R?@!l*5 q@T @`VBxDBkT5(@`Y`5 @!!xX5qT@b!!Pq@Rغ*@"!.D*4@A"!\= 4 qaTRqaTR6RRqT@@9?qaTsRTBdDPN~  ʹqT@!!5qT @ )B@ VBLN4R P VB %"8@!#'R"aRB R1qsZJ6RRy@ @RKcC9 R)G<'y 8G9G@E@7C977@VB7&xD_kT4R p* l_1TR QqhT"PNk TqT"DNa !A5qT R|Tq ! ! ,HVB*B@۬*4*  :Z@RZ@k T@T(BVB!(xa?B!(x!dD`D hDlDcK`!Kd?qT_kAЁBKc  `dh?qT D!VB H@Q HVB**@5@"!T@5qT@Ba!,L* @1q!!"cB@RTBBBa!CD95 2!RC9`D9 3aB@`9n xR@!@5qT" @K@G@,(T@!5qT@*5@D#P@*@9@A!35qT@ @@{A[CcDkEsFSBOqaTq!TsR{D 5 3h R @{¨__qATs@KB44Zs61{DS[5l4L R*_qTSA[B{Ĩ_`@ɸa@@?`Tv @qAT`@*a@@?TLD44&R{SD5`M RiM!R5ASA{¨_*_qaT`@_D_{ `D5X5 R @{¨_8DR_qAT_{S[_qAT`@l @h@d-*`43R*:̷[B*SA{Ĩ_@@;·@{S_ qT_qaT` @:@6 @2*ܞ*5@>@@*SA{Ĩ_3R_q T{S*[#c`@5`7`@ `@qT`@qT`@RRq@T`@RK'@*oqSA[BcC{Ũ_ R_{S_ qT_qaT` @˷@Ƿ @÷ *5@ `-@|@*SA{Ĩ_3R(qHT!!H`8`!  |_q"aB    , L  ` {S3T q T q T 5 |SA{¨  4qT@X ۶qT qT5 |   ʶqTHT qTqTq`T@X qTqAT      q`TBqT5 T  4  |         uSA{¨.{S[D9qT`D9v"tD9u"w`e@d D9cD9*  y 4 p`D94 h k`D9bD9aD9q ( d`By* qiT R bFD9  Z@ [B d2D9c6D9bByaBySA{ĨO`D9%  B@SA[B{Ĩ_{S[c .`D@`D@qT`D#@'@` `D@@q T`D@  q@zTQR 8a@ R58 qRR!8558`D9b@BQ_qT Xbw"cjD9  u"xcxSa  @t+`D#^@'@`SA[BcC{Ũ_ւ@\q #Y@ ε"Bp ;`8@6 @ '@g@hqT'@c@<q T'@_@\qTt9#3@{R c"e @{Ĩ_{ RC@ @{è_@7C @@@@6?`?A4{  szqT t @{֨__{S[6cH* ks\D9 a@9 "PB"@9?zcB?{@9c cxS lN@9 4 $I@9D 3 7&@9k,TSAcC[BkDsE{Ǩ2R3@3azD9,bD9 a~D94' $bD9aD9`D9*`D9 4 aD9:ZRW`D9klTD97@?y! B?D9qT qTqT0`@9a@9 *D9 qTD9(9&@ { Fd`DO?@ @{è_@6s?hqT@o?<q T@k?\qT@?@??{S@RB4SA{è_@@sb@ab@?T`@`7s.@>@?kT?@a@7?>@?kAT!d{7 R {_p6_q,T_@{ASB_!D3{CS*`@@5 {97t^R`@!!:5RY`@!`5 qTA!1"BI {97T:?`@!5m!`@b!,}`5 qT` @ҭ*`*b`@!\3]`5q T` @ґK*, R`@҄>IkT*a@"@9_qTT_,q@T(T_qT_(qT4߳_@q`T_Lq!TsRֳ_q@THT_q@T_qTSRʳ_q3RLót4*@j@ *!24cRR R"*RbRH1TpRTRRDR`@!(5{ASB@{A*SBc@R:{kSB[*cZ*qmT@ qT @* @qT@ްq@Tq T+XR*)Ma@ऀR êr?k`T$E RSA[BcCkD{Ȩ_5x`z@9xqT!@/`~@99qCzT!@)4!5D~@4T*q TA94?q` T`/ ;  +½4*6x*R`5q-T4*5<*4x*-@49;@3?@7*h, FD7@!!z3@.7@Ri*,3@Rܙ1T@-4- R_@_{  @ H/R @{¨_?֠5/ R{ {{_{SOf@S8@*SA{ʨ_@@QKBRBX0V#@/=`*40K0F@*0?@n`* 5{HRRrRSR@S1$@*SA{è_B* 2* `@*Rƍ40 *2`@R*4000{ R R^7@x3 @{è_!!,R,43Xһ`5@{SR3]T4ñY4b @!h_q!8!R4SA{è_!!R45&҉`5@{S[R]`ST4@*SA[B{Ĩ_dY*4 @!h_q!8!R4z]Sp5q@Ҁ @q šB7Ts6Z0V{ Wk66J @{è_R6@6!!dR47`5@{ `Rr| {|@_ R_ R_ R_ R_ R_{_qS[U&T!7R A!9,a@*R q`Ta @qT! a@ҳsR0 4q!T>#E5 RSA[B{Ĩ_R4sqAT=1@ 4$8a@8 ?9|@4-@BR r?kT:L<@)Rf D@! KqT!K_kT:A)@#Rdh`! KqlT_kTP;; @< ?q@+|_{,R sSS @{¨_{=% ! c$`6@%@F (%_ _}|{! ` A@ !!`$@B@/A!!0.B@A!!&B@A !!$B@A!!&B@Aa!B@A! B@AB@A BB C@b$BB0C@b(BBkRr R3 |@R[* j@*@*R *R!*q[zTqT@9?kTq!T3@{ASB[CcDkE_֠_ *!R{Sz[*RkT*`6* %{@*SA[B _**%ܞBRߘ{! @_q@TRcRcj`~``9A6_qTRR5}x`D9`~`qTT q T@qT!\#& RRqT`RjR @{¨_ R`j@RB{CStR[*c8<W kRr R`j@*a@** *R!*qlTqT{ASB[CcDkE_{RS4<[U**qT**DRqTd@9**qTSA[B{è_a@95a@95c BR AkLT_qMT*Aa9?kTxa@9ha8! !a4a@9c5BR xqLT7{*S*6@SA{è_}Ҙ4DsQ`7:IRDA_"HOa87@@_@|@%RRCR{CS*JOӥ*h@@A *%R!2"R7*!R! ~`t@B! tl@A! lR@{ASB_{*$RARSsz q T* 6D'ɝSA{ʨ_!R'`@y{* *AR|*` 9!R2bR| RD@AT_֠@{@SA[B _ {S[*A4_9Hsz5R@7`@9 qT`@y I* 7s "kT*j!8?Tb@95b@9s j!8!RBR*{CS[cks4* 5(vBywBy4@94R{?@T()}ϗR6* 7!|@!z*RF*6bByaBy)  @9qaT4RL?@!T @9qT!?T "@9_qD@zT?ThTaTT{A*SB[CcDkEsF_ւ44Ҕt@9?qT*Ü:@9?$qTP+`J"vJD9wJD9ж**Zo-{/n9`*Byk T@94@9_q`T_q T_qAT?$qT+,&?kTl, % @9kTtnD9q T-  mҋR`ZD9*k T } R\`n9R"ҀNp~~@L!RxD999@9 71`T~@LD9!9?q$Iz`T kT-1T.~@LD9?qTxD9/9% Rҁ`G?q`TkTD01A:T0RҀ~  *) *ij8?k+T`j@Ra@RR"R * R!2d^D9*4bDa:IX1, )w"vu"RRRa:D94oa>D94iaBD94cC{CS[6#@4*82Л#@*{ASB[CC_**5u@ R*R!S!2RRRL*6D2e6{A[CSB#@Cf!R*4R_{S[D%@? qT@9`e9 @2&q`T39R9SA[B{è_%@**RbR{Ch@@h * R2cR{A_R*RR{CrD9h@@ qh * RS* {A_**R"R{Ch@@h * R2cR{A__{@%q{_*RRR{C rSh@@H * R*R*7D 7D9 qT`@9aRb@9 *A BH6!2_rAT!2a9!|Sa9*@{ASB_{c?z[5**S#* 7@y*R@!TS #@*SA[BcC{ը_*@@66?RzR}R*R[*`7*7@ys7RqTq TqssD*C**6*"Rd1T*4R*RV`qTsR {CS[cksD$zRt$`7@9R2qҀ*@7*`"v.@9BҠ@9a.9R9`>\BR`FX`*@9@9b>9|`4"@9`B9&@9`F9?qaT*@9`J9 @9> @9a.@96 *D9qT"RR`5 R`29q@ TT 5D94@SR`Rq` Tj@@RRR R * RRr* 7$qAz! TD`6`Ju6@9Rw@zS>Ik T5Rʚk"Җq R5`R>Ik Tе"R>Ik TЀN5 RЀ#z?@ TR"RRMRDR@6uJD9 qTqTj@*@RRRR * R!2m6{ASB[CcDkEsF _@D9 qT*RK*RG* P5`L`@A`^`ub;Ttj@w@A@CT?@*e6A@T@ ~;@;@ @?@@y@y`*6 6*R/(6D9 qT*R'*q6*"R;76*6*c6*BR6W7*bR R**@B*_ qT*5Gr{#{D@A4R_RR#R{C@h@@A *>R!2e2@96`@D`7>@ٓ`@Ra6@9r@!@S" *h@!*A*>@˓`@a:@9@!@S" *h@!2A*>@R@{A_тR{CSRRcy`@RR#Rrh@@A *>R!2Re2@9{l`@a6@9@!@S" *h@!*A*`@a:@9@!@S" *h@!*A*{ARSB_Cd*{CS[cks@9 @eCc@he8h@B\S(C6t6@9T<*Rr!**R>Rh@@R#RB9A *e2@9!2R7*6`@D6@h@A *!2`@{A*SB[CcDkEsFC_t:@9!2T<*F@V`@~@J@ulSv4kGRЖK`@3**>R)G*`@O)D6*f`@{@@kATR`@D'69qT['7@kTQ4*@k !T{"PRS R}R$@9#@9!(@``@`@4qaT`@465  `B@9qT@9 qRzT`*@yqZ@SA{è_`*@yqTqTR{[zSsRcRxRkYRZ@*F@9 51TV@9a29*@ya69*@yA5@46@D7@ ? SA[BcCkDsE{٨_րF@94RБ` B9RS9*A999@R9 *F@956@D@6c A95`&@<`TqmTe6A9d2A9<8bA9a@9`@9 qRz!TRqTqT*qMTe6A9d2A9H7bA9a@9Ԑ* \**7{RS[<vJ@}`R<9` B9AS`9@R`9=aR*A9@R`9"@@?vJSA[B{è_{S[cks" ! "! RD!R<*@9 9K@y@yCTW?`R*oX;P?@R|2#9@R9 B9RS9A9 9A99Z y~S9+A9@@R9#@@?4 @x o@qoTsRR[BSAcCkDsE{Ȩ_րG@Z{T{S[cks" B!!F! RD!Rw<*@9 9K@y@yCTW?`R*oX;P?@R|ː#9R9 B9RS9A9 9A99Z y~S9+A9@@R9#@@?4 @x %o@qoTsR9R@[BSAcCkDsE{Ȩ_րG@Z{T%RRCR{Ch@@H *>R2"R1{A_{S[a!*c#@9C6hb8B9*_@qTa@`:@9z9@@S * h@jR2Ahr9*N)F@ S29 B969>:9p`@s*>RR6@6&#@SA[BcC{֨_` @z`7q `@a6@9F@@!@Sh@^S5 *RrA**a:@9<*B2!*qJ@!>R@6`@D6b:@9qa6@9A7R`@Rs*>RR~@j T`@DA6a6@96Rv67@jRAhr_kTN@!Q?kAT2@9?qTF@〹T?qT{R9SRo@@589 R@SA{Ĩ_0 a@`fR_{ qT:ٕ:aNԕ`N @qßZ{¨_{S[D9@ 5**VD9 qaTD9QqTR Ңu t29J9D9`B9D9`F9qT@qAT!'=`RVVRD9_kTzD9R`5`6@9 4`:@94`F@9`5`>@9`4aB@9 xq`T?qT; !pP ;}R@SA[B{Ũ_"D9B_qT#D9b 86b69"D9B_ qT"D9B b>9"D9b9!$b:9?qaT R`*9`>@94a@9R@S?q!a9b@A@ *@h@Rr*!*a*@`9@=#B@7'@?x@ ` SR0`y RR{Ss<[zckRYRsRvJR@@$9@(@9` 9R ` B9{Fy9S`9*A9z9@R`9"@@?*4qAT=g` A9qT`2A9qaTc6A9b2A9R!*"q Tz@9:;9>R*AD@@RR*`57@d@$9V(9*7@?qT@! *5_kjTR<$`{[SD@T @SA[B{Ĩ_@_ @ Rw5@4_$@T{S[cX@ 4`@ 4w"a@9` @ @R)a@a ?`&@@Ta@@_@R@`"@ ?7a@b @>7D@AT @@ ?@_@`54@@1aT `{@SA[BcC_`@`@ R`"@ ? b&@X@_T@_T@р@`54_ @{S[c#tD@AT` u`#@SA[BcC{Ũ_ր_BѶ@7`4w`B@t Z@Z R_{S [ck*+*d\ X` 1+@SA[BcCkD{ƨ_`"{S[D@aT` @@ RSA[B{è_@_@  @_B@` @{S|@s`zt(@ ?֠4`ztSA{¨,@@"@6`6RR_2B"@B@76b6 R_! `$@a_R@"@ ? T`6 R_A"@A@7YA66"4@*C@x_{S*@"@@65s@60@1qkT@*SA{è !1Ëq@SA{è_!@{ ?{| _R_qhT{S*5BT34qTSA{¨_C@!`$a!0.B@AC@B&!!b B$C@bB&C@bB@A_qT! `(@_@"@6`6R(R_@4R_R{_@"@@6{4M qT R {S* 5?9b@94qTsqT@RY!?BM5 RSA{è_(!?BA4! ?;4!4?5q* @"_@__{ *@j @{¨_{S*7*SA{¨QSA*{¨_*{S*[*!H? 4!`?`4!|?@4RSA[B{è_ RA"@!6q@TzrTq@R7 , R{RRc&cR RR{Ψ_@"@e@"R_{SQ@?T R@RRb>Ҁjsjss"! bAT@"@@"R@SA{è_#Y"c6c6sd@T!@{S&@!,@?T!(@?TR&@SA{è_@,A( $_{uS @4@~~?ssts@? T @!ATaT @?| Tc!@AcLC`R@SA{è_֠ @˔@ @K  RA"@ H6 _@d@e@@B~aT"_cBaA @@``PC_cT @_fc!`@Tf @ R@f7!@5f_aT  Rb"@bah! 5?T!C"R |!B !x|Ӏ@ _`# _ R @E "I?'hT FBx|ӂE__AT|!R! @eC _PhT@l_PT L_PT O R_TR0@_T@~?CT @A"@AH7a{S!(@[,@ck+ +@SA[BcCkD{ƨ_֟PT^v֢IT|TC"Bx|C@@@T@ @_T@ @!~b C"@B@"@!@e T@B~C|T@d@$% h"I@TF!%x|c@` @!T*PhTlPTL!PTO!RT!R!0R@B~F|T @@$ A@!@A@_( TBC#RD|BBx|c cC_@` |"RB @TT!tB!T#*cxS## @ T@@AT?@T@"@BCT @x@~|T{z @`OCATP T_iTT @ _ T @@ "@IT "@)T DI_'HTCFcdx|_!Tc|"RB B PhTlPTCLcPTCOcCRӟTcRc0@T@c~HT @@~}TA@b C@"% h$ (@!@A " @v`_!QT|!BTe*ҵtaOC?TwO@T ˵?tT! @ ! @! TT @! @`@~|MT@ta@ `B `@c|!@``IT`BW{S|ouA"@H7R_B~B _ (T_T|_(T@|@SA{è_|_ `T|?{S[ck?P)TSA[BcCkD{Ũ_SA[BcCkD{Ũ1A"@H7?2e_\A|_~8zBѿTwB @A@T#Cc@#7!~TTA  @ @@@@TAA A@#B!@|T@Ac@@A@!@Agҥ 7t_T˃@c~ 9_T? T"р@A _ T_)T`@ `@_hTsBa@a@a @  @ @@~` @`@_ Ts`@sa_lTAA "р@A _ HT_T`@ `@_(TsBa@a@a @TA@@!A?T @~t` @`@_ Ts`@sa_"_ T_IT`@`@_TaBB"@"@!@ ` @ `@_ Ta`@ab@5 @@@@@({S[?PTB"@H7@SA[B{Ĩ@T@SA[B{Ĩ!\6|"?ւ @ԚzԚ!˿"To@SA[B{Ĩ_@ԚS@KU|@BѠ|HTa@!~! @ @@ a@!@!aIa@!~!?|MT`!@@a@!@!a;sB@R_D@#|@E>AG:Aˡ!!!@'T{ңRaR,B`R{_pF>_!R*@kLT{ @@R{__@kLT{ @y@yR{__{ *`@~`R @{¨_{ i`R @{¨_{@ ]y`R @{¨_{ *`@y``yR @{¨_@kT{ i @R{¨__{*iR{_{ S)ctRSA{¨_{StД:[R`~j`5sR@SA[B{Ĩ_sAT qT{S[*a6qT@׌@ӌ*#RR~*B(: qTR@SA[B{Ĩ_ր @Һ_@@_%*4QARq_ R_`_{[Sp@TSA[B{è_t`I`5s@{S &SA{¨_{  !#8@"8!bR @{¨_`@! R_{Rc!1ބ`R+/3;7cPR{ɨ_?~bRaRA{S3|@1T`|@? 3R RAR~*u4@*SA{è_j385R_qT{S423[*zs@Zs0j RSA[B{è_*@5skT_{ D"@`R,"q @{¨_{<C~ Rc@X@09 @c"RR?*@.{@"@`7@6|$@"@hTh@"77_{S[cSA[BcC{Ĩ_*RfuR|@RR!Tq!TK@F5@bTCBc-B B㶍c۶ABCmö!-B|{ @@Њa@̊`@ @ R{¨_@R{S*[*cksq@T R7Rk*T`@*s" R"|}B<RB|c"@XkTQ6q TR|n@a@@؃qmTZ{rs"T9#њ5Zҟk,TR*SA[BcCkDsE{ƨ_{"BQ{s:@F5"@AResa@`%@H%q$š0q*_j TЄR@RqRjT@R@RR_{cRS88[kqm T**"5QkT!h3Z Z4*SA[BcCkD{Ũ_aCz T*@{ry@@AzlT_'qT*`@R**cC*[BSAkD{ŨRSb*~@ QRK`@*j"s@T`@SkLTa@(5~}kT*h3j"44{S[cksa@[@7w!X1?@4R{@SA[BcCkDsE_*!qTQ`8 ɂ *R@9?q$IzT4{<@9a5\[<4Q{`@9?qT_qT!@!!$ښ!7%R@RR5`5BAB-! 鶍@!i۶m-!Cɶ**!| R2@5q TR R?q$IzaT9!Tq T4_qDIzTQ|Ă*C@s55R"*V 3  { qlT9?kT!| #|@!!qT@9!$k#8w@?9X nvR7@j`8%hd8kTk,T*c >RDdjc8$k#8c8 **( R`@ ( ?@><p  4qMTvK31`@ .+qTqmTC@6X*v@V34@{ 4_'qTQ|KaK?qTC@s {S*?qTQa8?qATQ`8QTqTa!(!3H8*SA{¨_%R @֟ @{s@?{¨_{S[*c*#99 kT( @`@5R#@*SA[BcC{ƨ_zss@kTa@ ,?T62e @*s*?*@ق@_@ 1T*?1Ta4{@E"R*{_*_{ScRY5@R@{¨_ R{S[|@`@95@SA[B{Ĩ_RkT@9q"B|@`5 RtqT,qT0Q =a_{`{_p_$qTA! `_xb|qTkTB_!TR R_{S[c#sw2**1ATVZE91AT\E9D 9`E9)e62 9 @y o 7PAP?qmT C9@6G)CC%#@{@SA[BcC_G)cXfE97T@!RAf9B?TVZ9U^9_f9R@y6 C9!7 @B?TPE9@?klTo@@cCyCo4Q``8(q@b9@@@?`@b@@ 6_k-Ts@s`?T_k+T6@`"a6`@`@ `@6@g@7k@7*{A@!S`UTsCs~Rs~ @#TA"@!pA"ARE9a5RAR9RT9рRyRSA{¨_ F@B!b_xyC@A a`{S (@9TVE9@7qT6 @ 6`@ 6a @ 6a@y  7 R(65!b@<9ֆSAR{¨_b@bBR ʆR!!  Q_$qT QqhT \Q_ Q!Qq 0Z{@9*1T@91T *{_*@94LqT@94{@*1T'*{_Q  $qH T@Hf8f ֥ QREf 1 T|@ & f 1T|@ & )fRK@ klT1@T%* k@ Q'REQGREf 1T|@ &  ) QgR@ 1T |@ҧR_QRQRE Q'RE1T ) &8GR*_{SҖ5@iT4?`9 RSA{¨_{5{¨_{Ss [`P96RO9RR5`!@9qT(Tq`T qT`*D`*qTbqT`.D`.qAT `&D`&5@SA[B{Ĩ_qATR`@4qRR` ``Dk T@4`P9@7`BP9aFP9Jq T`4`@99 {5`P9bD6 RYa&Hy!Z!<? k`TRc!c @9 <_kLTaJP9? kR{sSc3 [k"x!Raby9@``9|_` BR}|`"R`P9yR@`DqT`R9`9RSA[BcCkD{ƨ_ !6@94_kTc& R`9 R`R9   1 TQqLT9$`P9@{`"D`"`"B`Ba"B(TqTVRRz9*@5`BP9 5`Ba@95 @9qTDR"R @944qT @9QB_dqhTqaT!R"@9@QqhT$Ś&6$q)TFQE\Q@QqkT|@|@!CR1ATVRRR:R{Ss [*cRkRzR+`P97`D@7q T5R`P96`"B@`B3a"BT@`+@*SA[BcCkD{ƨ_֤* 5bD_qT`P9@69`BP9aRP9kaT!R`R9a9_q`T`&B b&B`P9`7tDq TaBkҕK ~@~`DK``B``DaBQ#c8hqT_q`TQ#c8hqAT Q#c8hqT4Q#`8hq!T`a*B`D! a*_T K`!Q!kTR{qT1`T1TR`DqT R`9`P9R@`R `"D`"8*R R`94`P9`61 T~`P9@ `"D`"_{ 6s `DQqTRnRlRjRhRfRdRbR` R`9 @{¨_`?6 @{¨`~ 1T!! X`_8 A*B BA! !!C!|R!|"?aT_@_kT{BABS! T @9@53sCs~Rs~ aT@ ?5 @"9@SA{è_֔@SA{è{A! STД@3sCs~Rs~ aTR@|5 @@SA{è_֔{ 0@9qT @{¨a@?q@TT?PqT T?1 T @{¨8p?q T?q`T?`qTcVba0 (QqT#"B _!TqTqATb*@9a&@9edVc N`6@94a2@9!?qTT4?qT;cVba04a/a@x*?qT`[( Xe@f@fIBR @|{¨K(@|B#|`,@JÚšdDz{SSs [V@)s TsCs~Rs~ "@9`5"9T@ ?5 @"9 "@9 @?kT֢AT@ ? 5SA[B{è_{S@a"@9TSA{è`@@b@@@SA{è@SA{è_{S*x95 @#*`?q!@SA{è_* R{ ? @aa!0@` Z`{`b!{z9R @{¨_{SR[ck{{h38cۂ*/@@9@4Ee*SA[BcCkD{ƨ_c*/@@94R*Y*`5`2@9qT`@(qT{S[ckR*+_{!#M{ 5*5 3+@*SA[BcCkD{Ϩ_֠a!0{b! { R SށL{ ! {4AR1{`{?k 8\*@6@94!(z48*3@!@9a5@* 53<4@ @9A45 @AqD@zT \@222_R_cxSa 2_!_@9 `:@9 @`*Rp*3wO@kTab@9`f@9 aj@9@`n@9 `ar@9`v@9 az@9`~@9 Ta@9`@9 a@9@`@9 `a@9`@9 a@9`@9 Ta@9`@9 a@9@`@9 `a@9`@9 a@9`@9 ZD@T{S[c?@!š"BBzBc""zATaTa@9`@9 a @9@`@9 `a@9`@9 a@9`@9 !AT@Q 5v@5wҿw4@Rv`w`BA9aFA9tNA9 `JA9 @aRA9``VA9 aZA9@`^A9 `~RSA[BcC{Ũ_A4)@р ҳa&A9@ `"A9 `*A9 @a.A9``2A9 a6A9`:A9 a>A9eT;`BA9aFA9bNA9 `JA9 @aRA9``VA9 aZA9@`^A9 `B|Ro*afA9`bA9bjA9  R"@anA9A`kT@@RR_{S!Eq Ta@!=q@SA{è_{b S[c@BA#!!z!c!˿'zqT|2 R|||R@'@kTSA[BcC{Ũ_ց~yy4`@9a@9h@9i@9 `@9 @a@9``@9 a@9`@9 a@9`@9 `@9 @a@9``@9 a@9`@9  *||`@9a@9 `@9 @a@9``@9 a@9`@9 a@9k| h|aB !d|{S*a [@!Ú# cczcc#˿qTSA[B{Ĩ_zUqaTR@@kTasQ4=vTR{S*Rv**5E!!`@` bB.`b{`a!00uA!VvqA9!xS@6!2@y"RaZaz`y\w@*SA{˨_{SR*@ q@s@*SA{è_$@kT@*4 {S[`"@94 u\qTf!3R*>@5@*#g{#Ju5#@ҳu#@`4#@ sqT@RSA[B{Ϩ_"B0#||ChckTA! @_!?@T|!{S4Д0[*R@t5s~|js1T@SA[B{Ũ_sBBqTqR#R5'@@sb'@ab@?T@k!T`@kT4@4s.@{_S[*#c*R5'@R@sb'@ab@?Tq@!q@kT@kAT @5SA[BcC{Ũ_qUzןs.@sb{[*SRR**L1T@5@"@94s4@Ra@sq[BSA{Ĩ_{ *5@0@9?qT,* @{è_3{S*R[!**L1T@5@2@9qT*zIsSA[B{Ĩ_{S*y*5*!z@5*SA{è_{S**!z**aL1B:T"z@SA{è_֠5@`2@9q @B4@B @֠_RD@{S*R*SA{¨{S@@*SA{¨{S[**R#*5'@@sb'@ab@?aTT @?kaT@kT@*SA[B{Ũ_s.@{ 5`@ @{¨$ @{¨_{c5@{¨w{¨_{ *5@* @{è @{è_{S[c[`@4@@@@)4SA[BcC{Ĩ_@?T@@):{S[,a@74@@@)w@@[BSA{Ĩ@SA[B{Ĩ_{S[ a@64@ @@)X @[BSA{èSA[B{è_D@D@D@{S*R@5@S@b@b!@T@*SA{Ĩ_@?kT@ks.@b*{L1T *|A {_R{S[*ck*sBP"@oys _1T** 7R* 5?@o222 9BxSA 2!@!R_@{ @Gb|@rA{ O  R_{ST>[ck*+@T@4* @x|kT@Ga@ ~ @Q `B|T`@`@@`+@[BSAcCkD{ƨ4+@SA[BcCkD{ƨ_zn)yvr@ ?G3a  @ {BST ?SG[Vc**w@>TSA[BcC{Ĩ_ֿ1T`@kT`@kTa@ ~`@pn @Q @{SSs>**`@kT`@kTR~)t)@SA{è_{ Ss>0r~) @{¨_{SR4@@SA{Ĩ_@@sb@dbc@TJ@!'q5Rs.@@!4@!@a֠_{6@q{_ր{* @!mq {_ր{ @` @R{¨_{S@R@SA{è_!RR5@@@b`J@SA!D#{è {S[V֖+r#H@u R@SA[B{Ũ_+  ~ #`5'@b {SH@TFs`T@SA{è_ s>@(6{Ssfs~@RCq;bSA{¨_|@ ҁ{S[cksF @*@ 5 h^`bxn|7@z `"auJ@t@77@@!t@7` @@ @c2*a@5_@@4:`@2` _= ` 7@@h@!4`@!|@2` 1` `@d@5"@@p@!4`@!|@2` ! `:@:`>7*`5@A7@@@`@2`[B*SAcCkDsE{Ǩ_ ?*4*a>@@ >`@6`@`@ 6`@`@6` @ @ @ ?*`4@ ? ?*43ttttA={S[6@@v6p@6b@SA[B{è% SA[B{è_{S@``7`@t@Z@`5`"@@ d@4b&@!t@`&a@ @`@5 @@l@4a*@r@`*`@@A`@2`*5`@ g6R*SA{¨_a@r@t%``J@ ?*@4{S@ @!7@*5@@2@* 5@@a*4!R"*@5@6R@*SA{è_ր"@@@pq TA!X+s@$@ ?*`4@x ?*`4@"@@@pqTA!X+U@@_@ @_@@_@@_@$@_@(@_{S5RFs`T*@SA{è_s>@ s{@@{@ _{S@@k@5SA{¨_ 4@_@ R_@"@#<@Ba!R__FcdaT@d @@@?kTRC_c<@@_@_`@4@_ @@@_{c@`{¨_@7c R@<@!_R@!2_{ n ``@2`R @{¨_`_(_$__ __{H@ q{_{ q{_{S*[**@ @*?F|@qT@ @*F*7@ @B'*ZA c ?~#?Tc|#T5Cxa!cZ`?aT@ @*"xSA[B{Ĩ_{S*@ @uJ@*cB**@*SA{è{S*[@ @vJ@*OB**@ @**Rc'a@***[BSA{ĨR{AT{_R{!!S4   3ݝsCs~Rs~ T@SA{è_ց@m4!*" B!! !ݝ!C!|R!|"?aT_@_kT{c8 !!!SR3DkZR+[5е*Rk TqK:.1aTZqT+@*SA[BcCkD{Ǩ_*R9?qTqB:9{S[`[BSA{èSA [B{è_{S43[ sc7k s?B_ ! $;2  sݝ{sCRs~Rs~ 7@kT77@aTLm @1!TR7`Tsz @z @z@@ m 4ZCC@ G@46 `7`r@`6G#*L1 Tq`4TEd&ң"RaRB8$Rkk@SA*[BcCkDsE{ɨ_{S[Wa R@*SA[B{Ĩ_n K 7**W *dq*@z!TR{S5H@A7`@x6> 4@SA{è_``@p@7tFрTR `7*>@@@_@@{@bBB`?@CBRҮ5A@?H@@`5A!{_֠_{R@@I{R@@E{*@@1ATR{_B"@H@"B*@@{{S@$$#$'*5Ҡzs- @@*_5sT@SA{Ũ_R_{ A"@@@!!x*6*FE B%c)RaRR* @{¨_{ R`5*5*5* @{¨ @{¨_{S@@j`SA{¨_*@@C@a@ aT_@!@?kT@{S[A@*@*@ ҽb@4!|@ Ҷ `u`BvV@@@5a*@ ?*4b@4`@a@@ @*SA[B{Ĩ_RtT t{S[*#*5'@Asb`baTT@ @a@>kT@*SA[B{Ũ_s.@{c5@@@{¨_@_{S*_}5@"@#@_Tc`*d`_aT@5SA{è_c,@!Qc`{ ?`5@"@!@?`T!`a @{è_@" @#,@B@a`!_{S@5SA{è_{S[caU|@#.*5'@AbрbaTS @k*5@)kT[B*SAcC{Ũ_֔.@{S*k*@*SA{è{ @t@6@@ @\" AB`C`T @{¨_C@B,@k_?1aT@_{S*5@# Ac`b`_T@SA{è_b@_kaTc,@_a6@_{S*5@# Ac`b`_T@SA{è_bH@kaTc,@_a@_{S5@# Ac`b`_T@SA{è_bH@_aTc,@{S*H@qT**SA{¨SA {¨_{Sk5@ Asbab?aT@a@?!T@5@SA{Ĩ_s.@5{S*@5tSA*{¨_*_{ *@ @{è{ #*@ @{è{ C*@ @{è{ T*@ @{è{ d*@ @{è{ J*@ @{è{ g*@ @{è{ ~@ @{è{@c@{¨{ ?h5a@ @{¨C @{¨_{ 5`@@ @{¨_{`@`{,R{_A@B@RA@!#_AT_!@!R{S` @!@"@4T@! @!@!@a ?֠4bEA"SA{¨_R @!@! @aR_EbCR_{  @!@!@`@R ?`4 @{¨_ @@ @ @{¨{ @!`"@@@R @{¨_! @!@!$@ ?`4 @{¨ @!@!@aR_{S@FEX҃ RaRB%R*SA{¨_@!6fE, R!07E&C R@!@a ?*q4*TE*\&C RaRB%RN*q@4TE*D& Rh*q@4TE*x&c R@6P@ 6L@6BJ*q@4*TE*x&CR@GA"@`86@hf{[SRckF9&Z%vX`aTt6E*B%cRaRRG*SA[BcCkD{Ũ_֗`@THq*@zATf@*ңRRR->@{ @!X@4B `"@@d@4;`@@!`@5 @@l@4/`@x` @{¨_{S*@6*2qAzTu@47r@rT?jTp6!p7@4 5@`@ `@x`R R ?`4@SA{è_@(@ ?_ր@{S[Rc*`FX?T*SA[BcC{Ĩ_֕@?T*1TqXz!T*>@*4{SA`J@!*c*5#@D)SA{èN{S[**cRkQ)* @;(?@9'(a@@$@aRc@'Fnq*Ta@@?nFsїzS` T`>@*B*s>@s*! T4@Q$n@(a4j"s>@s`@}8TQzSc15[k+TSA[BcCkD{Ũ_RzskB**s{S@*@`KSA{¨_{#S*[G 5**'@* ֊(@(@L(m'@@sb'@bb!@_T@SA[B{Ũ_`@*c@@@RRBma@?1`Tms.@sb{S6+(mSA{è_R3{S[cXw#fFscT#@SA[BcC{Ũ_`@y4f@5*c>@sf**{S<)[6UZm*Wm*[BSA{è!p=f4**[BSA{èSA[B{è_{S[5@!p=|fqR#*54'@@@4frf`5*3s2qT@SA[B{Ũ_RYf{+S3s[ sc=*:sCݝД s~R֒+s~ TSA[BcC{Ĩ_ց@ @lA`l+( lu@Bl{,S3s[ sck*sCݝ s~R+-s~ TSA[BcCkD{ƨ_ր @c*@ @5/@@@ -l4( /@9@b/@b@?T65-@!T4@w-l@|l.@b{-S3s54s˔n.sD|*T@SA{è_ց [l{!|| * ҇R @{¨_{S[ck+)*@7*7v+`T' 7|BT4*@*K_qT!.p@7!.k7!/fRR6@ @***'RGX`T'+@*SA[BcCkD{Ǩ_7@ZQ{C` R@R**s @k) TP!@& @B G7(T!@TTT`T_֟ T@q@Tq`T@ha?&@ha8?`9R@qTq T@hax<?@hax<`y@haxZ@qTqT@ha?@ha`@haZ@ha`@haZ|` *R{@c5!@?qTT?qT?q T? qT@c@9{¨_3@y@ @k TP!@& @B G7T!@TT TT_֟ T@q`Tq`T5`@?@h!`@9?@h!8R@qTqT 5`@y?@h!x`@y`@yZ@qTqT@5`@?@h!`@`@Z`@`@  *R{@qTTq`TqT{¨_ qT*c9*c3y{S>/[@4g`4@5@`5@SA[B{Ĩ_֠{S.`@\qT`J@SA{¨SAR{¨_{ qT@ @{¨_{SR1@4`J@.4|@SA{è_'@@`4@@`{S**@ @ 7/b?"CTsZRSA{è_֠@ R{sR@{¨_{s@{¨_{ *@ @6sa @{è_ֳ/@{SSA{è_/cT{s@{¨ _{*@ @5|@{_{**@ @U1T01AT@ {_֠{*@ @Tq{_{*@ @]4|@{_{*@ @b4|@{_{*@ @7|@{_@ @M5_{**@ @74 1T`{_֠{*@ @7|@{_{*@ @71Tq{_ր{S***@ @U* 5+`/@` `2c*SA{Ǩ_{@ @6qZ{|@_*@ @%6{{_**@ @U*@ @P;*@ @Z;{S[*cxb@@***cC***[BSAB'{Ĩ@ @UR{!X/ 7!/ 7!/6A"@! @*{¨_ց!07!@06@"@k@"!R!07!0@7!17!T1 6{** B'@ @U`7R#cB`R @{è_֠{*@ @7q{_{S*1T*SA{¨*SA{¨_{ 1C @{¨ @{¨_{!1S`!1@1ҡzs8b5*@SA{è_saTR{ @@!4@"@a@@?a@a6q @{¨_{S*`RD@`  @?kT@ k)T@sK~RSA{è_9{S!p5J@7J@!56 R`@RC!@J@S* 4*!!>X6h J@!5`7!!>5h*SA{¨_րRJ@!7>{S[`R*@5@R@sb@`b!@T[B*SA{Ĩ_`@6T @ s.@sb{SR` @kHT` @c`@a@SA{è`@t@X{ v@a`@` @||SZ` `@C @`{¨_ @{¨{S[H@RSA[B{Ĩ_֕Ж:7^7R6 5@ @2 "|S!xb$_{S@ )d@@**R7`@c@@cc7gSA{¨_ {S*[V@#4@@A6s7@?k T @!Xs6@* 6b@"*@?qSA[B{è_@@R`R{S[!! @9!hb86h*`R#@1T`@a@`@4A)K'T#@`|@#ARg`5'@a @?T~'@R@SA[B{Ũ_{S[A?#'[*5'@[@S`V @ @*SA[B{ƨ_*@}Ӣ6{z_~ B 6yB(6x_{Sla @?qTSA{¨_a@@?kT` @qlTR`@{S[c@@4@K@@`7` @@`?* 4*SA[BcC{Ĩ_փ@ @Ra|S !~Cha*@h!@@x!s{SC/#cg c"  `TfSA{̨_{ 5 @{Ĩ_ {S*[@64@*@`6@a~S ҂ @!~ s~}Cha` @h!@hs@h3RSA[B{è_*@?@4{c5@+@{è {è_{!8 5 @{¨ @{¨_{S*!D8v5@c6q@@"4@D @Dq@SAb|{¨c{bC(65@0635@SA{¨B@{TC @*SA{¨C@SA{¨_{S!l8[@* 5@3@s4@g`@T`yT`{T"@@`b|(B@`?֠4* _yT6@BS@`?7@*SA[B{Ĩ_ @@@?{c!5cҶ{è_ { *`5q@BB @{Ĩ_ Ҝ{[+@|Sc#5*|@A`@@!4@#@!@`R`4#@SA[BcC{Ũ_`?5@Ё8!P"*!`5a@#@![B!cCSA{Ũ{CS*c**B8+[R*i****+@{ASB[CcD_{c5c{è_ { @a@ @{¨_"RR{S[*c*#@94@_9c**7@~@cc@**B8sd* qTq TR#@*SA[BcC{ƨ_/@K !|@ccBB d"@*@?* 7*c/@KqRR5!|@& *B9dC{CS*[c*H@*RB8*J@q**Cן*{ASB[CcD_!@@{S*[RkT@RSA[B{Ĩ_aZs{*R{_{[c*k*S+R*k-TcV**%R*1Ts@4**+@*SA[BcCkD{ƨ_H@*{CRFR)**3R{A_{S@@cA)B87d@7`@q!Ta@| @SA{è_R{ *@@?  Ӛ_j @{¨_{S**w@  Ԛ`@4*`SAR{¨_! a{ *d@@?*$Ӛ @{¨_{S**U#@a Ԛ!*s4@A*@! RSA{¨_@! { *>@"A Ӛ`@*`R @{¨_{S1+MR`!9J@T @!9cR@SA{è_{Rc!;{¨_{S@B8 S qTSA{¨_րJ@!hS@:\4P:\5@R! R R{!`: `6B:҇ @R{¨_ց!:u@7${COqTҢQ@{A_֟q!TҠQ{{ @)f @pSq$$ *d@Sd@`bE4Q1aTR_֠pS $@8@ {S*[*@u4@@@@`?1@TSA[B{Ũ_sSO)C'"R@`?{Sf&;`J@?@RSA{Ĩ_5@?@?kBT/{S*[c*k3@ 4@ @ @`6'@:R4@klTRc x5c@{BRg@2)G#@`? 4SA[BcCkD{ɨ_֠*c\q!34c@!`  @5S2$=)!bU!C$@"|?{S[*c*k:@4@ @ ` @`6.@4@klTRC 5s@Csjt8AH 8"RC@`?* 4[B*SAcCkD{˨_ֳq T|@ sC*[@~@ [`@X\#@C"R`?*Tf{S[**#@*B;CaC[@#!;*@5'@]\)'@*'@4I9 R @@! kT#@*`5#@@*SA[B{Ǩ_s{S***R0`5@*R5@**@SA{Ĩ_{S* 5*@SA"R{è@SA{è_{S*[@64@  @RSA[B{è_*@?4{SԐR`J@!<"r!*SA{¨{S@44@@SA{¨SA@{¨_{S*[@@4@@R SA[B{è_*@?4{ @`R @{¨_{ *qT%ҥDRaRBX<R @{¨_R{{@_{S*[c**FD[5Am[9[5[5@4*SA[BcC{Ĩ_$[AO[*`4Q4R[[ [A8[A2kT@!4@!@A{RCR!Ss*qT73*!@*SA{ƨ_!tk*5RR"R#!*!X+^qBR{"RSH@!<5`)J@!'/1T%ҥYRaRBX<RSA{¨_`R{ `J@ @{¨ @R{¨_{ PRRRIRHRܡr R$!R|*F ?k SziTg**c  qTB_ qT? @R@sr},.[* @{¨_{S**@@RAsr!!`)RSA{¨_{S*[}* 7}R @?36 [@?`S"S*k2*@SA[B{Ĩ_ZqAT@?`S!S*2*{_rS*[RRW? R*5?w?v **@SA[B{Ĩ@SA[B{Ĩ_{S[?* Rs }5}Rs @?qTZq!T @?RSq@r*SA[B{è_{S*+@bS@B2R**5?R * R{*`5@?*@*SA{è_{S[ @0@9@?տĉyZ*%*?մ?@RTsr *vR)RSA[B{è_{  a@5@!x  @R{¨_{S`@@ @@Bh=I1` R@ @B=@B1`29ԐRJ@!<"r`RSA{¨_`{S*[ @?@?տ?ĉ#Z?v?u?*[BSA{èN{S*[cksR:YqBzLTqTsbY@!Q!|@#qTz@)x@\u @v @t@` 6@?Հ5*?qT*SR*Rs59Q?1TRBS*B2*Qs51AT*q[B*SAcCkDsE{Ȩ_C@cha8!8y8?? *R*RqT Rs2? **5@?ՠ9 RR@?Հ5*j*SR*R4 R5KqT*qs:Q?qMTz8?? *R*b*@8?? *RW*{S[ck@ J@!!+8  ` @ R !?J@'B!,W` 4!!4bW5 @2SAR[BcCkD{ƨ_րJ@!& J@c![@?<q0q`@TJ@s!x?255[@5xa_@B?^@ ! $7cs5[@5xas"B ]cs R{SH@R@SA{Ĩ_ 5{S Rm5@@sb@dbc@aT@ :@AW 5R@SA{Ĩ_s.@@B4@B@b֠_{ @?qT @{¨? q @{¨_@!4@!@a֠_֠_{@Kq {_{S*@qT qT7q T*SA{¨>SA{¨_֠{ @` @R{¨_{ DR @R{¨!!hV{S*[4sQ1!TSA[B{è_{ +A4a@`>@! @ !<!*!2+҇`5/@a> @{Ĩ_{ }X+u*`5W* @{Ĩ_{S? qT T4!Q?qTX@P@*s Ԛ RSA{¨_!Q? qTT@\@!3`@{!RrS[Ҷck4@yC!<S9*5zRCcRcCz*5 @)Z aJBZqTqT?q`RCR` bN6`6@2`6a @ R?kT8RzRrR{S5@Z`6qaT@Z6`6@2`6[B*SAcCkD{ܨ_@R r R*(A_jTR0{ R* @{¨_!Rz*qd@zT*\0qT! X`_րp{R ҡ@y!<S+`5/@a @{Ĩ_{B!_qS AzcA9@R?q3|>Rs4A9A43|c\Sb@*B2cR#K5V}R!Rb~qAzATs~@5?@87!?$qT VVCT @SA{ƨ_ր}R{"|S*!R[1TR6r@5?@@6 ?8q!TjTҥ)RaRBR6SA[B{Ĩ_uQqT}*V*qlTҥ@C+RaRBR @5{Ң BRC;{è_R_{R@7!R?@R!C {è_֡R{S[ck+ @4@.@947@iTBcCRaRR+@SA[BcCkD{ʨ_a@5*R;R?a@4b@7_qDk) |S){`5TR`4ҥ`=RaRBR* T`@|TR{Ң@R+c;{Ũ_@khTR_ {Ssz@ 5B9`B9?k`T vC9`vC9?kaTC9`C9?kTC9`C9?kaTaRR҈U5R{@SA _ {S*?qTiT QqHT#R!R5szqaTsz5`B9q`A{@SA _R тR{S[@! ?kTsz*5@@ҡ@T`C9 q(T!8 x`?R rkT@4aր!wӁVៀRrkiT`C99`C9anB9QB!_pqR9bB99`C9B7`4bB9964bB9b6brB99bB9oӅfvRBoӀ `F_8@9D@ _8 +`@z4dC9|bvC9B|BmӢ Tv4b6B9`:B9cB\S@@@ b2B9q bC9B|`vC9|bwB*mӂ`B96`rB9@AT4#R* *5 R`9`C9TS@44`րwӀV`C9avC9|TS`B99`C9DӀ9R{@*SA[B _`B97Z@8J$E @u#RB *N5B !RI?qTB {S[*Rc78A9 !Rcpc*2*4qTqS:T**,9*SA[BcC{Ĩ_ {S[cks_qHT@Rar RarkT҃RaRBR/s{@*SA[BcCkDsE _փA9{7ҥ#R@5ҥ$ÐR@*zx4 X5@ 4BÑRaRR@*@5[S*2|}hbD4ҥRaRBRRR${ "4 B@6"R B b*[!T47ҥLR<*5zB9~B9\S@ vB9 kT*ҥ#RaRBR"@9B96@2V?R$R *!@!6# e@*c! ~6qATk TB97 j*nB96ҥ cRaRBR\z4B97#R* S@5 R9C9TSRpSQ!R'oE*5o@qTrSQ!R'95qTR*R#@*!Rc$,`5#cqT9nqT*b !R`5_q@TB9kT#R* ** !R *`4*D7@B B)ka?k! 9(_{S[c#@`5`~@b6a!P `~@b"a! *R`* R`9`@RqAzT`:@h`:`@1*4#@*SA[BcC{Ǩ_5ҊS`@!`5*5`~@`z R`&"RRh*5=,9RSA5R`@ @ r@R[RCW5sA9qaT@R` 85}R8YRC+[@5`@+b @ @_k 2 C[5_@7qT}8Sb @AR_k`T!Ra `>x^`yR1TRq*5`>@ 7RT ҔS R`9 V7eb BsRaRRm o*m{"Rr @!@!*85!5eҥl yRbaRBRQ@ @{¨_R$@5!Ra9{S[cks|@``@;5җR`C94`C99`5@"RCT53` R`@y<S`ҠC)5` @`6Ay`y C`@y<S5Q)b )e @RR)a )kTCtZ qT_raTqTqT@R#rc ECcB@dVf @che8Х@1q"xb0LeFb|#Rb )LPb c d@cc4S@A*R!_q A|@ n|` @RBbkIT`4`B@1 T<SCC`@y<S 57R`9w@5,@9J*>5` @)6e53yvF) j9ATe RbaRBR`A `4SA[BcCkDsE{Ԩ_a>@9a7 Q!R 5a>@7Q8T RR!x^` Ra`y3q!TRiRf@RCrdcRb$SxA*!DO{@"jaT"Ҁ@Uk{ j TRkTRkTRk@$ؚ 6`@yҼc<S@5qcxS5*@5RkTRkTRk`&a @ R?kT@`" 5a~@R5RRRR@4qT8RSRzr*R{5@ kTa~@azR"Җ0qT!1q!X`azR`ң`@yRS<S5zRcR{S 5ҡz`!Zz @aT @ @`@`!@!TRR*SA{è_<*@4@RaR@Rq@,@`{{@!{{@|@@!4@! @a֠_|@@c4@c@c֠_@!4@!@a_|@|@@!4@!@a֠_|@@!4@!@a֠_|@@!4@! @aR_|@@!4@!@aR_|@@!4@!@aR_@6{7@{__{S[|@`@4@&@#[BSA{è@SA[B@{è_{S|@`@4@@#@SA{è@SA{è_{S*S,@9kT`A9qT*T*`5@)/@*SA{è_Rs{* *@ R 4*`T @{è_@%{@ R{| _{Rc|@@@{¨_{@ RS@5@R@sb@ab@?TSA{è_cC90A4 s.@sb{#[u2 S3Rc@ R'@ `( =TSA[BcC{Ũ_B5*2T*q`Tk@@4 @shs6?qs@@@`HT`dT#R{S[ck+G@*o@+@SA[BcCkD{Ȩ_ւ.@9*@ R@7a@* BcBbB9b 7Kcc`cBSRҺ"Ta @6`@4*B 딒b@5b@|a6;RRkR )5ck53k5}Rw 4ҩPT`@*B cT š|RaR`9R{S[cks@*.@9*@ RM7a@@5z{Z[{`@@딒 @)T @cSSA[BcCkDsE{ʨ_Tb@7``@_q)|@RsR)u*`4ASTCi4``5S}R*5`@|9TC@C_C@C_ D@@$hTE @C)F(@B@_qkBT(@B4c$š!$šcKc|c@&˿_@c!R!||ha4h!!R9_"||!hb`4 @_{#@* ca||ha_qB{_R@||`h` 5*B||e$Rdh"d9_B_aT`{s`{¨_a! P9@6?9_{ r* 5eB@d*!TXAc4@*`R @*{¨_*C{ @`ZA`ZR @{¨_ ?4{ ?1aTR`ST@@!7`FAT @4|@ @{¨_{SR[vbғ5@4|@@SA[B{Ũ_ր@9'qT#w@'@a@Ta@K5`B@nw`@ @~K`4.R@XABQX6{ac#!BpR`\R`M@a_&@@(T%@˿T@P6$ R 9R_8@֠A{S@T#TRSA{ƨ_@@F?@7a^@4a6@?kTL@+`?@_֠`A{ @#TcTD@eP@@CP6bP@+`?@a @{ƨ_ @{ƨ֠_֠R{S__k5N@*B@e@@   `?ր7^@46@?k*SA{¨_@A@ ?*__@P6{= 5#Q@%E@e@  {  {A@ @ ֠_֠{_t@f@#T˿T _֠R{ @5ac+!6R`\)Q`L`RRR@@7`B`Z`6@`5`^@`6`@*4"ZZ_a@`&*4C!Z!Z!"R@ QB a)a@BQb2! TR @{¨_RRb@q Az Ta@`P R@T@֠_R@$A@T@P6 _֠{Stb-SA{¨_{S[c*#R J@RJ`Kqd@zTkhTb|@I*5@Ij88#@*SA[BcC{Ũ_Iccc3{St~[@"@@ 86޲s R7@` R7@ vuwF FyFwIIB69B66RRR| qlT'a!d"ҒI5'@$'wC:'@@94aRI '@I'@ARI'@HT` `#P`< PRQWss.@Rv1TF D7Bv97FMI 5FII5@RSA[B{Ȩ_ց@?T(@6@`O9B@*q 4TRvRqT`*HJ38'@@6'b`@)TR5W`@TO'a@`?T#4a@`O`7Z6G@47@7@G@<a@`?T6a@`O`B@i5R;V<@B@`@@\@@X@@T@VD@!VH@!@TC@C@#TVP@!֠_@d@@h@{S @@ @8@@?4a@?T@!aa@@!aSA{¨_Vp@!Vt@!Vx@!@l@ V|@! V@!{  V@!@?ր5a*A!a* @{¨_֠__{SR[c@'H'@@9?qTa'` '@@9?qT#R'O` '@@9?q!T!R'@`>N@(`NR@`Rb@ `bZ@`Zf@`fj@`j^@``^V@`Vn@`nr@`rv@0`vz@`z~@`~@``@`a@`:t @!a!ATu&@4.@jAT !Tu@_Tb@ @`@!a@T`!@HMS&`a@Tcc`p"@@8Mb@_qm Tc@e@R6@&|*hfTA4QRd@_kT%@T$5a`c#!# $ZRMa@P6b&@`@b4b.@@ 4!xa`$@ Ma@P6b&@`@"4b.@@ 4!xa`%@L*@`*Z@`Z^@`^6@`6@"!_kT%@kITe!`@`b@š`b@š`a@4`*A`*`@`@T@!"_aTR_"XA5!@! R{S[Rck+ @3G3@@9q@zTR~ MRҿkT@@9?qaTR  57@`&L`+@SA[BcCkD{ɨ_w5` @AT{ d@{T@` @d@*@!Tšs`'cL*@Z`{SR[*RkT[BSA{èp~6`j`l{S[cR#y9?(@sw@uT#@*SA[BcC{Ũ_a@`?`Tk*@6a@*#L@*@ *~`@97{[*cS#RklTR^@T#@SA[BcC{Ũ_@A`@c@b{S[c@ @ RSA[BcC{Ǩ_H@a!(`6a!(4x+')7`6R9T#@@#K'! E'a!4#@[S*@(*c7#@T@Yma!(@a @_@5@F@?_?@zT{S|@*@6*a!\)x4@6 9Kt*A`@"F@(@ O?1T@RSA{è__@F_@M5!R &_a{"@,AC $@o*ATac@$!x)R`\1K`F5ac@$!x)R`\%K`FHB@6GB6XB7ac@$!x)R`\K`F7ac@$!x)R`\K`F%@4ac@$!x)‚R`\J`F4! @kTac@$!x)R`\J`Fp6ac@$!x)"R`\J`FdB868A$Ě|S`|G4 !R! ?kTac@$!x)R`\J`vF@{__{S[cksV@>O1Tu@dBR&`ZB6aB){:RkTRSA[BcCkDsE{ʨ_lBkTu:A`fB&t| ~@{#@6ac8,!x)b=R`\J`4F`@c?_ 41`T(1aT@ D5`@9kT`fB@#{ 7~SbFC!|@cR` Cha8*@h!8`*A`*{S[6Rcks*@@9 "Q3s~s~@a6@! H ^BB|@RR&RT s*SA[BcCkDsE{Ȩ_RfB 7|@!"`4B ˔B o!o@&RgR6(1`T1!T*RJR@|@"Ts˔R k`8R`) ߂ kTA FC S!|)|@a84kT@!c*i)8.A. Zq-TB a* c*!cqci)8*A*{S[c#B@861*RR`nBklTR?qVzT`:AafB$ 5afBc:A*@c$f4#@SA[BcC{Ũ_@dBR#@[Bc$šcCSA{Ũ@S{sS[ck@p@9a@qcRA@?ovgB86a;A6$֚1TaoBR@ *g8~;*8a@6$֚!Rku@1TA 6g@Q @*RkTeҥ)VRbaRBx)R`SA[BcCkDsE{ب_g@4RhGC|c8Sc(C7c_BtgBK?@ chukTB B99 k9?q@TT?qT? qT?#qTRRRko9~@b_Bc9g9 o"šp6agB"@ @ |@o6S@?T`_Ba@@'|a@c`!sm`7 L_Tc_B*RB|@*ÚK )`#Bo@`@@o@@@6;@o@@@9@@ a 8aR)KRkK T RB`gB!R* |@7@`{?na@\g@! g;@!;7k5@kKTR_RRk9R**RyRkR RbRk}f@*` #6@! Hc R#B@B`@RB'šBhzBo @@ ` L)bGC $|!SBd8cB(B@(! hb8!|@  B dja8" bj!8{S[cHCLCDCfB!R@! ^B (R|@3;@@ a86jB**|@ @@9B@9@@9!@9@ h6**`7W@h6**T*SA[BcC{Ĩ_s{S[c#dB @86`:AunB$ךRҿklT#@SA[BcC{Ũ_`@5R$ך@@Txx?1Tb^BCR`fBdFCK!(%|&Sc e8(*%8@qT@4`fB!|@! z9 @ 6@! !KRRHR*fFC|SBg8e(!c*'8q*@  k T$4@4QafB|@ {S[@6@@6BSA[B{Ǩ_`@3'[`@41`T(1T`@a@ B ˵B {S[cks\BdB Ko@@ 6e@$Q86`:AynB$Q ><ҀQ?kTSA[BcCkDsE{Ǩ_:R9R*k<8Rz<@afBkTc@~@B @@6A5A9"z<@@7`:AafB$ ` @a7a@ J`8`k<8 {S[cksXB6aJC6``J?`NvRCR9`t[B*SAcCkDsE{Ȩ_`JJN`ZBx 2aB aVB!A!!`vR`@afBxJC!wNC$R|@9`F`a:C!4(* 4EB*Bx)CRaRR`FCF`fB!b@! `^B (R|@9@(6@6c@`^BB @@a7a@ J`8C9W@@6c@`^BB @@a7a@ J`8B9yJCzNC @86`nBRoo@k TplRs R!@";t@?yB@`Zk`~@@_1T1`T<Rk@*G(1aT@B_@9{ {1T B@@9B@@9kT<@6R#KqT\R_1TO6`ZBP7k@ !R@9@@9|R!T @@9B@9"k  @9B9Y$1?1T|R1T:|6 @ h6k@s*`76@@`o6k@g*`6.<Rt*d Rk@;{(1;@{@T@9dBDC!(š"|!Sb8(q_dBDC!(Ú#|!Sc8(rTqT_qxS_R RdB$RDC"(šE|BS|@ he8B*h%8XBB6VR_{S[c#RTT@ss*#@SA[BcC{Ũ_@IT@Q*!5@9R{S[cks!@@@QT`|E7 Ri?Re?@u@ѵ 0`7`@ 4KFC@VBFxVyz9# Z7Ҝ T`@` 4R `@ a@@?T` @SA[BcCkDsE{ը_`@ 5@\*qT`@`5_q`@ a!H!`/E`@@5@@T`"E *4E`@4BJqIT@k R*4@`@`5~~@ kT@*D`@4@@ D*@( D{S[@@ >W3a@75*5@@3@?*5@'@7@?*3@qs[B*SA{Ǩ_s{S[ck@/' TRqs[B*SAcCkD{ƨ_@Kc_kB/q*YzT/@>* 5/@s{S[c*ks3X@CB)QT@8 bD[B*SAcCkDsE{Ǩ_֢@s3@a1T@ 3@?T@S|  *4YZ@9 @{Q;{Q 4/D@@[*6@5@g*s5R*@@ D[{7>*457@J*tS4*@@ C@ˠ˷{S[ckV@+@BQ_ T@8 CSCs+@a1T@ C+@?T@St[B*SAcCkD{ƨ_4XA@3QK!A@s4K!C@@@*qd@zaTR*@4C*Bc_B/q*Yz@T*@4~C@ˠ/@˔\RRR&h`8hf8J06cJ&JTa|! @*a%* A*D!*`|SF*2E9 @*f`*fS!*S*fS!**fS*c SSc`A9*Sc*** *@9R_D@9`@9f@9JD@9g@9B@9JJ**4FJ RB |S_k!T@Jb _TqTGJ RB _kTpSBtSCC*b B*B*xScc*`@***|SB CCC*"Rc*B #h`8BJ"h 8 R_<S *R*5?qT |SA R@@@9?_@@y<?_@@y<?_{"R@9`?{¨_{!BR@?y{`?{¨_*@AT_$h`8d9*@AT_d@9$h 8B|@AT_$x`xdyB|@AT_d@y$x x{S*$AaBB4XEy6A9B9"R99?@5c&A*bBSA{èRSA{è_{#RS[cksR%C:B78CZ;E5E8E?c@55RaE?kT|E{@R<5SA*[BcCkDsE{Ǩ_d C<Q?֜ F!bBA`Aha8! 8dC5"5?6&A&Q "A_kZ#! "{S[ckRs8Bo;8C7܅4E@`*@`.@VB``6a6@H7`:@@`@`"@%ҥiR"aRB@RۧSA{¨_րVB@7Rp҈":@4@!Eb@bq T@_q TT_ qT_@q T"nRcd,:C@`_qTB BbAB;q TT 5P'Ba)` `27b>B` B`'B8q TqT qTRcd,`"@`&@``@BpRcd,}`2@`2`2@ `2`>@``>`*@P'`*`.@`.`J@7`J`N@`N`6@07`6`:@`@`"@`:b"@`2@b&@bb@`B Tb>@`_TbtRcd,6/`2`>@ `>`*@"`*`.@P`.`J@`J`N@`N`@?kT`@5vRcd, RB` )B07` .`>P'B` 7B` `@`5 R``R` R``F@``J@`F`B@``N@`B"d@c@"`|b ?k`TƒRcd,BzRcd,"@B " CJC5R`@|`VB"J9H7qT_q TT_q T2A"$~EBx_qT^B_$qmT2V,KӿqRR@TS@:)RB9BP )R1 ` B*v6@`@ )4R_ q`T_@qTBR22 |S6 J9?qTXB!2XR_{ `RF94a@@?(T`@qTaNF9@R!S ` @{¨_XB J9"2!2q!XR_A?qAT J9?qTLF9R"#|Se " BB*_ q THT_qT_qR8RB!caA*?q(TBRA __q T_qPRRRRR? q"RB R!?, TR)@R_֠ _{S J9qT`ZB2`Z`B4`ZEy`6tB !!&'`4!!!'4!!'`5p1!=` =! 2` RSA{¨_{CS[ckRs@@?{dA R9R?5 ܚb_b;]TdA{R?*4`@"%ДB@qc&@ @!!3!cRaRb@@?{A*SB[CcDkEsF_ր˹?a 9*4b5Z{a@%"Х$Ba(@R'@aR@ @u'&LxRaRRq!!3'!&LxcRRaR%RuRs{"RcAc9g9k9o9?{¨_BA4 M9$M9A *4`M9!= @? qTXB!2XR_@?qTTB!2TXB J9"2!2q!XR_{SAqa T`"J9q T`VF94tNF9R~S `B*qTTqT qTqT 8,R`@RT* ``RF9DqHT@Ray!R `y@SA{è_qTqTPR6R@R2RR@RRayqTqRRR@SA{è3 J9?qTXB!2XR_{ &`Aq-Tb"J9_qT`VF9@Rq!T`R97`@hD`ayR ayq Tq@TqTby @{¨_րR`y },yRqB! 0_֢5qhTc|@!{a k&`B4bL9`L9@ HRr| cL9`L9` |cL9`L9` |bL9`L9@ *}R| @R{¨_֠_ր_{S@@`?փ@Bb@`?RSA{¨_{S[c#!XC3dCa~@ 4!Raz*ARRR?bQ)`@~@a@?kT`@?kBT`@@b@!|`?aQ)@b@|B!`?b@`@@B@|BQ6!`?Rz#@SA[BcC{Ũ_b@@A|`?b@@B@|!`?b@@B@|BQ!`?`A%C&8C$|*#R4XCdCF)?kT$@#0@Ha8_RXCdCA0@!7@4@?kT@$@Hax!A0_R_{S*[|@`4z@ 4@!TSA[B{è_"@j T&*@@?6s"Q@!"qT&IT@%"B@`@IRaR@@SA[B{è'&LxIRaRR"@z p C,@")t@ ?qTT?xr`T?@qATx@b5"Rt?@q$@z_?q)Ta@b@B 4$@R,%{C|@SXCdCNF)sK"s&@b~@`@ :%2@ 2SA{¨_{SaXCC|@4dCNF)sK"s&@b~@a@!$%2@ 2SA{¨_{S[c**@!XC@5dC`?փ@Bb@`?֠@1Tv@4`"A@ `"@SAcC[B{Ĩ_ 1!T~@4C**?ւBa@Rc@҆EqT`&A`&Ta"A! a"@?k! )a@?aTj`8_q T{SdC!S)}Rj@*r@J$KJKRB.@R:@R@@Bc|)q) Bc!J  ĉRHƚ}|||B|ƚ| |ƚ|!ƚ kЋBƚ kЋcƚ? k!Ћ\SJ ƚ_ kBЋ,* k * ƚcЋ_ kc<SJыbL*RB *!*||Bƚƚ_kBЃkуRk*Ѓ@@*a)?b@A?a@ @SA{è_t@|@@C4!24? @#RC(@"xB2q! !!2? @RC? @_? @_!x4? @_({Sp@`5 RR $`@@?` 6Aa6aan@!Q?qTb~@PP_q!b@_kB a)r Tbz@a@`j4t@b@4  qT!5`@5`G)b@ ! `)R`j?`@R@SA{è_RR!R*c&@R`>@b@cB Tdxa!Db@ c*@|SaB@Bc@Tdxa!D44Ra&@B `>@!`z@`5b@"4a*@B `B@B|S!jTR5RajjT!R4Raj?a@ 6@Ra@`j?`@Ha@?`@Ha@?`@H`n@QqTa@?`@Hu4 R`*4 R`.{S[XCdC`@4$*`@@?`4H`.@5# T@%"DB@ñRaR@@ RSA[B{è_'&LxñRaRREqDzT`@qR{CS[cksR[`"R!J@! *qT%"B܀RaRRPN{A*SB[CcDkEsF_րJ@!!`n@6J@!!h`6 RJ@R!!R!J@!du @q T nbBcP0 7 A)Jqk11`n`bҭ @k TR`:RҺ`& `@@?,2?a@ |qaT!!4@TAR1@ RrARB*`b:?@+ sC`CGy! TB 2 (  T$,X@!V"%Bt@#RaR@@jv'&Lx#RaRR?@*xxC@@TxrY[C;gCw@@ 4`@@?hHx R@R!a`@?q0*``@@?``@ @?``o@QqT?`@(!Rj* 5@5!B&gC4!A!h?q*T'ARRK?!@ ?"@w@?SK@w@ *Rb|hb_kTc$AT @"%B `$@#>RaR@@G@@"%Bp!% @ȀR@aR&@VR@q@0*` gCp@ 6,@a@?qA0*R@IT@@"%as@B` '&LxңƀRRR@@"%B#.@cR@R@ @ @kLTs@SqvARRR? A@?ր6 @ңƀR@R&@ @wc|@)gCc j@+ *+IH }RBL@)A @|}!|˚!˚ ˚ kЍ? k!Ѝ!\S ,*A@!|!˚? k!Ѝ *@@|˚ kЍ kэ=SM*L@} ˚ kэR *R!*@@|˚ kЌLC)}B} ˚B˚ kэ_ kmSBЍA**!)?" @A?! @J `@@q T@2 WB2 Ww@@@q l*@[BAR*@[G@@K@O@@ 4@ 4<B<*a5@R RqF@aARAICa@?q` T!Rc :!g@g4kA Tj@ k T~{6.B)j/).C)j/)A)ajO@c_!aa@a 4a@0q@R!! _kAT 5a@"%B!!@)@ cÀR&@ @'@aR-'&Lx#>RaRR4!ZRKl@? qaT qЁ}@(T1'&LxȀRaR@EyBEy!6!a@?q!TRc@R'LcÀRaRR &xA@`@?k T`o@QqT9@?q `'@ޕA@@@ `;R`'A@`+@@A_B$@@ @5`s`,@@Fq`@<*a@\Bq 8*`A@? q`*`5*qs@ *s@@"%B" @ң΀RaR@@'&Lxң΀RaRR'&LxcRRRv;p@c<q%,@S'F%F S?qT T?@qTLT4?@qT%"($B{C @ @R@aR@ @a{AR_?qT?qT"R4R"r*?qTT?@qT?@q!TR_?qTRr*4*0?@qT&@ 0@@@k"T@x@4t*Rr*@ @ "@_kCT\Pӟrc@*B)S)*@_kT B*Tcc *)?q_֥t*Rr*@B 0@#@kT\SR)#@kITt*2* 2 R_փ\Pӟr<Sc$@#@$@ф ҟ@Tchc8q`T@@@kTS)@(@kITt*CSR*@B @k!TRhrb*|)*RŠr*RRc$r*4 )R4Rc" r* )R RbIr*)'&LxRRaR7{S*[*ck*+XCdCa@a6ARV Far@?k@Ta@`r?`@a@?`@ BqTqR*:R.zzj*****5z.j+@SA[BcCkD{ƨ_ֵR*ҵ*`@@?`4`*@ 5 T@%"$B@RaR@@+@SA[BcCkD{ƨ5'LxRaRRzr`TBqTb@a@@`kTBqTR_kTBq FzTBq@zT!QRk{S*[*c*XCdCa@a6ART Far@?k@Ta@`r?`@a@?`@ *8Rkxj***Rc4xiC*`@@?`4`*@58 T@$B@cRaR@@SA[BcC{ĨŜLxcRaRRjSA[BcC{Ĩ_{ Rc!@/qS:T*@ %BңR@aRR{¨_R_{ @4@@?*`6*B('RaRR* @{¨_{ @4@@?*`6*B('ңRaRRr* @{¨_{ @c4@c@`?*`6*B('CRaRR[* @{¨_{*[***B'S**#'****]5@@\SA[B{ƨ_{ L]5@!@a @{è_{S*@D@*?@SA{Ĩ_{S3-PTS8(#@*SA{è_\*5*5*\{{{S*@4` @5*  R:@W@?@SA{ɨ_֠{S*@@*?*`6*B(҃RaRR@*SA{Ĩ_{S˭6*`5A*SA{¨_{#RRA?@7@9{¨_ARRARҁR{S[@R@SA[B{Ĩ_ A?q 4KT s @%{S[*cF9lCy`R`9@ R`ny4Rx9wnySA[BcC{Ĩ_d A*? 4|@ T7 @@dR_"L"#@kaT @_! ?!T{S[*R** @*SA[B{Ĩ_u{SR 9`@]6RSA{¨_a@ ?iT`A`R"9`@] 7C|S#9# @9*c4H#$9#`@9c4H$d9$(@D4"9b6"@9cS#`9B2"9"h@9B2"h9"(@9B2"(9"@9B2"9"@yAq@T"*q *@R 9"y_@{AR!rkTF9F9"*9 R9c)'f6@RCC'@c]@7C@9{Ũ_RR{S[T`@B/1@҃qRaR@@{ a*A ?@6@SA[B{Ȩ_ֲ@7aAa(6r TdARR?ր *6eAR!rkTaF9`F9"*9 RC9# )?be6@Rs?`@#C]7A9r T`@/u(6P/@҃jR@@aR/6`@0@@#kRaR@@"dAR RRRLx҃jRaRRL0@jR@LxjRLx#kRaRRq 4R}5RLx҃qRaRRj{S[cks7B @aA7@*4b_T!Q k@sˠ: s3`A*6 @`6`ARq6ZQs8*zB:6h38seA?s 4|@Ӛ |dA?*SA[BcCkDsE{Ǩ_@HTsR{SdACR!R? 75SA{¨SA{¨_{ 6 @{è_`6R2979 5qT7{ @79@R9 @{è_֠{S[cks6@@ ` @*~@:~S@R@9R95RR3 5 4*qR9SA[BcCkDsE{ʨ_ֽ5q*7@A@8ATA7O @[*@5 @37@ K!TA7R~ J*46R*9OF9yF99?A@?*@[*5@s*R{!"R*;yAR)cc9A'F5?@c'[{Ũ_{!"R;y!R)cc9A''@[{Ũ_{S R/bF9AR9`F9[y9OSqT`"G9@69bA`@[4|@SA{ƨ_S@S`@][|@S@q {S"R[F9A!R9F9{yF99*C9_c7VGA9|(CE6S@C9u c@[4|@SA[B{Ǩ_ր@%[5'@c@'7@7{S໛R+[rcR7kt@93bAZ2 `Q _z*$՚6"՚*7 O}`eka8@@9@9yaR9AR99B9 cA|h(CS9@48 *ҡ7L"RO}`aka89@yaR9AR)@48 qT>r!T+@SA[BcCkD{ʨ_ZRK&ҁ!3 s7`O rh@9a9@d`@9d@9 `9TZK!2 `7`O `B9a9a@@`5a9@a"@9?qT@6Rau9qTqT`o@`"RR_ RC{S[cks@C! R!r!! !  ! !! 6|@@TsR  Ra@`*@y|{`.@y`@7A!22`@@H@[7AxAbR+9" R 2"ry6R#ycRK9b@b(6 R *RCyaR9A R!r'a@A06Rya R 9 R2!rGa@A6Ry9!R2!rga@!6RyaR2 9R!rBR2! R#9!r9R!rb@062! @RC9`"@9q TqT@=;b:@9"5s`@`@CG9GG92KG9B/@ aRŀR@@ @ {BSC[DcEkFsG _C`"5sdssLxRaR ŀR0d59a@ 0T4h7CuCRd 5@`ʈRr?kTWB9q!TcB9B9 *RkaTkB9qT[B9t4}R'R *4`@B/03 @ңsRaR@@[Y@49`@@@?`@@@?`@``@t B<)!8@t`@``R`9@`!4R`{@` `;`{`@86`A2``@H6`A2``@`6`A2``@p6`A2``@RR`@```@7C@ @X6Axc@6tA477`F95`2@y =4`9 q<Tq)6T<LxңsRaRR[B9cRN!?!T@9?#q T@9@99~ R\S@*@9*?C* "*5@@qTAqT5`R`9`9@*a 6`?HT Ɛ3cgksCR@)A{b@j T `qT!$R @){`$r Tc@\RaRB(7zRC@1aTz@Cs\@kaT D?:@=B(7#TRaRR@ZR a~@c Zc39!` \S"|SB*"|SA`*R*`#9<Sa'9\SX`/9`<S`79`\ScXa+9`;9*c?9 *7**Ԇ35@@A@@@ _R{S[ckss `|{B*SC[DcEkFsG_ `9gCcGRo J`ZRQ ``^RK _|`DajR@`*Nk Ta:@@ _@4B@* zJ)R a*N7KRqJ@@>4<,f:@*7cRaRR aҥ RaRRY@T@^E9?a8T q(T( *RGJ@k8Tf:@ ㈀RaRR:|*s*q˘TTV@V%*R@*$7q@T@ T 5%@ @9q T R;f:@@cmRaRB(7R KqM Tq`T;f:@8?#lRaRB(7R9N@RN***4|N@%RN<R @9"$@96<@9  (@9@@",@9` 0@9@"4@9 8@9@{@MTf:@;8B(7#oRaRR`D' `@9"d@97l@9  h@9@@``^D Z@5w^4`^DkT ;ҥf:@qRaRB(7R*<R`%*R@_*7 qT Tq`TqT%R***#5W5B@B@nMTnjTjC*qTqT;f:@ң{RgqTZ@ZW5`%bRR@K`BGaBG*dRNcVN*q T(1Tq5`BGbRN!'57f:@*7bRaRR 2f:@#cRaRR(K@'`RN*ccRgVNaRRXdBG eR&R#RRARJ@RJ@!J6"@A9! T@Daji*h4oC@***R4<R`%@ @9$@9" (@9A@,@9"`RBZr_qDAz T0@94@9# 8@9a@<@9@9#`cZqT(Tq`Tq@T`%***@0*4qaT ;T f:@RRr@ q)Ta:@@@*%Ra:@ | R`Na:@l sG@*@R@ qT@*㇀RKK@T@+N@Z@ k!T?qT Rfa:@P@`^_1aTz@"f:@,4B(7CR@C@_T@?AT@T`JGQ6} $f@64f:@$㾀RaRB(7R/@g$f:@P!ۀRaRB(7R!@?1aTz@@@?1aTz@@@?1aTz@@@7@`7 @ 7@7@7@d7@%6gf:@$PÿRReQrk(Tgf:@$҃Rb@kmTg $Lf:@#R Qq)Tgf:@$H€R`RNAR k-Tgf:@$ң€R@ф@d7@6f:@g$P#ĀRaRB(7Rj@kjTg $@f:@ĀRaRB(7R@g$f:@l B(7ڀRaRRRt((n@kmTg $f:@҃ŀRc*NkkTg $f:@CƀRA)qT@kLTgf:@$#ǀR#4gf:@$<ǀR@@k-Tgf:@$҃ȀR`щ @kTg$f:@CɀRaRB(7R6@@_k Tgf:@$pңʀRwp@R^@k`Tg $f:@cˀRK Vc%E@ѡ@#R qI*Ez@Tg$f:@҃̀RaRB(7RqӀ@@ @9q _kTf:@g$HB(7΀RaRR֋@g$f:@P!B(7#܀RaRRȋX'@D%"@9 @9 @@ "@9@ @9@`"@9 @9@"@9 @9@ Tg$f:@aRB(7cπRR" @9 $@9@@ "(@9@ ,@9@`ZkTg$f:@ЀRaRB(7R @9@_k@Tg$f:@ңЀR"0@9 4@9 @@ "8@9@ <@9@`Zk@Tg$f:@CрR"`@9 d@9@@ "h@9@ l@9@`Zk@Tg$f:@рR"p@9 t@9@@ "x@9@ |@9@`Zk@Tg$f:@҃ҀRKK@)@@0@94@9A 8@9"@<@9A`!Zk@Tg$f:@ңӀRP@9T@9@" X@9\@9A@ `Zk`Tg$f:@(CԀR|`*RR7R`*NkT:6R4`!j!8=*,*qT@T68-`@"RC@ T@"R?T@"RT@"RG@Tw$RR`*NkTy5@Daj˳`DV@`*Na2K`6J@`:n@`z@`_*@b5s!*59*a4?"u`BBj!8@ѱj!8@ѳj!8@Ѵj!8@ѵv85+7f:@҃ـRaRR9Rp*m*k|{S@`zDkT@SA{è_֡zta {S7 U RSA{Ȩ_{S[vBR% `zDkTSA*[B{ɨ_zt#9 !% `XD!X_XD!QX_{SxD`zDkT@SA{è_u4*@@ *@ {CS[ck3 qTq**!%Rt xc8%B@e`>G`@4f:@g,;%B#ңRRaRRx`BGu`nFsqabN7@a.$@@4!$ša*@a@aay9!2a99`>G$@B4!$šk"$c$CDZRc|c " B D cTSc d( kBbr@9? qTay9!2a99@bF0A@$dJA|@4#AT@ar_kTg ,;D'f:@XRaRB#R&@!š@!šg,;f:@h&VRaRB#R# cc5#|@!4xTebNK! aZa^4a afKaj*abafGQ#c Kb cjNbV@@Tg,;f:@D(҃]R?qT%|@H|@"Tc.Nf|@hT_j`Tg ,;)f:@^Ra*N?|qTFR! aB$hT!RaNcKcR@P7@@a:@) R`N`.Rn`BR*`4 g?B@*C}Rf:@B#aRR+RyvD?1T`NN`5`9aBB(@R  [[@!"@B9Bx"@9afD5aBB!p **4g\7f:@+hRaRB#Rv T`BBpa ;J *@4g\7f:@,iRa:@E[@*C*|-6b:@y!P._`zDk T~$* 5 ~a:@@T`28*g?/B# RaR*R3f$A{xa *4v,f:@#h.DRaRR f:@/FRaRR @dG0B@*Tb.Na:@X1dRNC| a:@bFN82dJNcrNa:@dVN 3bbNcfNa:@c2N4b6Nd:Na:@#RdzDbJ@4BQe^DRa:@bD6cDa:@bfDT7cbDdjD R` %R5~tIt|q T_֠{ASB_*{CS*`XDBQX"44 gf:@%9B#㋀RaRR%!R4L`>Ga:@@@x:h#.d`BB~`BG~~`nF|~`>Ga:@@@:T`>G>R{cCS[kqmTRҥ@;RaRB#R[SA*[BcCkD{ƨ_R7@ ~#*@5s)R@@kmTcRz/@@9b5T@T**RaRB#R4sQ`~@s8?(qATj 8C)Qz3sAT#@P?҃RaRB#RC R+@s)~6`}/@8#R'@~@Tw T?҃RaRRB#e ҡND!@9?,qTHTA4?qT?㰀R?4q!Tvӂ v*NAD73@w"bARg4Rv NF7@bARS4hcR~@ ҔNBCRb{RSx@B!(|Dxa 5cBBd~DSA"R{¨ SA{¨_C{cRS[kКR sCzDk TRRQkLTRA:j`8a@9v@9b.@9 ` @9c2@9 @a@9``@9{>@9 Zy6@9 a@9@`@95``"@9a&@9 `*@9 @``:@9 *bB9aB9@A bB9"@aB9A`!ZkTg $:@B҃RaRR* R{BSC[DcEkFsGC_5C@5 Z Z*!*!7RNk T4FN!Q?jAzT  _kTg:@dRaRBR~RaR g:@҃#RRBo*VcQq T?q T6Nk*Tg ҆:@RaRBRV RuZ>ql T`B@9` 4`B!@@@5@TRv^9z*BzDklT*L^9:@9>@9;@9 ?@9BZB<r Z<BzT*C^5g  :@B"RaRR* * h@R`RRRRR@R`R{S[*ck+R\@ Ak TSR8R@T*@k`{+@*SA[BcCkD{ƨ_R`"9`&9`.9Rx9`9~Sa*92969:9`>9R9V9Z9^9b9f9j9n9r9v9z9~9d;@d; d9<S`9\S`9|S`9``9h`9pӄx`9d9!@*`5"@DDCWNN*`5# @)R*{1Tq@Tb@ a@"`t{S*ZZ`9@@9" BZB<@aRN KbB9BBB96D929BB9`6`vD1Tg 7f:@| BFRaRRy`BBvBҗy`zDkTzuyz5xv`8(`J@`JK)9 ? qTb@ )|!:*`@!4@?kTD929b@f!Q!|":A:@jb@?kL TRrk Tg,f:@C[RaRBRP*6{uazD!?kLTR)Z@5a:@@  @?kmT @?kKT@^@_kT@?kT@~@?kTR@gP%&8@BcWRaRRu R@R`RRyBSth{ @x @{¨x{CS[ckHG-7{ASB[CcDkE_օZ@7z@7~@d7@!6gf:@;PTRR`RN_kLT"5gf:@;CURF_qTcFNcQj Tgf:@;TVR8 bkTB|@gf:@;DVRaRB|RB^@B Q_q)Tgf:@;H҃WR@B~_0!Tgf:@;#XR b6Nk-Tgf:@;XRb@Kk`T|@gf:@;҃YR?q-TRgf:@;tB|#ZRaRRigf:@;8B|#cRaRR\t`BB*{A[CcDSBkE;!!|@@"@Tg;f:@<[RK)f@e|@|#? q!TD96f:@g;B|[RR+Z@k Tgf:@;xc\Rj@k Tgf:@;\R:@ Tgf:@;c]R6gf:@;^R{7Z@k-Tgf:@;xң^Roj@k)Tgf:@;C_Rd:@T*Tgf:@;_RUcBBz@c`@9d@9f@9e,@9 `@9g4@9@d$@9`` @9Z `(@9@d<@9``8@9Z `@c0@9Z<qc k Tgf:@;#bR-~@kT@ SkAT?kT_kT*@5`zDkJT k ~8` (@4`BBhy8@9" @9 @9A@ ``f:@g;ңSRaRB|VR7RRrrRC{CS[ck @9!@9@9  @9 @`NN%5R'$F@9~@*6`D92`91$TzD"_kT:@g(ңRaRB|RI$dxa!@{x`J@9N@9" @B<@?kT`5g (Ҧ:@RaRB|R(zDk,T@9@9RN@ @9@@9@`! !|ab"@9&@9@ *@9@.@9@`2@96@9@:@9>@9@!`ZfDkmTw*:@~ҥ`RRaR:N4 :@cRaRRtBbһ!KfbDyaZ@ bvB@9@9 @9@@9 `|@`zRNA  b`~B9`^J@9N@9 B<@B<@bu*e*` 5`ZR~k` R`Z@k,TaK)? qAT` )|"`: 3"y`"`R2h` K)Zc_ qaO)Z!Z )`@Zy9`D96C929bm**5*RJ@J%{A*SB[CcDkEC_`@!!c:@*`` )`fbj*8RaZ@bDKbfDaZ@ f5g (Ҧ:@4+RaRB|RF8Rtt<S*99\S|S 996*@gЦ:@(B|cRaRR&#vC{CS[ck@@xNN5^@*qaTf@k Tg P-f:@B|C8RaRR{A*SB[CcDkEC_րZ@kTB@~~RkTF@qTZ@K_qTafD?kTu R-Д~f:@ҥ| ;RRaR~`:N4 f:@C9Ra:9rkRu9!@ Z!Zar99Ra:9rkt9@ Z!Zar9@9 `:@9 @*` Z*5~~7@@~~hakTBG*VN*qEz!T`@9qTBG*y**BG@77*qT R`9 Z ZaR9@9 {@ TG 5:@*URaRB(RPuR{CS*HG7R@{ASB_A@9B@9" a @9A@b@9"`JR!ir_kT`$RBZ@r G:@5,B(cRaRR!uSW4G5:@,CRaRB(R u{S(@9qT8@G2-CnRaRRB(t:@G2T2B(ңyRaRRt RSA{¨_! @9`&@9b6@9e>@9 a*@9cb@9dr@9@`.@9 `a2@9Z" a:@9A@bV@9%`aR@9Z" aZ@9A@b^@9"`af@9BZa cj@9#@an@9a`cv@9!ZF* dz@9d@c~@9`*cZ**$6GІ:@2PoRRQrk(TGІ:@2ңoRd@9qFz,TG:@2.CpRQqFzTQq)TG:@2.#qRf@9Qq)TGІ:@2HqR~RN@R k,TGІ:@2crRq*qAT!5G:@2.sRe"5G:@2/ctR\!Q?kTK_kTG:@2/uRNTG:@2 0#vREH5d@9c@9 d@9d@c@9`#G:@20vR4B4G:@21cwR+"5G:@21xR"4G:@2xңxRR+C{S#*HG7R#@{BSCC_A@9B@9" a @9A@b@9"`JR!)r_kT $RBZ@r G3:@2B(ÚRaRRsG3:@,B(҃RaRRs 4G3:@,ңRaRB(Rs{CSy96*.N>G~!*6G p:@3B(cLRaRRs@*{ASB_R{CSHG7R@*{ASB_**4G6:@,CRaRB(RsqsҀ{S[**c**ks*5@9~@ *9@94.NZ<R>GO;*4O@(1@T1T:@*5*R{C*SD[EcFkGsH_qATW@G6#5ңR:@B(aRR,sW@T*1TBz9'6C{CS[*#RX *RRq*Ez`T(1TJ a@9b@9c@9" a@9A@#`cZkTW 6(:@aRCRR 7r:@,҃RaRRr i#@*{ASB[CC_**t{CSLN4:@G;7B(ңORaRRr@*{ASB_y9 6*.N>G~!*@4G ;҆:@p8PRaRB(RrCR{C#*S[**R*4q`T(1T@9@9 @9 JRd@@9 ir`k T*1!TR#@*{ASB[CC_RH 4qsv4 sR @9@9d @9@@9d`ZkTv4 354G7:@<9ңdRaRB(R:rqRsC{CS[**#*\NdNh˫q*Ez`T(1T@9@9 @9 JRd@@9 )r`k T*1!TR#@*{ASB[CC_R 4qsv4 sR? @9@9d @9@@9d`ZkTv4 354G-:@<9#RaRB(RqqRsC{S[ckHG6y|@t.N***Rvf:@G%9B(îRaRRqR{C*SD[EcFkGC_~@`>G#4*41TG@ G%:B(f:@҃RaRRqh*d 5Z Z%(f:@cRaRR$p;@Х,҃RaRRp k g5**/N~@?G~@Cn!Ŧ*`5KG`6/NR_;@G HB(cRaRRp/N kT***Wn3?Gcn*`41T!kTg`js8"h`8kTK _qRZ;@RaRG ,ЀRB(hpU ;@*Z@=;@**7&R#RRAR;@**x)$&R#RRAR@gK@ Gh6@C#R;@aRЀRB(+p*** s{S R*@9@R@9 R@9`R@ 9 R@9bN Z!ZA@9GK~!!|@7cC*4qT* G(f:@c+RЀRB(fof:@G(7B((RaRRXo#@*{ASB[C_cB9@qATqATG(f:@H-RaRB(RG@qTt.N*RWd Q?q~4AzaT*R Q?qAz T`>GSafc! 54a:@8*Wҹ*H*5aBG*d.NRV* 5`BGb.N`5Gf:@, 4RaRB(Rn`>GScɤ4CBR aRGf:@ЀRB(nc.N*R`BGb.kv8*eaBG*d.NRA*5`BG7*b.YaBG*d.NR*5`BG*b.Na5G f:@ 6RaRB(RsnTa:@* *G*qVq`T*1ATGf:@ 8R6GR{S7@?TSA{¨_"@@?|"R#@`?`MQ` 7{CSF?T#@bC?|MBQ R#@`?*4Gf:@4 B ңRaRRn*{ASB_RFAaHG6`46b@_aTC@aTc߀RG {C"@ B !@aR8@Rm{A@_?`TB@"@@R?|_@_{S*@s @D5ZB@?q@SA{è_%@#@kT$@Ҥ|`b@@C@kTD@C@TD@C @C@kJTaR_@"@kT@$@kjT!@mT!@kT RHG6{A@ 5 GC)$9@B 2 ۀRaRRsm{B__{RS4` MQ` @SA{è_"x"Rd{SSA{¨_s @3@ @~ T` @T F{CS7FT`NN5` N`4`JG6{ASB_4 `28'f:@L50B cDRaRRm@T{S*[**RB0\a7X)(bF`@`M` R@SA[B{Ĩ_`{SM5`F* R` RҐ ` @SA{è_`zF`F`3 a4R@@ K?qTRb7!,C@@ ``M` T5|{CS[cks6 @4c`FKRr pD) (@*{`JGjC)7`ZRItD`ZRB*RqEz T"@9&@9>@9 *@9 @.@9`2@9 6@9:@9 @ ڟ8 T- T[ f:@#؀RaRG,R^l@ f:@C؀RaRR;RPlNc4X c е f:@ХaRÉRR9@*`5 `DkTx*@"A|qT@`Fe1T`y9f:@7CRaRRk`NN5 R`Nz`jD5`fD`5ҥXCRaRRkQ9R`f**Ln**44`fD`f`jDq T4afD!afQR`j`2N`2`6NQ`6M5bjDB4a:@Kt{S*[**RX)R7 4(@SA[B{Ĩ@`SA[B{Ĩ_C{S[ck*C?bZ5`^R$aj`$T`FazF`F `j -bR t3c@@@!K??qTa4_` M` R|uvR@q*Ez`TqTqT@G `Hf:@B ҃eRaRRj@G`#ҥ@vR B aRRf:@jVtB4g`A;R8"@9&@9.@9>@9 *@9@ @6@9`2@99 Z :@9 @@` Zk*@4qTqT QqIT qT`>NaBNkTGf:@`HB kRaRRj?1T@G`@B #vRaRf:@Rj`j  a`F'!T7;4a:@Т@*@* O`jna`M5a3 ** R*4`F VR***@4`NN`5 R`NqC@*{CSD[EcFkGC_*`M!RqPb@`4AFU5`j ,a*a3k`>N`>;4*aB4b*a3:RZt{CS[*c*k**Fc`FT`FaT R` R{ASB[CcDkE_azFw3N4^V****4"`aF64uB4Ea~F+*4v391`>NQ`>@4'3f:@ңRaRB Ri`NN`5 R`N@*{CS*a:@{`FgFuTaF*`5a~F5`F`TazF`4u3aB4{ASBR@@b`4Gf:@RaRB Rei`NN4F@*{ASB_ R`NR{S*[*7aF @1T" @_kT1!T"@@R?|`MQ` #@`?`4SA[B{è_"$@_kT@?aTR{CS[c+x| l@``7!$`28b:@`*R}` `b4a6@T  B^рTy4AрT2 wB4x3* R6E@"@#@cF`"!C@9!7!% 7ER@R@aF5 A)`4`FqsazFpaFmaFj`F_`Z@ѱ7ER @@` M` `Fx!@ѥ`Ѩ`ZB`fDqT!R 5 8f:@ ҥX&̀RaRRh`:N@4f:@ ̀RaRRth!`bF#Ax#aZB"A_k TRQ`f`bDR`bw 5+@{ASB[CcD_{Stb4[v6@5@?T4@ATazFa~FaFaF`F[BSA{è7_"@@?|`F@{CS`F`M5f:@'Х->cRaRB Rh`@{ASB_q5`F`M 5*Tu4@D@@ KRk,TtFf:@'Х@&>B /RaRRg`M!RqPb@`4AFT4bfN@c.NcK *@4'-f:@PCRaRB Rg*R3+` MQ` ?@T$#@8BcJc~Ӄhc` @JT?@T_ T_ iTE@#BB&c'xdJ~ghg @J~ghg @J~ghg @J~ghg @J_TA%#hd8cJc~ӣhc` @J_!T_BQ!"6DN K@ _#_8q!TBQ{!S[4(@^@qTbRRf@?kLTR\^@*SA[B{Ĩ_!Q?kTj@*&RRE*4(1AT3Rb@RshDlDBK_q TdD4?k"Ђ!Kd`Dc h! `8@D_pD0N!K!| l_!_klT R_chc8k TRC{S[**cx|@;R,N@~@>G9#q:@BzTG@ *'l&:BRaRRf];@{CSD[EcFC_***p&R#RRARx{CRaRSPRf`@9a@9f@9cR ` @9 @aR`RZff@9҃RaRR f`"@9a&@9f>@9Rl  `*@9 @a.@9``2@9 a6@9`:@9 aRR ڎf`B@9aF@9fN@9R  `J@9 @aR`RZ~f`R@9aV@9f^@9R! `Z@9 @aR`RZnf`b@9af@9fn@9Rd! `j@9 @aR`RZ^f`@9a@9f@9#R! `@9 @aR`RZNfCRaRR"Ff&RSA{¨#RRAR{ң RaRS"R-f`@9a@9f@9 R # ` @9 @aR`RZff@9 RaRRP#ff@9 RaRR# ff@9# RaRR#ff@9C RaRR$e`"@9a&@9f.@9c R@$ `*@9 @aR`RZe`2@9a6@9f>@9 R|$ `:@9 @aR`RZe`R@9aV@9f^@9 R$ `Z@9 @aR`RZe`b@9af@9fn@9 R$ `j@9 @aR`RZe`r@9av@9f~@9 R0% `z@9 @aR`RZe`@9a@9f@9 Rl% `@9 @a@9``@9 a@9`@9 aRR ڑe`@9a@9f@9C R% `@9 @aR`RZec RaRR%ye&RSA{¨#RRAR{S&EaB@&AaZ@<'=az@'9a~@'5a^@8(1a@(-ab@()af@4)%a:@)!aj@)a@8*!Sa@*! Sa@*!a@?qT!t!|@aTSA4+{¨e"B9dB9+cB9bB9aB9SA{¨C*RaR{$,S[8@9u>@9 ReZ`@9a@9f@9#R<' ` @9> @aR`RZd`@9a@9f@9CR' `@9 @aR`RZd`"@9a&@9f.@9cR' `*@9 @aR`RZdf2@9R*aR8(df6@9ңRaRR*d*ҥ(RaRRd`B@95{B[DSC,C#RaRRdqTvB!@@@5T4+RaRRd`B9aB9fB9,{B [D`B9RSCC @aR`RZd`R@9ҥ+`N@9#R aR`J@9RgF@9fB@9pd{RaRSsX-Rad@RaRR-Xd@RaRR8.Od @#RaRR.Fd@CRaRR.=d@cRaRR(/4d@҃RaRRx/+d@ңRaRR/"d@SA{¨0RaRRd{RSsh0R*aRd@#RaRR1c@@1CRaRRc5@҃RaRRx1c @ңRaRR1c@@SA1{èRaRRc@SA{è_R__R__R_{S**[*c<#u@@4qT`A#@SA[BcC{Ũ_u1`T @@?@6T 7 u1@T@ @?6T ">?ՠ@B*RT*s*?ՠ@RV*B*?ՠ@{S**[*cu@ 4qT`ASA[BcC{Ĩ_u1`T @ҷ@?@ 6T  iu1@T@Ң@?6T @@?<@@?7ҥ|2R!>?@s* SsB*s 2?@@|@?6v(T ҫ@@?@72RaRB(2Rc@* SB*2?@@Y@?ՠ6ST ҈{S u,v`fu` RSA{¨_{ H@}u @R{¨_փR$R!|#(@dh!8(@_#|!#B p@9B*p9_**R(R$Ě7qT_$Ě`6$Ě6*"R"RqAT{_փ|#!ap@9 `p9{*?klT**R|?kjT_d(@hb8BP6@!|Sd@q!Td`F`ӄS*?ե@@$@?Մ@@$@?$R! @!`~h!_ @!@?!x? @_@@!@B@!@9!!(~Bha?@Bx?@h!_@@!@B@!@9!!(~Bha?@B2?@h!_@@9!@B@!@?@?!@! @"@?@ @_@ad@5 @!@?`@_(qT_ qHT_qT!xBTQ_qT!x!2? @A @!@?!x? @Aad@5 @! @?!2? @A  @!@?!x? @A @!@?ա77_!2{S[cksV @H@ R\u3 W SA[BcCkDsE{Ǩ_ִ*REB*9Z3s6R@*4 Z*c|  ZX`*nAd~@!` s*ӳ*`@hqHT#€c ǚ TРT&<4ңRaRBl4RaA4 @@?!R*?A @ _@ @A?x?qc2x?A @ {CS@9@!@?@ @` @@ @@?rTa @\S?!@! @ }R}` @@ @@?r`TqTa.@4Bl4! @(@R'@R@ @Ia{ASB_֧LxRRR@9@9!!29@9BB29!t9_$#x! !xS!Kb99_{&<"` y`9` @d@5dRfr h"4?` @?@!R ` @@9?@ Ra @@9?!@" a @!@!`??4@T!Rb @@9<B@0~@h`?4rT!qT86 `@XW`qT`5SAR[B{è_@@!@@@9<0~ h`?_{Sc8R#[*vRKy҇ #`9R i9a*@ !hg87Pq!T V66`*@"RP@96@?qT@?qTBP_qTBQ!R*7R]` R a9R i96?U9 ]9R%@?qaT@ 58 xBxSa BK!"$@9B@9hh8?kTj`8 ! _kATT ]@9 *!kaT6!R! ! ]9qT oVSA[BcC{Ũ_!R! * ]9qT @9l2 9je8 )AT "R!R @Ra*@"R|#!""Ra*@  @9!@x 9R 9 @9!|t2 9 @9x 9`*@!@c !@?`@?`@RR @|a*@?h 8 VR`{R[S@L8,*5 @@9#R%*5*SA[B{è_{q{${ (@!@9A6#Ux @{Ũ_R R9R9'A9R@R#l2'9`R9A9"R9x9R9A99t929A9Rx9{p@ A9Q 94R{_ %@tSh`?cE @@@kT_ R #@tSch`?@@c2 tS?!@#h "$@R R*D R(RhQ$7qaT_րhQ$a6$6*"R "Rq!T{_ւ|"!Ap@9 @p9{{@@@!@@940~)h`?)5rAT@9}4tS@?!@|@?h @@9?@@ @?@D @?@H {_ RD)kᧀ% @|{#!h`@!Pd@!S`4b AB@c@J? kT@9)A @0tS?!@|@)h b A){CS[@ARaR@@Z`.@0@4(@b@_kT,@b@_kTa@! @?! ,@B4!2(@8R_qDCzT!2?b@A ,@a(@a0@b@?k`Ta5@aZ0@a0@4`@ @?2?a@ e R`_qAT!2a6ab@?Xq(T€ $6`@@?`2@BR!HQ  *?a@ `2@b@9pSB@ka @ ?!@! @"a @!@! @!@?!0 b @*?B@B @Aa @!@! @!$@?kTa @?!@! @ $a @!@! @!`@?"x_kT!b @!*?@@ @`` @d@@5`@@?!R*?a@ !R@_q TcA?c2?@?qT$R@# A?!R! !J! !J?@ _"RDRcA?!pB a" B*?@@_qTbA?B2?@b@B A?K! ?@A @!A?!x?@_cA?!pB a" B*?@{*0@6*AR*aR6@A?2?ա@ @A?2?ա@ @A?2?ա@ qT@A?2?ա@ @A?2?ա@ {_և6*AR~@ A6?x?ա@ ?2{S[cksk`@kl@ 5v@k9lfD`5 TR!R5 RBrf@qRrB@ B"B#! _kaTR^ RRlf@!R`5l z B)@ @wJ@***@ @B<>*q T1T@ @*RB' * 6ТХh>Bl43`@c[R@aR@l @`Lf@RqRjLxc[RaRREY{B*SC[DcEkFsG_R@ @**bR[p*5`J@ x`c 5Bl4>s`@c]R@aR@"YJRІLxc]RaRR@ @*B*1ATBl4`?`@#^R@ІLx#^R`DRR!?G{`CRDR!K{a @`9"d@4!h@|ug`#9@g@ 5`@!"l` @ @a@Bl`1ATBl4`@æR@ІLxæRLS""A @!a qT*@㫁RaRBl4RX/fc@XqTPq Tq T$QqT @?2?a@ `@@?x?a@ `@@?2?a@ s`@@?2?a@ `@@?x?a@ Wo@5@k@@5Bl4<`@ңyRaR@@jX`@Т0Bl4ңR@\qTdQ?q)TҥR @?2?a@ 9`@qT`@A?p?a@ a @"d@45 @LA?!p!2?`@b @LSB @|@0Ah a @`@!@LS|@!h`?!x?b @`@B@LS|@Ah a @`@!@LS|@!h`?!l!2?b @`@B@LS|@Ah `@a @LS! @|@P!h`?!x?`@b @LSB @|@PAh `@a @LS! @|@0!h`?"pB2?`@c @LSc @|@0bh ! R!*?`@b @LSB @|@0Ah ` @d@4a@5 @LA?!x!2?`@b @LSB @|@0Ah `@A?2?a@ `@A?p2?a@ `@A? 2?a@ `@A?HR*?a@ `@A?2?a@ `@A?2?a@ )ІLxңyRaRRWІХТLx0Bl4ңRG@g@q T?@@@$?A@R!@ ?B@aRB@A?B@B@A?B@B@@?B@B@A?B@B@@?B@B@A0?A@!@ ?@@aR@P?@@@`?@@aR@T?@@R@d@g@ 5@@4@?2?A@ 4R@#9R@#@@#@VB"|B{? TСc&!l4R\  Rҿ?C@h!?D@#h#_ qT?D@#h#B!_qT RRRR+R@?kT?@@@`%$*@9@B<B*@9B *?L@*i&@BQB<?F@ech%b!!*@ @R?2?A @ @!Q0A@!a?4@Ag@A4Hӿ?A@ !?@@RRR@!RBg@_qA T5?B@RE?B@@RE !?q!T?@@R`?@@!Rd@g@kaT?@@AR @`?@@aR @d?@@ @h?@@ @l@g@5?@@R\0?@@!R @?@@@"?@@R@@"G@'tN?qAT?B@RE?B@RE$?B@REh ?E@Rh"?B@Ch ?E@h"?@`TR Bl4`@҃@RaR@@_VR ҥ|`@KRaRBl4t@@PVІLx҃@RaRRFVR ІLxҥ|KRaRBl4tR5V?B@B@A Ag@?qT@9?A@!@"#@R! !tS?B@RCh!R@B@! !tSBha?@B2! !tS?C@bh!Ȁ@tS?B@Ah ?@@!R#0R?A@  ҿ?C@h!!?aT?A@ ?A@??A@??A@? ?A@?qTRR?A@ ?A@"qTRҎ@+RRRR@@P?Հ @ ?B@@@@ P? xS C# B*?C@b B@BP?ՠ @ ?B@!@?@qaTRRRRCwCR!K9999C9R*Q29C(qTRC]C9RRx9@R9C98R9 t929C99x9C99l29CR;9R*R9'C9"R *9l9*'9A+@!@9[6CC9C29A+@!!]8\6RCC9C29RJaRG"R!R*^7RCCaRRR9VR9C9R*Rx9R9C9t29C9x9C9l*9CT*R?@A+@|!6A+@ 9@A+@|4!<A+@ C "R!Ra*V7RCCR99C9 Rl*R9C%C*R@RA+@|!6A+@ !R9@A+@|4!5A+@ R CW"R!R-@P7RC@C R9 R9C9  r rl ** *9CCm@R*@A+@|!6A+@ !R9@A+@|4!*A+@ C "R!R I7RCP@*C99[Rc9k9C9*Rl29CC9x9R9C9t29C9x9C)@R*@A+@|!6A+@ 9@A+@|4!5A+@ R C"R!R*@7Rc9*Rk9C)}R *h@A+@|!6A+@ 9@A+@|4!5A+@ R C"R!R*;7CRCA$99C9*Rx9@R9C9t29C9x9C9l29CBC*R+@A+@|!6A+@ 9@A+@|4!5A+@ R CvCR9C9* IRl*R9999CC *R@A+@|!6A+@ !R9@A+@|4!5A+@ C I?@@!RbSR|R?A@ @?A@"$@?A@"(@?A@",qT?@@?@@2?@@?@@q!T R@o_9t @ 2`K`#C9j@k@Tf@ (5R/`u@9`BR(rSR" R99R`@``Ra#C99a@9|)a@ `@a@y@ҁ ` @d@5`#@`6`@@?b@2x_qac@"TQ_q2$Dzx?a@ `@@?`ЁR*?a@ a@9` @!@?@ @` @?@RR @`@9b @@ ` ?B@|@!_h ? qT` @?@R @` @@ @ @?T*a @?!@! @ ` @?@ @$`@9a @@tS?!@|@ R"h `@a @@!@@9(~!h`?b @!$2?B@Ah `@9a#C9b @tS!?B@|@Ah `@9a#C9b @tS!|S?B@|@Ah ` @@Y?`@9!R *b @?B@@` @@X?`@9 @ b @?B@@` @d@9b#C9?@d?@ĀR`3`_@` @$@@4kT`/@Bl4 @` @]RaR@@R_t`@9Bl4S"`@CdRaR@@R@@8RCDRC*99C9"RRl*999CR. R9R9C9RRRl29CC9 *"R9x9R9C9t29C9x99s:RLx]RaRR@|qT@ 5ĀRR @kl T $Rf @ @C@d@_q!Tb`ESB*?@B@E$b @?B@B@C$b @? !B@tSCh kT@ t_`@9t!RR! *@**a@c @!@`_@!@9bd@!@c@!(~_qRBcha?``J b @J?B@@h!`?@ `K@K@RPs@@a@9x!@A9@9@g@q TRc @R R@@?kkTĀR6`/@@n4l @ @ #ZR&@aR@ @Q`/@@( @ LxaRRaR  b@tS@h`?!Lx#ZRR aR @ aRaR&@@ @~QLxCdRaRRG@!RrG@Rr`@ac@qT?(qT? qhT?qA3@ *@3RF!RC!TQ?q qAT TQq$DzT!$Q?qpSRRR_{S*[* wH B0*\ @SA[B{Ĩ_ R`)` R`R ) `UEc u| R:vZwr9| daTc c`@`)`@`Fa @ ?֠4!& `A)JjTc~q@KRrĒ@zT_RݷrkT4*{S[CR*@*?6SA[B{è_<S`**@cR?`7a@< *`R{#RS@7@`*;[ck+?59R{v*g5T"R34aZ!ZA s! "ZBZ*(z`b !" ZZ**5g@4@pk@T_1*A@T5#5 +@SA[BcCkD{Ȩ_{S*$@ ?S*SA{¨{S*q!R[! !Z* @` T@@X bN@a@!@$uw:@SA[B{Ĩ_*B @!@aR_@!@aR_*@@*L@_{"RS[ca2@A47aJ@?qT(7AR :`@RXR@ @R E4 E2`kiT 2 SA[BcC{Ĩ_* `5"R*jr/6 R`2R"RB{"RS*`J@q!T`B@r TBR| "R AarT}Ra*`X6 R`.@RSA{è_RRv*Rq ?rT R`*a@6 R`. R qTRa rT}Ra*RjT77RSAR Ha )06}R`*`o6 R{SP*`5*SA{¨_d<@ @**L@_{R (@7x@Rc* @R{¨ @{¨_{S[H@qT(@*q Tq@R@Rc`.@qATc2@[BRSA{ĨHRG)R < 7S`c*U6c2U6c2U6c2Uh6c2Up6c2U6c2U6c2k`TR6@SA[B{Ĩ_R"R7@6"R*7t`B@rTU 62U(62*"R 7k*4@[BSA{ĨR@7R @qATR{"RS@7}RRs@p6s2@h6s2@`6s2@X6s2@6R7@h6s2@`6s2@x6s 2@p6s 2G)!  )fRSA{¨_`@6R_R@SA{è_{RS/7Re*>Rs6qT CRW* 7}{*S**R *R@2RSA{è?qR@@FzT$@f{** @_R&jT%qT** @{¨R_{?qR@FzSt<@Tf(@*SA{¨f@**_R&jT#qT***SA{¨*RSA{¨_{S[**R<**R***R@RSA[B{Ĩ_{S*[*R**R***Rw*SA[B{è_{"RS[*qT B6qRR}RSX6B$T`@qT @q}R@Rs6MӀN)RkaT B2 @SA[B{Ĩ_  `5RB}5"Rp**`*JӀ2 R{ o5 @{¨ @{¨_{RR ]5 @{¨ @{¨_{ P@5 RR @{¨ @{¨_{S[ck+@@! qkR#*6*R+@SA[BcCkD{Ǩ_*oRBoo@ Q?kT ~j`cZ@)z< @s Z Z{> Z? #kT>[5R?*c*79*R6*7s>s {S8@!$Q? qTR*`:@$Q?q T@Rc*RbRsl#2bR!*#bR`:@qTbRlRbR*w`:@4qTRCR*RjbR R*bR^bR #RbR*QRlVRSA{¨_,qTcxc20qTcxc2{RR 3RR.RR)RR$ RR"< @R{¨_{RR  bRD<bRc2RRcjRRRRRRRR"R+RRRRcRc"RRR׍R`7RR@2R @{¨_{cRR RlRc2cRRBRR BRR*CRRR<Rc2RR~ @{¨{ x @R{¨_{cRR e1RR`RR[RV RRQR*`:@(qaT@Rc*RCF`RvR@26 @R{¨_{S2LRbcR*R!RR*RRBRbRIRSA{¨_{CRR RRcRRCRRRR @{¨ {R RRRRRRRR RRR @R{¨_{e< " @q[6!RW<" Kc<! !KS3<<s*3 "@c**[BSA{Ĩ{RR c)R"R(RRR"R(RR|"Rw)RRrc~"Rm#+RRhRRc`:@qTCRR[$RcRRR$R*RRRRJ D`:@qTbR|,cbR*:`:@$Q qTCRR1Rh<`:@(qTc2R$RR :$ @R{¨_ctc<,qaTc20qTc2__{SR[4cv2@kTSA[BcC{Ĩ_a@)qT?LqhT,Xa*,%sBB 4?LqTB,BXaq(T#X`*{SH@J\Rm]`@SA{è_!Rc]`!\6,!,`!(\ 6!`9`` @|B,T@cRaR@@I@gfLxcRaRRb@*@?@7at TE`B"Tb @@?aB@k\aB@? k`TRJ{S*"[R**'@SA[B{Ԩ_{S [** @@?` kTsTSA[B{è_R*P"!D@!@Q?qT@RR@r{*CRaRBxRIR{_{[ւ'cwSRk+@ @*ş*q"T*@ @4@ @*ڞ*q!T@ @~@%RRϽҵ~ h5`h#?RaRBxRKI@ @*%RR h5ҥC@R@ @*%R#R h5ҥcAR@ @*%RCR h5ҥBR@ @*R h5qTҥDRqTRHR@@"@`@?x?`qT@@?t*2?@ @?*? }҇kTR#@b@?Bx?b!kTR RR矏RIPHP r rr&RR¨#@?c c *?##@?c2?##@?c *?#@?!P !*?@?! !2? @?!l!*? ,@?!l!*?B,kTЖzR@@@@?2?@ @?x? [#R* 4Rc.RaRRHR*@4Rҥ/RaRRzHR*40RaRRmH*`#8RaRRdHkTRb @A@?!2?AksTqT+@SA[BcCkD{ը_*9RY4* "@?qTX{RBS*[*c#@ @š2qlT#@SA[BcC{Ũ_@ @*RBL6qT@ @*2@BЙ;97R*@ @*s6R@ @*4@ @6*RFqAT*\@ @* *@ @*R*|JR*@ @B\uN*@ @BuqB9*@ @BmqF9{S[cks@0@~|Ӏj`q`T!RR3{7kTSAR[BcCkDsE{Ǩ_T@qLqT!!XcxbA! ֡@@R*R@rsB@6SRr*2@9 D*c*cB@М @{wRkTA5Х, ңRaRBxRqG F*C\RaRRiGR@ @*@ @%RRB'лҥ R2`@?տ?`@?RRr *?` R**@rx`@?տ?`@?  2?``@?տ?ՀR``@?2?**``R@r^5R@* RR@cQqaTRtS *c2@c@QtS *RR{+YR{_{S#Y@_sB@TSAR{¨_=a @3@{SFe64R*SA{¨_d7d{S[H@R@SA[B{Ũ_U"@v}d$!@Su3dO@6d7O@1Td ҁ! "`ZO47`d@!4@A_{CS[cH@!H"vd*6*3@@95B" `J@Sd{ASB[CcD_WД~#B'BWW@klTR{wc` R!Z] 4 "S`@ R@@ROF<gfLx RR R/@X Х$@ңRaR@@3F |$`@ң R@gfLxңRaR R @!@!@?pqT@!4@"4@@?@5gfLxң R@!4@!@a֠_{S@B4@B@b*@?~@RSA{¨_֠@4@H@d֠_{S*[*V @H@WB%*5q AzTa@ Ax @SA[B{Ĩ_ւ*Bp% 5q NzaTa@ $Dx $*B%`4{S[cU @8H@WBP&* RqMT*R*B&5*C@*R `@zbkTc@ S!|Bd@!|  !tS!|@ha# c*h!kTRSA[BcC{ݨ_֠{S[W @W@B&*ø4@*SA[B{ݨ_*` @qTC@RnRa @?kTz`_q@Ta@_kTc@|d@SB !| B !tS!|@ha# b*h!#AR{S[U @H@NW`oX`* RB&` *RB'`*҂B8'\` R`*B`'`4`J@[BSA{èSA[B{è_{SW J@!(Db`J@!(>b`J@!X)8b`J@!)2b`"J@!*,b`&RJ@!t*&b`*!*J@b`9!,+J@\b`!|+bR`9b!+ b`4`@`Ba@?1 T`@1T?kT`:@2`:a"@?1T`&@1TRSA{¨_ R`9?kT`:@2`:{CS[,cV`J@!P,b9!,`J@b9`J@a `J@Lbc RSZ`5/@@<`aTR{ASB[CcD_TcRZ~V@kT@5@$-B-sgfLx҃8RaR R҃8R`@aR@@?D`@2`{ V@ @{¨ @{¨_{S*V@@9V@?1`T?kT@1`Tk T1T @*@SA{è֠@SA{è_֠{S*~V@@V @?1`T?kT$@1`Tk T1T@*@SA{è֠@SA{è_֠{ XV@ @{¨ @{¨_{S*[cDV@U@1`TkT@1`Tk+T1T*@4*m*@*@?*5*@4q@z Tsk*sVZ33`|@**SA[BcC{Ĩ_*R{S[7V@@Uw7@97*@4*b@*@?* 5*@4q @zT(*qT*@A! |@@*SA[B{Ĩ_R{ 3*1M:T@1sR?jaT1ATR @{¨_{S4U  @*SA{¨SA{¨_ RmZ{S8U8@`7a@91@T5`@9`7Ra@9a6Ra:@!2a: aB@?1T1T4SA{¨_a@9a7a@96a@? qaT!Ra:@6a@&a@?qmT!5`:@@6a"@5` {qaAzTq!Az{_R{S@4@@@R@?qlTSA{¨_{S4@54@*qaTR @*@?,1`T@SA{è_{S@4@@ ?,1TSA| {¨_@!4@"@!R R_0@{S0@a@95SA{¨_s0@0@0@R_{S@54@T@"@"@6R/a@`R;p*;*?p+C+O +GE>RA@@?֠4@SA{˨_@@@_{ST@TSA{¨_sxa@95@@@__@@@R_@@@R_@@@B4@B@A@_{ST @4!.J!8 ٖ** R(Y 5@AA"@!xA"RSA{è_AR3K* 6;*qT@@a~@RҳU5@fTqT@S 4R RX4R RX4 RLY`4.R{R{_{S_q T_xrTR@SA{è_*|@@@k`TB Cx`?T aT7*/{ R/v6*<=oj(6Snj#5464qT!D@$ @B4@B @b֠__{ S @@a@a @ab9@aj9@af9@`R @{¨_{StSSRpT@T@SA{Ĩ_`RJ@!$0^`RJ@!P0^`"RJ@!x0^``@5J@RA!<^`4qRR`"R@@B! !|@@ha8?_{+@*{BSC[D_3@**43@B3,5@ +RaR@@ @>gfLx+RaR`R 7@@7UP*5PP3@P@43@R)*4{S[***Cc*ks*`RGU4***4B31RaR`R^>{B*SC[DcEkFsG_K@c**S: THcR* 5O@_P4*^)O@@7O* 5O@^PO@O@ZPK@TP@ 4 5@k TK@@R6K@B35@ R4RR@@ @>ԐR r RgfLx4RR`R4K@B3,5 @ 5RaR&@@ @=gfLx5RaR`R O@O* 44O@!RVO@Uy@ 4kTK@***4{S[H@!'[ԐRJ@"r!4 [ !6J@[J@!6[J@!6[S*J@!7*[J@!07[S*J@s*!p7"RZqT qTqATs2J@"R!7ZqT qTqATs2RSA[B{è_s2s2s2s2{ O`J@` @R{¨_!B?qTT?q@T?qT`A_? qT"6r 6r`Ar6v`AsqR{"R!@9 @*@5` @94a$@9*"R`5``@94ad@9*"R5`$@4a@9q*q{_R R#@9c7#(@9#7#h@97#@97"@9_qATR_@@@4@@@d{S[c#@B@B@V4@ 6*7@`@"@?*01`T*#@SA[BcC{Ũ_ր*@@4&@@qT҃"@9@9b@9s s `>|c ˀ @y9c4`Q @pS$h!8! QklTc4 RdRarS@j* 5*@D!pS`4*#sA@c@c@c4@c@e@e`@@ @9C@9@c @`@9c 4?kbT_@D)qAT@4k@(@(@4R4!K?k!A({S*N@b@?aSBl!*S6!2S6!2?a @96oN@ @?ts2q2? SAR{¨_{]N@?AR?!R?R{_{S*JNSN@@`4ksORܡr` <q TZRR!#rCKkcQcQ!R!  K jZAK!!Q$?qT R"hS!SB2A* *?ՀR@SA{è_{SNyN9O`@9`"9R@SA{è_{S[*c@M@6`@2``@x+8x`q(T6`@x`SAR[BcC{Ĩ_RqaTT@9`@x`?Ra a@?A6`@?V8T"QR_{S@M@@c@r * @SA{èR_%hc8*qTc_kHTBQ%kTDѦhd8߀qT*d|@#˿kJTAKBk!!Пh!8_'hd8h$8{[VSR3 ZRs ZrR)TR&@RyR`y@R`9y` R`SA[B{è_{S[cW#^M@ZMa&@99a*@9 9 @`@ TR 4#@SA[BcC{Ũ_sT{S[cks'Mw@Ss!M!'@9a9!+@9a 9 @5 @ >SFRko|J~Sf^S!@T~M)`9@R`9aFRZayg 9v y9d9c"9&9`b9FR@4SA[BcCkDsE{Ǩ_~>S`F@T{S[ckYsLx@3L'@9a9+@9a 9 @@ >S'RcgzJ~Sg^S@ T~ L)`9@R`9aFARZayh 9v y9c9b"9&97`b97@'R4ˠ @R`9y`b9SA[BcCkDsE{Ǩ_~>S`F@Z`T{!S[ckssL{*5kLHUR @4#T{@SA[BcCkDsE{Ө_R99R9oA9 9@@R@RR yR99b9F 5@9`|qT9`6 R93RA! yRA!@t+RA!oB9|R*9R B99 y9Fb94@qbRATB9@5@6TRҭRy@R9\RFb9@5J@@9@9A @9"@ @9A`@!Z?T@9!@9C @9@9b@@`Z 22BxSA 22!R& *h@!*@* "*@4*`R!2R @SA[B{Ĩ_{6J{@{Ssz[*B2@~@@9@"qR@S *j@2!*!{@SA[B_{S* J@*SA{¨{S*I@ 56RP 5@|@!pт@B8BQC<? ""To`@SA{Ĩ_ք`*@{ *I@a!p[ @R{¨_{SS<r[ck<sCѠ@T5<`*@T R?k TRRr>Rqx**/8?@!z!8!@|c!ˠ;@@?zh@@7@yA *!*R*7@W;@78 s8K>9s>r>RT*SA[BcCkDsE{Ȩ_ִ{S[cx<rksT3<*?@aT$W<b R_kT<*B RB*7?q Ts"Qs>>X2@R5DB*kD*sE*cCSAR[B{ƨq*B<>SA[BcCkDsE{ƨ_ R`{R 7 @{è_{S IIa"RSA{¨_ RR{R RRm @{è_E<{*s*R$@{¨_{F<*s*RRg{¨_{E4* S<*Rs /@srS$ @{è_{%<c<A<B6c<S!4RsRG{¨_bR{S4 R@<#2SA!x{¨# R{ R <c2 @{¨ R{ R R  @ R{¨{S4R<@#2!x#RyR8SAy{¨R8A9?q`T!R_{R Rc RR{8 @{¨R{sR l8s @R{¨v{b R ^R b @ R{¨g{E4** S<R`/@sS$ @{è_{SR[uе<Hނ R*7s5νsj҆qpR`@z T4@ ?֓4`=@RSA[B{Ĩ_`4={%<DA<_rc"RTB pSB<!4c sRl{¨_{SGG"Rb RRRRb RRSA{è_{iRSiR2SAi{¨R{b RSb8< R2b R Rec2 R`:A9 QqTcRyRRRR_t R2 RSA{è_{  @R{¨_{StJ@`:A9~SqTqT`:A9qhTqTRSA{¨_ QqHTRbzRz*y*bzRr QqTRR"zRf{S4<5 @y?kT*b RWuy.@* RSA{è<{S4<[5 V<@y?kT*b R>uy.*[B*SA R{è3{~ <B2 @~{¨{y <Bxy @ĉ{¨]{bRR{ĉU{S`:A9qaTM RRM  RR<b R<bc2 R RR R#r*R RzR@2z>*R}RbR:zR"RRc "SAR{¨{S[FuF{F"L= RRB? R$|DhdxkT!|@! @y`:9 @9`B9`:A9q T( TqT 5`=@@SA[B{Ĩ_!?$aT! a!>B a !2B%a ! 0a"a@ R ?a@ ?`B@9~@}R<`B@96}<`B@9qaTBtB<`B@926}*~⿍@RSA[B{Ĩ QqT!@B a!>a !2B%a !a! >Ba !8B2a !@.62B2Rq@T{ST<*!y*SAx{¨{S*[*KcX<w<#9sqT #@SA[BcC{Ũ_y4*<J?j T},**R{ R 2 RR @R{¨R RR{ R l R!RR%RRc RRR%RR= RR @{¨{ { @{¨{ ❏ @R{¨A{R%R@Rc RR |" Rm@2"c< RxR @%R{¨@Rc RRh{ R  R8jýR" RWb RBR b RM˅ R6<˅c2 RA Rd2c R RE R2 @{¨ R {  @{¨{!R $ Rl R`:A9 QqT8R!<X6Bx`:A9 q!Ty<Bxyy@2yw}<B2wyu<B2ybbRab R<bc2 RRAR RL R" RR " R*ýR" RRB= Rk= R<=c2 RCRr RfRb R~"R RyR r< RV"R^Rc " @R{¨gN{ (:E @{¨{R ; R RcR0r R%C Rb R C R RoýR" R/˅ R<˅c2 R# Rd2c RR' R2 R❏ @R{¨{  Rl R!RX6<BxNRb RR R Rw R" RR " R@CRr R`@@QqT Rb RR RRr< RcR~R0RCBrb~R# RbyRýR" R= R<=c2 R❏ @R{¨>Rb Rh R{SRWRf8RrR%RDRc RRd{&7}ҨqTRbRY RB@2c< RMb R8Rb  RC`:A9$qT R`(6b R&<bc2 R1"RRc "R'I<X6Bx>RdR@!yx<B2az<B2azR_ R_ R<S_ R<*0B*R_kTa`!{4rTRrR  R.*b R<bc2 R@SA{è{SRR%RDRc RR{L&7}qT$`:A9qTzR<zcHc2R"|R/"|c2ReqAT R"R  RXbsRRh<rz2bsqT"sR"sc2R=bxRR8bxR^M RIRM  RT`:A9qT`@R@qRc|RbR2(bR R*<#R R7@SA{èRR{S4<8A9?qT?qT!Q!?qT*RRziZ*R"{SA{è_?qTRT@7vRRRRxP*Rxx R{S RbR6-sqTSA{¨_{RR !t8!R!׏i<Bx|c@y @b{¨ R{SR[qR5<S<B2fHzVzT*!׏"RSA![B{è{S8A9?q TzR-`2czRcBR"RBzRzRuRR RN RRR@yF@x RlqATRb RbR R]R RXztx RR!T@R RK@SAR{è RC?qT?R R RQR` R@yF@x R/qAT@SA{è_{S8A9? qAT RR\@yF@x RqAT@SA{è/?q TrR!RI@yF@x RqAT RURRxRRЃ+Rp3R>@yF@xRqAT" R`7CRb RCR" R" RURRx R RRp#R@yF@x RqATCR⎅ R@SA{è?q!TRRr RR!R@yF@x RqATRURfRxRR2R R@yF@xRqATR6RyRsRxRm RUR=Rx Rc RRR8R@yF@x RVqATCR⎅ ROR⌅ RJR5<c2R@"|R@c2SA"|{èR R?q TrRARj@yF@x R%qAT?2RURRxRRЃR@!Ra@yF@xR qATb RURRx R RЃRRG@yF@x RqAT"|R"|c2RbR<bc2R#@SA{è_8A9?$q T{RSrURRxRRDRpR?@yF@xRqAT RURRx R RЃ$RR@yF@x RqAT"|R1"|c2RgbR|@<c2SAb{èR_{SF?J@A!>wJ1Ta@y`*9!2ayJ@A!H>lJ1Ta@y`69!2aySAR{¨_C@ye6 @9$@9F@y *k!T6(@9,@9F@y *kAT60@94@9F @y *khT60@94@9F@y *kT 6F(@9@9kT(6F,@9@9kAT06F0@9@9kT@9qT5 r_֣86D4@9 @9k!T@6D8@9 @9kTH6D<@9 @9kTP6 @9B@@9_kR R{S[Asb`bTSA[B{è_`@`7s.@FX?T@A7D>@5D@B4@B(@b֠_*!_q b9""9_D@4@@**֠_{S[ck*D@4@"@0BF@*?a@9? qTa@9?qaTb @9a@9A *?qT1T@!SA[BcCkD{Ũ_֠*D@c4@f@֠_D@B4@B@bR_D@B4@B@b֠_D@B4@B @b֠_D@B4@B$@b֠_{RS[XA*5@A@@b@b@?AT ;9[B*SA{Ĩ_!RDq`@zR>@*.@Cq*@z!T{ l>qT @{¨_s@){Ssz[*Rc*0ks`=xt@vB `D>qAT=@9* 5{rz;>?@`D@o`@kJ@! ˩)!;D(?a TM)BB>A x{@*SA[BcCkDsE)_=?@@@7h4R;;@=a@ @;@)=* 4@Qt4;@oC=4YI9'H5{@kT I6@@y`5)A3`5ւ!@"@<*5?@@L=?@;4RA!>>*`5;@=;@{ <=BRR94a@*@@?! @ H {è_{S4[c#m{96R#@SA[BcC{ƨ_ !R"9CR3@5+@uw>@+@@sb+@ab@?T@!RR;9sb+@`b"@ T@43@sb+@`b"@ TwxnAsb`b T+@C@R@@5+@5`D{9 7 p<*L1Ta@@?!s.@ Hsb 4a@|cRA*5/@2Ra@!L3KTB*_qT`pCR@SA{è_{@?!x?DԐR#rRR01T`+ {_R{@?!2?DԐRR#r*1T` {_}˫R{S@@?` @@?6v?a @ԐR#rR R` @4@@SA{è,b @|@!@#~A"@?B2?a @!"kLT  ?` @RR*` @5@SA{è_{{;{S*[ck*sDkT@!'TSAcCkDsE{ɨ_֡b?TRk,TK  Rsu66#` :z` #`` @Rt`@RpuJSO!~ S2w$l@:S )$*?kHTa~!|@!!zT` @!z!O`@AL*Aq T`@@` @2`@?< @-@ 4`@q` @om R(Qi @`@& )z3k2 i! R)+@G<S Q)? q@T?q0*s@C!*w@ )!* Rr)?@!Q?q!Rr3@zC@(R@h!zSa>S!|*2*)J@@@A @L)@@!LL)@@?@Lo@@KB (AR @ 4*A*<**{S[c@5**AQ*V@v6  @j{T@@ *AqT @* >"T@H@ @*SA[BcC{Ĩ_{S[*"Rsbq}!`R T @TDq@SA[B{Ĩ_D{S[ckzs*D7qןq @zT7@ @!!LSxS |z;!@>I@R R#;@RxO~?l@KS`3c@2@ q TqO*;S@(SO@*Rr*aD9c Sbl**7@? qT?q0*R) B9B&R7@{S)CS* R(R R:,~zZKfZ["}*_khj Zә)@;S_* **Ȁ)B@ SyS@(R_@ RI RU)@4@d RARЁR4RrtR)` `4@}4*@9K!@ cJ?qlT~z"Ray bj Rr")2`C3@Gz;@wu` @@??a @ ` @@? (72?a @ԐRR#r *` @w1T@ bQ;~zqR}Rt@K3@HG@EB @886;@بK@TR@@`C3@4` @@?2?a @RR *` @?*1T@T 9` @@?ՠ(6?` @R57@@@zT7@!IA`*R@4BSR!!Qb@_ qT@!SA* R@SA[B{Ĩsb@_qT!x!2@RSA[B{Ĩ_{SSH5RR*SA{¨_$RRR!RM@ R!?kTAct8!t_R \̩ z @|SF FI*6@ {S[cks4D3wU4q!Tq6wBI b_T@С~Sd[B*SAcCkDsE{̨_֔@@X63@IR!:H T@"@?#@9dR!@9a *#@94QjT?`BkT*@o"@9!@9A *"ZB<?q TR_khT?qT#`R_k(T?q T?$q T@I? qaT4D?!R" @9r !@9A *?q@T? qT?qT2?ՀG?qT?qT?qAT Rsy@R @9!@9 * |SqT qTqT@  @qT!B!!x`@h8"@94@9T *kҀ?@zT3@~@t: R{@@T`: s" @9!@9A *"|SBQ_qT"R" @9!@9A *R~@R|Ӡjt?6B9!29 ?0qT?@qT? qTB9!296B9!29 ?qTB9!296B9!29 6B9!29H6B9!296B9!296B9!296B9!29 7RB9!2B9!2B9292m2k4D?$ @9 R!@9rb *? q`TT?q@T@T?DqT?<qIT!@Q!<@@xa@*?ՀD? LQ<qITQb ?Ղ R!'a@R!p'] @9qA T @9r-TtFI*46T@ @eaR*dRR @@l!R`+ @bAkTc`."VRA!t\S@!|S?,qTHT?qT?qT@@(!|S ?LqT?XqT@TLw @*4@lj5@@@@0R$q"T @9r!T`FvnD9R qT@@R֒@*R kHT@@\=@C!h#l*R s kTR_* 4@"M˔D9 R$ kTD9)D96@_kA!Z!*D9RRoo@kTJD9'"6`@qT;yCy`@ q@T(TqTqT-Rc(XD9D9 *SRqaT4D9qcb_@qRcccQqTs@}B< R` D9S(b5D9RZqCKc RRqaTD9qc`@qRccc4D9RpSZqCK@RccQ(qcq T-F9:F9D9GO7)W @**t"R!R? @. G@@?@D9c<SD9@|S! *aSSc`*pSm *)KD9D9@a *@*! *D9q`R!* @@G+IW@ @@!(@*!D9@R`<@*H`6 R$)MR Rt)3@cCkD[BSAsEw@{̨[ kRy{S[aFI V@@@@LR~@ @ykTV@R@ V@R@ yAR!RSA[B{èHSAR[B{è_{S[ 1 1t9*5v@?ՠ:@!?\*?ՠ:7`"!@'@?"|Sb"9@x@? 6bb9`b9@ yb"9H`"96ab9`b9 @a"9H`"9@@?!2?ЇRRD!Rh* 4T*SA[B{è_`6@?`6@?@?@5|S"\P@!|Skuryt{ 0@n` @@?a @x? `6@@?a6@t?  @R{¨_{S[Ac, ! R\?@@`@ATWT[BSA{èOv@MI$@zT{Ac !R\ǡ@!z!!z{!dzS*҇AcP!bR\*R*SA{¨_{S*AcJӿqT @FI?`@kTc9FR!!<\ǠuPPQkTFRc9!R*@ @>J` @|SqTb@FI?`BkTqSz TТHRc9 @*+@R*ABFI* @FI?`BkT@ RkT"JRc9[BcCSA{ĨSA[BcC{Ĩ_{[S*ckGӔRsFIbgJS_xSKg@ T@ @@@!@*m@ qT*94:@K!<rd @z?kK Tb@B *@ 5@@;@+@k* R* 8KkoГyk@+Rq?qT2W2@** **?2?@|qR?qC D*ןCC{ K9Q#)?C@ R<|KC@qӀkMTH+@@9!@@2 R;@*k@R^* Ҡ: SA*[BcCkDsE{ʨ_@?@T @\sK @g@_`@kTc"gR!!<\ğrPPQkTBgRc*o@ D?Z{S[*ckGsFIbR_:T@KSxSK`5 @@qT`@@@a@*@B 4SA[BcCkDsE{Ȩ_t 6@7*@g*arQyq!?qhTaH6qT922_q@9@9A  @9"@@9A`@9s@9A @9"@@9A`wR"R{yRR4*qmT9@6{2**%RR|qRB; D*{*@*g*"R9 *|S<S*@R;*R*)7@*g@=R|@ @_c@kTc(R!!<\ RPPQkT"Rc(*&DT*fqT*6.@94qTRID?ZS*: Ҁ KI{S(*`TRSA{¨_֠{S[((`@@?ՠD!!h65@!R9* 4 [B*SA{Ĩ_!R)D*{S[ck @9@4*C@@9`5%`Ts`@9`55ju8qTtsb_kB_kTQ*k 8 x!M*SA[BcCkD{Ũ__J_ J  _{S*[c*qT@`@9q`TR 8"& R "Q`@84q T2RSA[BcC{ɨ_ q`T @@*!`(qB:VRzvv kLT@ * #ARzab@885!9k T@T8[*GHc`(!Rp 7@TC |#ҝ{BT8@"@86C@Ra @95ARR{è_aR R{ ȝ @{¨{!8 { @{Ĩ_*BJB94@*@d"{C"@C86RDEc`(CR@@@{ƨ_ARRARq {S@?ATSA{è_{ _oa@97b@9` @9*b@9*b@9!*b@9!**r @{¨_R{S5!!,$pSA{Ĩ_{S <$.SA{¨_{S**SA{¨ySA{¨_{@9?qT!PQ " _q$0{_ R{ $q{_*@"q{ARRARq {_{ *7 $Ad2!"`(RRR"N5 @{¨TC4ң2R"aRB%R @"@@" @{¨_*@5B2D2RR"A!"`(*{S*4;2RZ/@k TR % SA{è_*`(RRR;~4@"@y@"R%"Х%TCB%C:RaRRR &{R;~RRS`(?ҥ6TC#FR"aRB%R RSA{è_;2R `R@JB95R %b{S[*cksg6@9q! T`@9qTs ?qyR<`(9&;R7`&;7@*#* 4G@@g@QkT*c'>53[B*SAcCkDsE{ɨ_5s  kLTz54;@QZ G@b@?K@?@Z4@Zq!!&h3Z5R?q@R_{@4c!!˂*@!DbU!|R!|"T{_@kT{[6&RS7*@R~ STN9` @A"Ay"Ta@` @?*`5DUN9@*SA[B{Ĩ_1aT1{`R ANB9` 'a@a@! `(~S* @{¨_b @ šB"AyT t' ?*4* 'iDe{S3[*5R* R~4 1T@"R@* R@J9@*SA[B{Ĩ_ր@?*5 @B"Ay"*@"y 1T @B"Ay"*@"y@JB9qsS {S[cH!|c!!!(#ړ4SBw@ *#4`@+ Ty ` #` @ o ` R{@SA[BcC _`@ `/A{S[cR4B`4|@v t*SA[BcC{Ĩ_AR8э΍' ?*`4 kT|@O @@Ǔj88 UR4R{S!0*@5@@@ @ *SA{Ĩ_ֳ3@4$@9qT$@9x`qAT!c R%@9he84jTBA_֥6!kTR_{`(Ss1!+ (hdRSA{¨_{Sa@9T":KSA{¨_a@9 )*R{STa@9T:}KSA{¨_a@9 *R{Sa!0 X``*SA{¨_{Rc`(#SEFR'@'@SAR{Ǩ_Z'@{RcCR Re@? T?!T@9qT@9x`qT @9qTqT5'qATR{¨_{S[@sy2J94 +2 ZZD` ( 4SA[B{Ĩ_ `5 `{*S*b4@t@i))qTj@J _q T,T_ q T_ q@T_qT7q T q Tl4R_q` T_qaT@ : hj8 +b@SA{Ĩ_R @@94 R @@9a5! AT @9qT @9x`q @9Qq! AzITQqT! ! $ 6 @9 RRcR@T@9 qT?qTqTa4 8`@6 , R`@(6 @-76`3s -E4`@'6  .R_{baB!S![4DSA[B{è_RsskTa@ @4sB{`(Ss!& .RSA{¨_{Rc`(#3 EFR<'@'@ @R{Ǩ_@'@{ RS[@v6J4 26 ^^D ` . 4SA[B{Ө_`5~`@` R_{SROt* 4 R2m*SA{è_@"@{S*5*5 T3}@BR@s*5 3s@BRs*5@ i{@*SA@_{AS @R 4/*SA{è_*5@BR@s*4 RH4%R!RL*5 R@J9_{S`;2Ra@kT RT*@J9RSA{¨__J9 __R___ր_֡* (!8J_k`T@_k T Ak`- /_֠ +_______{$R["#cb%*S7*s(R4`@`4kaT@`aB@96b@@?`5b@"4P SA[BcC{Ĩ_sBqT{?qS[*"#MT*5(@D@?5@RP @*SA[B{Ĩ_sBq!T{ `H}$@? @{¨_{H p@ ?** @{¨_{H `@ ?** @{¨_{H O@@?** @{¨_{H ; @ ?** @{¨_{S[H# @?*6@T%ҥ4RR"aRBH5R*SA[B{è_{H ,@@?*w4KT @{è_D@@!PI{ @@2H0@@?*V4KT @{è_@ { @@H4@ ? @{¨;_{S[cTCKSA[BcC{Ĩ_"H_qTk5x**  6nR_(qTh@b6755RR8{H 8@ ?** @{¨_{H o<@ ?** @{¨_{SH]@@@?`6%ҥ6C^R"aRBH5R@@*SA{è_*{H <D@@?*q`Z @{¨_{S_qT`@*J*43R*SA{è_ր@7@>{@QS[*ckq)TSA*[BcCkD{Ǩ_`@* qTa@*4%"7BH5fRaRR 8RqmT@cF@/@? T@95qT@qT 1@ |7@"qT@HB@@?*53@+TE@?*#6%ҥ8jR"aRBH5R ˿T/7R R@4%ҥ7KR"aRBH5Rts 7@ 9K x9~@7@}!'՚|9y( v.7@T{@QS*qT`@* qTa@r 5qAT`@qSA{¨_41 R{ *Y5 @{¨ @R{¨_{@QS[*c#qT`@*B* 44R#@*SA[BcC{ƨ_`@pyBlqaT`@fZc*P7/@ 9ǔ x9s~@/@}!'Ӛ|x9( {@ QSqHT`@*R*5H@q!T@E@*SA{è_ր3R_qT{*`@ @5`@)q @{¨__ R_qAT{* `@5`@$4f@%"9BH5CRaRR R @{¨___qT{*`@ @5`Aq @{¨__ R{S[cks_q!T`@zA**5[RU|@* !VAQ``8qTR`j;8`<6r@*^5q(*SA[BcCkDsE{ƨ_4R4R{ :Ss([zRcWRR"T5( RSA[BcC{Ĩ_`@4b@qΓsB%_cEcT@T_{S[ ?4E` s[B*SA{Ĩ_CR E! q!TR@ E!` @3`{ @ @{¨_{S  E!< *@ E!*SA{è_R {B  5 {_RE {RR{__R={ @l @{¨{DS4R[6cWRks(@@K @7@ ` wA9"ca7@?@5mT*˟qd@lTcSA[BcCkDsE{Ϩ_a4~@! G@! 7 @O S` ?@~@5T_T7@** <rTK@cRA9c* "O@gB9K @S@g@T@ kC@T K)K _T_T$(Z$ K(*R7@**[ 4@~@[@|@($7|@~@( T7@**[ <r[@TG@R[ˀKbK_kBЀB|@[@{CR#S[c?'@ E! q T'@@4'@aA @?kT4 @ @5'@ E![B*SAcC{Ϩ_vb0RR'@aA @?kTCc**1 T@y4{A9aAb4'@C{A9cbaA{A9! *1TB8'@9@3[@@4@y  @qT(@qT@qtS`aBs@Rw@a{@a`A@y `o@ `R@R4EE`_{S#[r `64@SA[B{Ũ_S'@{S*@`@T`@kT~@U`*R 5~R@SA{è_ut R(@y@B|_ @XA _ !`X_!(@y@y?qaTAX@y@ _!(@y@?qaTA @_!(@y@?qaTA$@_!(@y@?qaTA(@_!|?k@_{S[c*k0@@(@!z!S'šc!@!E&&z3#EiT P;l@ ;h ;e?SA[BcCkD{Ũ_"*]2@"4"*E@ Ú@Dڥ@(B bKB|@(q`T hb8#Rc djT* h"8R_@BR!"@9_jATB*"9Q R! E@ Ú@Dڥ@(B bKB|@(q T#hb8 R j`T` h"8_@BR!"@9_j T@ 9Q R! cEc(@BRCr@ |@aT!R"@9_jTB*R"9_k!B RbDZBQ cEc(@BRCr@ |@AT!R"@9_j`T@ 9_k!B RbDZBQ {S*@/ d@ 6`*@y!|t@ddd<b*@y_qTBQB|@d<SA*{è_R{ES[cks @@RY` @RU@T`@y4`"@*`"`"@c @ ښ*qT @54Q`@kT`*@yw@|5fqATt"B 9kAT`">`@kb T`*@yt@|4&@y~}6`@b @9{hzBb @a@*!hz|&y`@hzd@RpS!@9?q Tq RBA6* qT j!TB *!*!9B|@b"_`T` @~pS`"`@y`y`*@y@yqaTZ@yB@ BQy`*@yqaTB|SZya@" @ XAB@ ` XR`@b @|<rT*t` 4  J*R&@y~}/6`@*{{h|މb @*|?&yaC*!h|`4t"@m LkT`@b @R|<r T*@54 `*@y@yqaTZ@y!@ !Qy`*@yqaT!|SZya@" @ XAB@ ` X`B@SA[BcCkDsE{ƨ_{s` ES[ck(@o@R^` @RZ@@T`@d@`@yD4uZ@o@uZt@ `*@y|~}Ӕ&@y6b @{{*|&y`*@b @h|f`*@*h|`Z@i5@{LkT`@b @R|=<rT@`5U{ a*@y@y?qaT^@y@ Q<yb*@y_qaT|S^yX4:ya@ @Q RP`Z@SA[BcCkDsE{Ǩ_ւ(@! 9_kT`ZCz<`@_k T`*@yt@|@yqaT^@y@ D4&@yfX4:y\}6b @9{*|p&y`*@b @h|`*@h|-d E!R"@9_qT@(RkT$kb8 7*&R*$k"81To@@a*@y`Z`@y`y@y?qaT^@y@ Qya*@y?qaT|S^y4a*@y:@y?qaTf@y@ Q:ya*@y?qaT|Sfya@ @Q R`@b @|<rT*=4!j`T qATB*RR{[*cSkskL!TS4@RdRX<s4* @RV@ @R|e<raTa!$)@ SA[BcCkDsE{Ȩ_ւz4z~*@R @|* @R??rTҀ @|S9Tjz9sq9T @~`Z4RR d @Rч @|SI?kT  `~@Rx > [@  E2Qxt#2Q6|@BKc0k TT|@`~@R^?  _@!L _kTE**R ՚`5l!I?kT?  `~@R7@3 _@  D `~@R*(3 " ֚EBL;~!h{# kT**R ՚)5q!I?k@TR?  `~@R3 Eh{ @ 9Dxy9 !|9TK9|@~@`~@R~I  c@AL _kTE**R ՚54AI?kT_  `~@R~@S c@ @ D `~@R~P  ٚEAL9~hy _kTD**R ՚5(AI?k@T_  `~@R~S Ehy @  D`~@R~~  3 " D֚CLAxw! ?kT֚!;~Dxa*R ՚~@4Dh{ @  DxwI?k`T?  `~@RP~ ` {S[cks{@R>~3X<`SA*[BcCkDsE{Ȩ_ր @R-~3@s9C',tw!@E8@@('Q @*T@ @R|$4* k*@5Rz @y4 @`@9BK_k T,w@@ _kcTz y*yB:*1! TqTQX @ @@63@#!/qT4i*1T @3@|] @H8+@ @! !@ @"@@$@ * 4rR"K B{  o@ks@TC@T?RKB<8@B s@B kT@yz ykRsB:`j{S[cks@RE@(9' @b}R@c7kTSA*[BcCkDsE{Ǩ_*/ T@ @R|[ 4R|5~@ @yqiT`jz 4Ӄ@9_aT#5ujzqTu @ kT@T7@J{S[cksc7R}:61RR |`ۃ}R|˃zR|`<Ro}6j;R|R|VR"E7R@3@@ZkTa@9*cz`1ATqATVR@7R*1`Tt@yp6 /R|j;'Ҝmq TZwR*{#H5c@*~}ӀjwTjw7@yTsuSA*[BcCkDsE{Ϩ_R {wklT"v{3sESaD[Rck@8@('o`; S ?o@kT`D*LTSA*[BcCkDsE{Ȩ_l@R |@@~@ @R|5H1TRx7~@ @yqIT`jy43@@9_T3@#c5ujyqmT?@ *5z@ @y @y @ y*4 @ kT@T;@j9u{ `E   `D  `D  @{¨_{SEa E!` E` SA{¨{S[cks@ 5@"@` 5R)A9b 4@@|c a"R 7Rk{@`A9k@ak 8A94qT\Rz4Xˁ5 R?SA[BcCkDsE{Ǩ_qaTRq@b"5R R``@y @q T(@qT @qz?@y @kT*7@y5 DR@{S[ck@B|@Rc"ˠ_3O@9q T@49#'R~ _@3@q TL R8@9qTsL 5RSA[BcCkD{Ǩ_֠_@qAT @3@  qT%@ 4@Rz 5@9qTEs*4w@9@53@_@@@"@5@_q*T߀@j 8i`77@{ *CR/ R @{è_\@4qT/@q qaT/@q{[S E!#R@4`@ 4`@RSA[B{Ĩ_`@b"a@5 E!{SR6z^4ar@y`R?k!T`N@5RRfb@ Rrj@TХ< B ң(RaRRc`@y`b@?6`Ay*y@ b"bAR`4 @SA{è_M R{SW0 b@"a @|N0@(@Ks&ԚSA{¨_{S*[*=**[BSA{è0@! EAI{ -0@ @@@{¨E(@*(!|@{SR@RN`@kTR`@kTa @c@b"@*`|"|a@?@pSAl{è_** >yb @a@*!t`|>$* b @a*@*!t`|>{ @(@y"Qc@K |@a"Rmy` a"@b @`@d@B|R|z*`@5 @{¨_4P |`{S@RHy@RER!*`@b @R|Nb @*~xm`@Wa@R `@x `a@`@k`@``*@`@d"yZy@SA{˨_֕~}huW`@h5a@`@?kTPR~}huH`*@h5a@`*@?kTA*R{[SI E@ R!( ` a2@!(@$`Rx`4c*@5 E"@ @! @@Kca @?q!a)N1T t(`@R}ӿx`R`@kTR`@khT|}Rx`*`R`@kHTR`@k(TR`@kT`@ T`@ @*SA[B{Ĩ_w@~}` @Rxj6`@hv*a@d@b @#uR|<rTw*@~}` @Rvxj6`*@hv*a*@d@b @#uR||<rT* tC {S[Ecks?O_?z RST@qGzT`@R8x B@4 Xt`Drps`@X`@j`TХ ңnRaRB R^d@`jTҥ coRaA)"R S@*?1T!D5D @`6S@*1@[T`@Rw@@*4+E @(@)7@Rw7W@CEN<rVT @@"@q*Ay (@qT@?q@7E @@Rw4քE @@Rw@4ɄE @@Rw'4@9c2Q)k!CTA)@ @* @@!Q8:ZR  @Z @uw`K@ @R|<r@T*5@RB:x~*G5*@*{@*@y @y?qaT!_@y@  y*@y?qaT|S _y@ @ 7@R @Z~@R7@ @|T<r T*7@@5pk=*>4 Rr7@o+A4 @?qT:_q9K@**!y'*w@y+@y_qaTX@y!@ !y+@y_qaT!|SXy@A @!A aL?kTu@ @R| 4*@5y 6>/A4 @Rv /A@Ђ @{C2RҀ| @ |ST/Az ?qTY?qZK*0@*z*+@y!@yqaT [@y!@ !!y+@yqaT!|S![y@ @ `L_k@T'@ @R|<rT*P@5z {z`4?qTqK*@*;w{z;@+@ya@yqaT`X@y!@ !ay+@yqaT!|SaXy@ @ `@kT@ @R;|<rT;@*@5wZҽ3A 4 @RVv3A@ @{32RҠ|b @@|ST3A_qTqK@**!xK*@y*@y_qaTX@y!@ !y*@y_qaT!|SXy@A @!A aLk T@ @R|0<r T*@ 5x P {z 4*R v;@ %{zR@;@ @|W @W@ |ST;@D {z @?qT?qK@**!x*N@y*@y_qaTX@y!@ !y*@y_qaT!|SXy@A @!A a@k` TM @R;|;@@R @|<rTs@q4;;@&;@W@xb@4?qT?qK@**!x* @y*@y_qaTX@y!@ !y*@y_qaT!|SXy@A @!A a@k`T @ @Rg|<rTg@*1@5xW@W|xZ0;@CV T ؚ @*_qT"B55Q@*!uu*@y*@y_qaTX@y!@ !y*@y_qaT!|SXy@A @!A !@k T@7@R @|[<r T7@*55@7@~"yZy5?@a @@Gz?@@*a*`@ @kBT`tS@@*1T`@R u {@@qaTy4?@O@M{?V@yy>@y R~)*6yCq@` @|R| S` @t@E(@ Q=`_@!(@ @  RbA)~`@|*r5b@B7{*s*`5@ R0@k(@E@{+`K{@R?k 3{ @R{@:QZ @ k@@kT1T @* ؚ){@1T^k@ @hT#B9@@ #*1T*T J O@* @ Ok@k @*K ؚK@@*O@j **1T @* ؚ@*E(@@_@@B(@!Q7@ b@@999Tb @RH{`@b @R|E*5ADB9b@V{* ~5^"yZyc@Da__s@{@SA[BcCkDsEC _*DB97{ l@Q l*{ST!SA{¨_#R4t{S}zSAR{¨{S1(zs@?1@T @#|@@*s`|^T@SA{è_{SД(zs@?1aTе"5Ҡzs@?1ATҠjsjss" AT!R@pSAl{èh_@sT@sT{S[c#@ @qhT"5R`"@7khTR \B#RaRR`#@SA[BcC{Ũ_րRz`` @ds z`@b @z` @@ `{S*[cvs"5az`!@?1T?kTTRrxz` @6sr`z`@ @_zr@r``RA!x/`JSA[BcC{Ĩ_`{S[c*oA!)`4SA[BcC{Ĩ_s(nxz`@ @Rrn`z`@` @$zn@n``R`{SA@SA{èRr |R @r` @y Lq!T<? S@@SA{è_<@<3{SB@B@B!R<SA {¨_`@s@@B@@b_E@@cZ?kT @RZkkTB@cZ`TcR{S[c*k@R|r` @Rxr@aTSA[BcCkD{ͨ_CRRE*CCd@b @R|qb @"~@5kT8@bg C@jz @Z!Z 4*C&d@Rb @|Tjzb @Z|6qTW{S[*cks@d@P7` @Rr` @Rr`]`SA[BcCkDsE{Ϩ_RERd@b @R|`@`@6qTX@4&@`72&@qR ZR R@RRg*b @R7x7@R`@b @|@)@_kaT?kT*qT@ RZZ)`@a@R `@2 `a@P`@Rb @*`|ER5d @*R  kTB@`!_g6*8R<_kT?kT!Zg@!!Zj`T*R_kT?kTv5?kTf{S["5c#(!R@ Rr<lhRZq#@SA[BcC{Ũ_RNq@q@@@T @@qTRH d9^PBpQ? 9?$9! ?9? 9?9?9?9?9?$9?(9?,9?49?89?<9"@9 H9~S L9A9 *abA9`fA9 ajA9@`nA9 `.aA9`A9 a A9@`A9 `aA9`A9 aA9`A9 2aRA9`VA9 aZA9@`^A9 `6`A9bA9 *y`@9a@9 `@9 @a@9``@9 a@9`@9 a@9`A9cA9fA9 `A9`@``A9cA9dA9 `A9`@``B9|cB9 F9`39e@93c@9 e@9e@c@9`e@9ec@9e@9ec@9cA9eA9e cA9@eA9e`gA9cA9 gA9g@cA9`gB9cB9 g B9g@cB99`ZC?T P8ҦRGRVGaRBL8RI R  @9RGBL8VG5RaRR6A=.  @:~@RGҧVG6RaRBL8R$c @@qT@qT6B _ @qT&5@y (@q!TAQ??qhTR|@aah@?h 8{BSC[D_`RRRRvvt{ &b*Da.DA"*`:@.`,RN`v@` E`@`B`B`z@`D`@u&`Ci`Ax@`A @{¨_{RSt|@[)Za`@R@srt*`?@4|@@SA[B{Ĩ_su`ҡ@g{S[ck@@9qT`F;BL8ң5R@aRRn{BSC[DcEkF_@@9qT@@9qT@ @9*!RqAzTA@94a"RR j6 J`8`6`Rn?@@9! 5*"RRi@TRE`@k@!.B B''$%B%%("B929Ҁ`R:B;iRGi*B!pZ@iT*~@,i?|qT@9j`86R/n?@@95*"R?q R$@zT@94*"R?0@z@`CSka_Tig`RG"RaVGwi`@(T z.RJ9`EqXW`Z/a@`X9"P@@3`9b"g9!(@!<S"3b"'9 7cYRfRGgVG|@`4dџTkT h9҃[RfRGgVG h9?fRG#ZRgVGaRBL8R2# c5#|@4dџaTqMT`ERdK! ad&! aRaRa@RaRaRaRajb*an!;arav{@a !  C|@a```R@r_kBЀb6$*5`"g92`"'9`EkjT*|*@7qT`"g9x`"'9a"g9`C@A6`bX9fRG!;gVG_@:!!=BL8ңRaRR`B*`B`z@`D`@n$ R`Rc`?qLTc`!T =҃RfRGgVGBL8aRRR L_``x`慹RE_`@`B96`B`TR`6R;_``6A@qmTt6`BTy!R 3`By`B9x`9`"g92`"'9*5aV@`"g9x!D`"'9xa@a@ =fRGPgVGRxABL8aRRU`EaE|@!| aaE"BhSbbED|@B0Bpbd!|dj@"p!!paaEb" KB|! kT H0pCkRfRGgVGaRBL8R#_e>@*QBBaF!bbzE! !?kT H0#mRfRGgVG҄aF'Ra!$ҡ|!D?!`aBJT`>*5aEcFK`E" BQKB c|@` |@B|@a!BBR^`v `j@AU? T:t`v@* RR|9^`:Zsaj@`:@k T@9!29a:@ `A9x `9!bRG` cVGlkP*@5r#aD`#``Eaj@ QbKa慹|@!!|s#L``@@96`"g92`"'9bC!RBABR *5a>CM#*5)* 5G#bC`aDBS!S#*@ 5`X97`"g9 70#* 5.#* 5`"g9!x`"'92@ Td9 a:@!4*5`:@`:@$`:@`A9!2`9`"g96(*4a"H?1T P*(BL8fRGgVGxRaRR5Bu(@Tu"@T7-(`b>u|>@bERRRR>aX97x`"'9b*Da.DA"*.@A"|@A@"|Rq `@` E`:@ Bq2*@* u{ *4@* @{¨_{ A`x@!R` 5:R_@Tj @{¨_{?qR"sd@pqHT {¨_RcR95 pqHT _D| A !|{Sԅ"?@RC]@RRRR5*4~@SA{¨_s{S[ g9a6 Lj*{CSD[E_@iT*@A9DA9 aJA9@`NA9 `"bA9aA9A bA9"@aA9A`&qm"TX9b6?qTR 0#, +ңERRGB VGaRR7&@q9T1B929`j@9@ 4q Tun@9 5Ra@9`@9 a@9@`@9 `a@9`@9 a@9@`@9 `a@9`@9 a@9@`@9 `a@9`@9 a@9`@9 >a@9`@9 a@9@`@9 `za@9`@9 a@9@`@9 `aA9`A9 a A9@`A9 `aA9`A9 aA9@`A9 `ja"A9`&A9 a*A9@`.A9 `a2A9`6A9 a:A9@`>A9 ` aA9`A9 aA9@`A9 `aA9`A9 aA9`A9 abA9`fA9 ajA9@`nA9 ` arA9`vA9 azA9@`~A9 ` `r@9av@9v~@9 `z@9 @`BTy`06bA9aA9BA bA9"@aA9A`aac BӁB9AS*3E9ZGkTEkT?k ЂzEEEH C|$CC g QE ) Qc   QcK B'gn@9'5j@9g@9G!j@9@ g@9GaE k` T *t.RRGVGaRB RR R *@RGB VG:RaRRAL qT 0H ҆RGCHRVGaRB R+(9!'9 0 cKRRGVGB aRRaRA9`VA9 B939`j@9g@9G!j@9@ g@9GakT *.R҆RGVG_qTqTqmT q-Tj@B _klT?kT *#҃1RRGB VGaRRE_kT *C2RRGVGkaR>@|!-T *RG҇VG3RRB [|#T *pRG҇VG4R qaTE?qMT΅c0!|!pkTI7?qTB QBKBK?kTDkTaA9`A9 aA9@`A9 `?RQAsrkTR'@R%`R#R! R@R`RR5R{S[3[`[cD$R*R @T*1T\"@43@{CSD[E_@q 0T@"@q!0T@`@*"b&@p cD$RRAR| @T@ka-TW-4 @D)q!0T?k,T@=`@!``Kb+5v2S a@"@9 @9@ "@9@ @9@`x 9#A9"A9b #A9C@"A9b`b#A9"A9b #A9C@"A9b`b#B9"B9b #B9C@" B9b`b#B9"B9b #B9C@"B9b`b# B9"$B9b #(B9C@",B9b`bz #0B9"4B9b #8B9C@"@@7aEkTcEbQ_jaT`@dEk*TfEkT`@?kmT@!T`@bGkTbGkT`"HkmTk,T`@k TkT`A B@7?k T*5j>CbEE|!_ @AT_ThE`HkTgEklT`H 7iH ?kT`HkTkKTiH 74 5? kkTczIkLTk Tc~I 7iHc ?kK TcB96cIk Tk TcIc 7gHc ?k TaIk Tk Ta"F 7CQ?k, Ta*F! 7BQ?k TbC  T_@A TcCC @ Ta"C ?@ TB# Td&Cc*C!!! T _T@T_kT@TR Rҥ`2AR *BhaRfRGRgVG@R`RRRRRR R@R`RRRRRR R@R`RRRR`3!C)#RHK@!xSc cJ *_ RB96{* @?kT'@QqmTEqTH!KƠ@)54HHEk TEkT_q!BzKT@TR{_"@@QqmTEqTH!KƠ@)54_HHEk TEkT_q!BzKT@TR_EaRE$RE!K ! R! _k T R"R  ! *_k TE*4Z R)KE! Qh*4DZ RkK lqTZRKe Rp t qTZ REKxcqTcZ RCK B9 B|  IJBxSE}Bl  l!|R|!|B }$ !"?)c|  )"clc J4B#?k|@!#|@A!f&˿kTԅcca!d_քBtS! B!  !{S43A)B 4DT@SA{è_HRRQctSklT@*_%*!|*B96{! @ @?kaTƠ"@)7EkTEHC c7kTc** 5B kT!?aT{_֠Ơ"@)7EkkTEHC c7kTc**5B kT!?aT_֠_{C EdD"|@@*šE_kTХQG UGh #RaRBR"{A_րH?kTQG UGh ҥRU@R'@R@H K|4qTTqT qTRBKc @9B(C**E|c B%`$"_ֿqT@9@9C  @9b@@9C`*@9@9@9C * @9@9B<SC *@9c* qT,Tq TqaT@9@9 *qT@9@9 @9e@ @9`*@9@9@9<S *@9c*C*R{S#G'A " Q*B|@7b>_ k T<s> (#sRaRRGBVGR{BSCC_R*R{u kT&QG'UG #vRaRBRl{B_R{R[!S75`B96bzHG"bjH@pSbjH;pS"R6qhSe^!*TbH[BSA{ĨuSA[B{Ĩ__q$@z TED!KR!# @ _#@H!a!(@{HH72H{xI{_{S"@@9B7#B;C"@D@$#Bբ7HB@SA{è_R ҞU  \` @b}@`@A3@aT @ H@` rs{#R!S7/`5`B96bzH"bnH)AbE bEB_k brH A?TbH@SA{Ĩ@SA{Ĩ_C{S[c*kChD@|| 9hE)R /U 85`B96*"** 5`B97*"4@Q)C@*{CSD[EcFkGC_HHdH**%R*5~@4= B#ÛRaRfRGRgVG-+`Htru{ 3"c@4|@ @{¨_c@C{c8"S[kC@{jDkE)*RҹT5`B96"@*i"`ET*f4(!9:#fRGgVG㣀RaRR*:"@*fRGgVG8Х8"CRaRR~@-dH**%R*`5H4`B97"@*"B^aE  aE?kT?kT`H`@@C@{CSD[EcFkGC_*u{S[*cpDaR4|@SA[BcC{Ĩ_rDi@TH6REzSKH*BkTG@T@@97!B;C` @@b !B`7HHa@` (@ {ӵ Q@T4@TRS [2 @!}!@kv5` @` HHa@` (@a@ @iTaւߢaTs{S[5R[B*SA{Ĩ_RRbE@| S`tRjaH`HkR|@S`j`t#u$ RRҒS`BZ?)TR҉S`@ ``RS`dHazIc~I%R*5 CR72*`5R`E?kTbH*4kvH * **J7aE_kT7kTB ?k+TbD!},)Jh!bDB@`D @9Bx 9`D @9!x 9{S[*tDTB@9@6u`vD!Tv`Do`nDln`Di 5trDtbH5RkT@@TQAPT@@@? qTQ!!? qT4dH5Q?kTC@#!T@B@4!B@_T`zD)`D'`D%`D#`rD!`D@`jD[BSA{Ĩ@SA[B{Ĩ_*{S[+*"@9#@9& @9C "@9b@F`1` T"R rkTpqRsЀkT bj`8_8q`T*a4?@ +@{BSC[D_\q T*****%R 5`R@9qT`b@9af@9bB@9 `j@9 @an@9``F@9@ bJ@9@`N@9@`7 E ?k T5>"B## RRGaRVGR`@T5>4$c RaRRGB#VGR*R@ {S[*3*R:R 5**vREK*q @z T#R+aRE0%B#K0:RRGVG]~@Z3@{CSD[E_sEcQc Kc #_{SR*Qb"@9a&@9A b*@9"@a.@9A`b2@9"a6@9Ab:@9"a>@9A aR@9T)bB@9aF@9A bJ@9"@aN@9A`(aR@9? qHTa@a@" @ @@R@SA{è_՗RջrR`x&{SR[*#c**1;aRRRGVGERsK @qsҀ#RRGaRVGRh'{Ce~@[ESD&RcFR;@RARsY{S @TSA{¨@A"|{S*[u"c*3*EK@T3@{BSC[DcE_****qT KqlT1T`E!5QK! *qT KkT@9qT 5*+)RaRfRGB#gVGRg91 T1B#!*TqT)&RfRGRgVGaRO*-B#+RfRGaRgVGR>~@sp($RfRGgVGaRR/5**!*,B#fRGgVG+RaRRNq )ң%RfRGgVG*5B@9F@9 J@9@N@9 `piy5**#(RfRGB#gVGaRR@?1TQcdt?qT? qT@_@) @{**"4EQJR@*  e kT"|}@(h`("@&h %4Q*@*  h kT*kmT|}*iih kT"@hh"@h(*ExS@ kT@ }}*mii *k*TkmT|}*kil _kT  **@hi"@h){_#@4{**JR*cQ@*c f|} hf k-T'@hf'@h&5{__*_q TT{b4CQqTe<P#dH`HkjTd cxDa (_qT_q T @l * `uI`u _&(S *M*`xD}*hhFk-T@a$l@gD ``xD h( @{l * `uI`u _bDAa$ R@`bD @a%@`bD @aA%@``qI`q bD @a%@`D@ rTC4cQA#xDx!_cQqT#@C@@`! @A "@ 7E#@k`T$@Ae kT?q_4FkෟxSFkkTk+Tq`RRR RFkT"K_qHT Q_*{S[**c**E! @"KB{ӂB^8b7B6 @ 6`E@?kT`&FQ`& @(7@)! `Fk T`&C!`&`EK`"C!`"2k@TaC@Bp@K aE`@?k T_kT`"F`"2k TaC@rK `2k T @A (65`*FQ`* @(7@)! `FkMT`&C!`&`EKa"C `" @ 6`E@?kT`&F`&b @* kTQqT@8* |`S`BH `B@TSA[BcC{Ĩ_fb*CB b*?k!T`"FQ`4`*FWb*C@ `*qT Tg4Q@ |@aR!#HcQ#_kT%xDD|}<ch$`#xDchdb*!xD!hd`vI*Q`v qTqTAA"~`rIQ`r {S*[**c**3*C@iT*8.B0TRRGaRVGR3@*{BSC[DcE_@***s*d8 R@T*{S*[**c** @IT*d0B0ңYRRGaRVGRx*{BSC[DcE_@)*Rs* d8 R@T*{S[*PD)~@cc 5kTQҁ~@!a5UQ~@!a,U@@(c*kLT@@(~@`U`&@`&u5 R`.@SA[B{Ĩ_{CS[**RMX)bҀ@c~ "-!@`@kT`@d@T`@d `@kTKT1B2RG҇VG# RaRRR{ASB[C_`{ @` @{¨_D|@!"@b_{SC@qTbQRb!@!@A(@BqdT@T@SA{è_ D)bQ5 {S!@C@ $@ck T!@(@ $@Bk-T@T @5Rc@SA{è_R %R{S[ckYhB)7@X@***~S*4`2C:R#+B2aRRRGVG]q!T`@@?k!T`@@?k*{CSD[EcFkG_a@9`@9 a @9@`@9 `!R rkT`R@9kaT`B@9aF@9bN@9 `J@9 @`kATqTB96D}`TB Qa"B|@ojb@9a@9A b@9"@a@9A`kR{S[4@TRL * 5*4 @9@9@@ *_kBГB|@T5@kszSs@*SA[B{Ĩ_ *s~SszSs{S[c#aC@!a7qT R#@SA[BcC{ƨ_q!T1T`R5c@@b|@A${hd@kTDD@@kATqKT TqT$@QkAT`41aT`@W@/Sc1T5W@/@ @"{kb@kTD@@_kTZ`7q Tyq!T{S[#@cISR*SA[B{è_ g9#6*4qAT$* 4X *4RL3@!@@#@kTTD@#@kCT_ @#!RB@A,A@!C(@5!{S[*ckRsa&@Ey@?kT*q$ @T`*@`5R`.@4u*5Z@4 J)`5*ZRK@`SA[BcCkDsE{Ǩ_ր@@4 X)5bb"@ Eb5@!|S?qTk!TQ!|@cd@@@k Ta!D@!|S?qA T*:RRk TQZ4kTRCR! k+TcB@@kTaF@!|S?q!T~@d@@kTa!D@!|S?qTK* @@ !B;CՀ C !Bդ&R|&kLT*09q`[T`*@`5Pv*@"@W l5ARRKb4@K o!|@!aUR"@o@4@@(cRK`AR$a"@! @!@"B;CՁ C! "Ba"@L@P@T@X"@T!R *`*7{S[4@RJ@*qKTT*4,@9@9@@ *_kBГB|@5#$RaRfRGgVG 4R"@5@Rc$RaRfRGRgVGq R/RaR#1ТfRG=gVGB<5R]hXc΅c0c|` @'@(cic8@9g @9@ @9g`' @9@9#! @9i@ @9#a# @9 $@9*! (@9,@9?IA a iE kkTiE k T7iE klT@`T16'RfRGB<5gVGaRR@R}S61\7aR(RfRGB<5gVGR`R& 5{}{gFhFk5@ T1>5aR*RfRGgVG\8R`F9C*RaRfRGRgVGRikTkT1>5aR+RfRGgVG\8R`FҥL:`FC+RaRRfRGgVGRBB!"@C|@@@kCTT@cD@kTT1P;-RaRfRGB<5gVGRR|SQqT1\<c.RaRfRGB<5gVGRxR*{tC{S[6@!@~SOdB)*c@5b@@_kTb@@_kT`B) +>RGB<5VG;RaRRBM{BSC[DC_{a|@ E5@)|S7q*T`5?B?OqTBO BpDx`BO @{¨_օp$B\ **B,O,qT! X`_֠t_{S[ ck; @9!@9f@9 ` @9 @` R rk@Tң'RaRЀR{B[D&RSCcE#RkFR;@ARmJ#RaRЀRL`@9a@9f@9CRХ `@9 @aR`*RfR@9*cRaRRfV@9qT*xaңRaRЀRX`"@9a&@9f>@9RХ `*@9 @a.@9``2@9 a6@9`:@9 aRRz`B@9aF@9fN@9#R `J@9 @aR`*RkfR@9,qT0Xfxf  `b@9af@9dfn@9c)R `j@9 @`*{B[DaRSCRcEkF;@I`r@9av@9fj@9u~@9 `z@9 @`*4q'\3c*RaRЀR2fn@9Чq8ң*RaRЀR#**RaRЀR|S+RaRЀR SC+RaRЀR `@9a@9f@9+RХp `@9 @aR`*R`@9a@9f@9+RХ `@9 @aR`*R`@9a@9f@9+RХ `@9 @aR`*R`@9a@9f@9+RХ` `@9 @aR`*R`@9a@9f@9,RХ `@9 @a@9``@9 a@9`@9 aRR`@9a@9f@9C,RХ  `@9 @aR`*R`@9a@9f@9c,RХX  `@9 @aR`*R`A9aA9fA9,RХ  ` A9 @aR`*R`A9aA9fA9,RХ  `A9 @aR`*Ry`"A9a&A9f.A9,RХH  `*A9 @aR`*Rj`2A9a6A9f>A9,RХ  `:A9 @aR`*R[`RA9fVA9-RaRХ  *RP`A9aA9fA9C-RХ8  `A9 @aA9``A9 aA9`A9 aRR9`bA9afA9fnA9-RХ  `jA9 @aR`*R*`rA9avA9f~A9-RХ  `zA9 @aR`*R`BA9aFA9fNA9-RХ0  `JA9 @aR`*R `A9aA9-RfA9Х  `A9 @aR`*Rf .R{B[DaRSCRcEkF;@`b@9af@9f~@9.RХ(  `j@9 @an@9``r@9 av@9`z@9 aRR`@9a@9f@9#/RХ  `@9 @a@9``@9 a@9`@9 aRR`@9a@9f@9c/RХ| `@9 @aR`*R`@9a@9f@9/RХ  `@9 @aR`*R`@9a@9f@9/RХ( `@9 @aR`*R`@9a@9f@9/RХx `@9 @aR`*R`@9a@9f@9/RХ `@9 @aR`*Rq`@9a@9f@90RХ `@9 @aR`*Rb`A9aA9fA9#0RХh ` A9 @aR`*RS`A9aA9fA9C0RХ `A9 @aR`*RD`"A9a&A9f>A9c0RХ `*A9 @a.A9``2A9 a6A9`:A9 aRR-`A9aA9fA90R` `A9 @aR`*R`A9aA9fA90R `A9 @aR`*R`B9aB9fB90R ` B9 @aR`*R`B9aB9fB91RP `B9 @aR`*R`"B9a&B9f.B9#1R `*B9 @aR`*R`2B9a6B9f>B9C1R `:B9 @aR`*R`BB9aFB9fNB9c1R@ `JB9 @aR`*R`RB9aVB9f^B91R `ZB9 @aR`*R`bB9afB9fnB91R `jB9 @aR`*R`B9aB9fB91R `B9 @aR`*R`rB9avB9f~B91R0 `zB9 @aR`*R`B9aB9fB92R `B9 @aR`*Ry`BA9aFA9f^A9#2R `JA9 @aNA9``RA9 aVA9`ZA9 aRRb`bA9afA9f~A9c2R( `jA9 @anA9``rA9 avA9`zA9 aRRK`A9aA9fA92R `A9 @aA9``A9 aA9`A9 aRR4`A9aA92RfA9 `A9 @aA9``A9 aA9`A9 aRR`A9aA90fA9#3R `A9 @aA9``A9 aA9`A9 `b@9af@9fn@9#4R `j@9 @aR`*R`r@9av@9C4Rf~@9 `z@9 @aR`*R`@9a@9(f@9c4R `@9 @`*`@C#RGc5RaRRx`@9a@9f@95R `@9 @a@9``@9 a@9`@9 aRR`@9a@9f@95R  `@9 @a@9``@9 a@9`@9 aRR`rA9avA9f~A9#6Rx `zA9 @aR`*RaBA9`FA9C6Rb@9gNA9 aJA9f@9@`@9'`*aR `@9@@b@9``@9@b@9`@9@RtabA9`fA96Rb&A9gnA9, ajA9f>A9@`"A9'`*aR `*A9@@b.A9``2A9@b6A9`:A9@RVaRA9`VA97RbA9g^A9 aZA9fA9@`A9'`*aR ` A9@@bA9``A9@bA9`A9@R8`A9aA9fA9c7R `A9 @aR`*R)`A9aA9fA97RD `A9 @aR`*R`A9aA9fA97R `A9 @aR`*R `A9aA9fA97R| `A9 @aR`*R`A9aA9fA97R `A9 @aR`*R`A9aA9fA98R4 `A9 @aR`*R`B9aB9fB9#8R ` B9 @aR`*R`B9fB9C8RaR *R`A9aA9(fA9҃8R `A9 @aR`*R;@{BSC[DcEkF_`@9Cv@9#R *`@Gn9RaRRx`@9a@9f@9:Rx `@9 @a@9``@9 a@9`@9 aRRf@9C:RaRRz*c:RaRR qp҃:RaRRiqT:RaRR_@^E9 qT*Eҥ( ;RT qT*C;RJ@^E9k Tfju8F5ws2`B@9CaF@9RvN@9 `J@9 @#``@GR `j@9 @aR`*R`@9a@9>Rf@9 `@9 @a@9``@9 a@9`@9 aRR`@9a@9Hf@9?R `@9 @a@9``@9 a@9`@9 `b@9wf@9#@RaR *R*`j@9fn@9s sr *C@RaRRҥ@ c@RaRRkTEQkMT΅0|a`j`8#A)9 @9bG"@9R:@9;,@9  @9@@"@9` @9  @9@@"$@9` @9  (@9#@@C`8 * *CARaRR``b@9af@9f~@9CR  `j@9֮!R @an@9``r@9 av@9`z@9 aRR@Df~@9cCRaRGӥ R:`B@9aF@9fN@9@!CR `J@9 @aR`RƀC*(kMT~@DR}`aja8@9@9" @9A@ @9"`@9A@9"@9RA&aR ҥ!DRCd"{S[c ks #(@"@a|@!_Aa @aD) #CoR+@ @aR@R`&@qTEk,Tf$#Rҥ#cpRaRR`&@k,T{DSE[FcGkHsIC_ր~@R`alJ)X@`"@9@q-T{*pR aRRk*҃qR Cҥ${FS[ @*uRaRR`@uRaRR\%u`C) sv&f^*Rҥ%vRaRRd`A) *g(ңvRaRRVq!T{BSC[DC_R__R__R_R_R_R_,C8CE**@T @D)9 `X96`"g9 7@RҤ7@d)s(a@` {CSD[EcFkGsH_***%R*1T**@5B@9F@9 J@9@N@9 `p K qT K?qAzITX>4cURfRGBl2gVGaRRX>,Bl2fRGccRgVGaRR@}@1TaE \K  KK 5B@9*F@9*N@9R$R J@9 @`O(1 TO@`E QKB  B @K!K F*5`EbE K! |@AK5ˀ 5klTCha8qT*X>5Bl2#7 fRGWRgVGaRR5**( @@BT@9_q!T@$@bC|!@Q@T@T @@$@A"|@QX>bRaRfRG7gVGBl2R***%RhQ{S[*!c*kzR;xEB _k@@!_k@TRR$@ T@4D@R҅6EK|qT**RR*q @zAT**RR1T17Bl2RG*VGcgRR1:Bl2RG҇VGjRaRR~@;@{BSC[DcEkF_`R@9(q@T*1҆RG8VGgRRBl2tab@9`f@9 aj@9@`n@9 `ar@9`v@9 az@9`~@9 @@T!19RG҇VGchRaRBl2RQ`"@9a&@9w>@9 `*@9 @a.@9``2@9 a6@9`:@9 ?`@Tt:;Bl2҆RGpRVGaRR,aw\{B**cE[DSCkF;@{S`(sj`@@@SA{è_{ @!@|SqTqT$5B4E`(XR<!R0$R=`4` @{¨_,@?JTR"@{[`(6RSsR`2@`5D#`@ )qB:T1ATa@4@SA[B{Ũ_րDv2@9@9" @9A@@9"`@9A@9"@9@9A ``2@@4aB?TX96@a@N@Tb@@JT`@ a n?T@_!_?_R{S@[*c*k**a@?HT`R55@Bp! 0@9sB'h)309+@@/@`b@aRASA[BcCkD{Ũ_`C{S[6@9"@@95@!@9~S *6 aF@9A bJ@9"@aN@9A`?T q!D==!RGVG=Bh>9RaRR{BSC[DC_a@9?qhTq,T`B @95qTa@9`@9 a@9@`@9 `a@9`@9 a@9`@9 @HT QR?qT>9RRGBh>VGaRRʹ`.;TC{S[cks@7@iT*{C*SD[EcFkGsHC_$@23@*2R@iT*s7`EaAK?kTҥ?`@~R>Bh>fSGaRgWGR`#g9v't;@2tC`#'9dD*uDSR@TTT`#g9@T6*Rz@HST`@55Rq*T`;@k+T> Bh>ÁRfSGaRgWGRM}`Du@` "@(q`T:tckRfSGgWGaRBh>R4&`@`@9d@9A h@9"@l@9A`p@9"t@9Ax@9"|@9Ab@?`T:lR RfSGBh>gWGaR&@aR:#wRfSGgWGBh>R@/ @9$@9" (@9A@,@9"`0@9A4@9"8@9<@9A `@?T&@ 4:X#oRfSGgWGaRBh>RҸ@T`@5a?@`E?kTt;`@`?`@q\@ T:l#pRfSGgWGaDBT!:`fSGgWGpRaRBh>Ra @IT` "@ qT(qT:#uRfSGgWG@c@9g@9o@9@9 k@9@9 @w@9`s@9 {@9 @@9`@9 @9 @``k@_kbT`Ek T`EkT`E?kHT`EQjT*?c@9g@9o@9@9 k@9@9 @w@9`s@9 {@9 @@9`@9 @9 @R`@O2u@_kT@?kBT1xcdRfSGgWGR2'Sk) I|@v@J&@4:҃tRfSGgWG5u'5`Ek`RҀ`C@kTuD`'OO@aTvC'Bp,tDҔbђ @ Rb;@ @!@#  T"@`TRb#g9 @cDX@)"64@**@!T@AT*R@ `@K&a@`EK"! ~)#%RR5@1!R**R@ T+lcIRfSGgWGaRBh>R'@aR +cURfSGgWGBh>R@a @IT` #@ q,TqT` 4 T'@x +#RRaRfSGBh>gWGRlqaT@ @9"@9#@9  @9@@"@9` @9@"@9 @9@"@9 @9` #@9@ @9``#@9 @9`#@9 @9`"c[C_TlT_T+ ңPRfSGgWG@pA9tA9A xA9"@|A9A`@9?q@9" @9A@@9"`@9A@9"@9@9A C@*D)4@@@R@9@9C @9@9b@@`0 @'@ 5+@W@9@9 *@[@9@9 @9 @@9`@9 @9@9@9 a@@CT`RҔ1 @R@@1ԭt 4stDwC'^bіbTt'@T`#g9x`#'9 @@!p @4)*@ 3@9S 3 39J @ :78S@ caC'h78#bD`!@@#`@9$d@9&Rd #h@9!l@9@a`R#@s@ @`.@2@9|ScQ?qT4 *4 @@)O#44qT*@*5`#g9 7@bрbTtD RICA ՚,@ ՚_,@2!K*@) 2)#@) @@@B`? @@@T@ @@5a@`E?kATc4c cKD)d @Rc 2}@(T @`;@#@dE!@"@`5K*5@O@Ta CR`|`;<.@|SQqhT@@ ~@`/@A"|-{S @TSA{¨_aBH!QaB@A"|{S[cks`BLRaRRεRSA[BcCkDsE{ƨ_@(@*Q!z !c!˄(A@D$cTRaRBLRQu(zU5j`TA@"ҡTЅ 2 R@79K?k9ӓsK<@o74@A@KjTz"c zb~@Y7 R&TЅ 2d҃ R@K s j`T@@ "ҵyTЅ 2 Rb~@-7\@CQ@qhT C @L@%!K@"H)!05 @K?kHTD% BK*@*\Q1Ta@!_F˟ hi8h"8B{ RS[cks7 \H)@W 5 @b! K>_ރT@)0I) RT? q,eS @kTH@8]S!*} S~k &THKH HR~ӖiykTM@8^S!*~ SyS}k$TUKU i9}~ӖiykTU@8]S"*} SyS~ki#TMKM i9}~ӖiykTM@8^S!*~ SyS}k)"TUKU i9}~ӖiykTU@8]S"*} SyS~k TMKM i9}~ӖiykTM@8^S!*~ SyS}kTUKU Qi9qIT}S26qTQUB5˕!{!,R *yC,9~ӸhykTV@8]S"*} SyS~kITMKM *h9Z{SqTw-5kTHqRGR瀈) Tˈ@,˿B)5!@,2k )KA5*6c+T˄5jh88T9YKh8KcK *(5 RSA[BcCkDsE{ɨ_hzkTH@8]S!*} S}kTMK-M h:hukTM@8]S!* } S}k)THK@,kH h5@,˕2(qgRiu8(h$8(R瀈* K *c K *XKh5q R*gR*瀉?@ *9YKh:KcKhukTH@8]S!*} S} kTM K-M h5C)IKh5KcKhxkTH@8]S!*} S} k TM K-M **h8 *)IKcKKh8***LK K,c K,@kTM@8]S!* } S} k)TH Kr{"H ,( RLKc K R  K,,! RKcKVKcKVKKhRc KVK KcKVKKc KVK KcKVKKc KVK KKcKXK*QkTU@8]S"*}Sqc Ku|   aTmSLkTH@8]S!*} S~ kiTH KH HR~Ӭ -jykTL@8^S!*~ SyS} k)TV KV -j9}~6jykTM@8]S!*} SyS}k TLKL }~6j9,jhkTV@8]S"*} S~ k TM KM -j(*cKLK2KhRc KMK2 Kc KVK2 KLK2,j(KcK1T*)I*0Q**kTA@8]S# * @ ) @0 )< )$ )? kHTD @\@_T@7@_bT?DqT?HqTRk*****9hh88qATQA"R\@$RH@" @@ Q mS )@)~ E)hikT?,T$@8\S *| S| k T @ @)'R @ Q@ E@%ie8 R) K( `R|qT RX`kT?'T%@8\S *| SxS|kTKcKqT RkT?0*@L@ @ T@ hg8 R RyS  xe kT?b"T%@8\S *| SxS| kT) *qTKcK *KcK}~ hdkT?T%@8\S *| S|kb T 3@R R @kT?T$@8\S *| S| kTpSR*  R'R  Yg kT?"T)@8\S#!*| SxS)}  kT Kc K kT qhT K  gR q'RdS xh kT?bT(@8\S!*| SxS} k#TKcKqTQ qT|S4qTQ2!K (R Xh kT?BT'@8\S *| SyS| kTKcKqTUKcK0@kT?bT%@8\S *| S|kT $CkT? T @8\S *| S|kTk( T?`R#_֥KcKҋR`RnKcK`@kT? T%@8\S *| S|kTKcK@kT?"T%@8\S *| S|kTcKKKcK @kT?T$@8\S *| S| kTp{R KcK!K RRF *V*rQkT?bT'@8\S *|SqgK|SQ cKAT 2Rm*}`RR{c[u@Sk*s_R`^@Hq!T`.@`5 R`.@q`b@`4`n@qu T`A9 5aA9`A9bn aA9@`A9 `Za)`@T`^@5`.@5RRSA[BcCkDsE{ƨ_`B anс@89@T`R@RR`f@4a@)b @! `R kHT ` R`Zfzn@5q ShT5`)2un@\x!!qBzTt5`@@˵!Rтjo8h/8B _LqhT!Tbnq@Sz{T 5@*`qBzaT{5a@@!!Kˀn@R4@R R}4.R{ "@a @@? @{¨_{! S`R"@`j@k T@~~@?` tjxS@SA{è_R_qhTR_#@9"@9b # @9C@"@9b`R_@qB  "@9_q(T!RA#  BKRB#c !K!)R{ `5 D)5 Ba @{è_րR@R{S[cks|@;@?{@ T***`5*C Wg*5@R qO@h[B*SAcCkDsE{Ϩ_RLӦc{CS3R/1Fhe8pS  hTc T3`7`@`TTCc36&RR+c+@a@{ASB_R@)Rÿr!Z_kaT@BZ_qT@ZDq)T  ER#@r_kT$@4w2?k _q TqT@q_ր@Z@RrkAT@ZqT@!Z?DqhTk#T{A@#Z!Z?T7A@!Z?k` AzCTA@!Z?k" Cz凟@qTD54D$@Z!+BTkTA @!Z?k` AzcT@ @Z!+Tk0{__ _@cZ$+775+T@ZkiT@Z@qT"+"T$@Z_kT!|@#@#_{"*R @A! Z`Rk`T_ qhT RkT@Rk@T*R *{_Rk`T R*"R @@9 5K*` t&*R@@1@Z!Z ?<qhTq)T_@T{6`{¨_*_@aTsqT@{6`{¨_*_@aTs qT@{7*7@s  *qT$q TqT@ *{¨_@!QA6@@6!1aTkZ {s7@?qZ{¨_{ Rs* 7@qTqT*{¨_{S4|@[/ |@tTSA[B{è_/4sb7{*@7@cZkCT*/R{_@_@@#lSBZd+"T@A!cZc@@$ _{S** qT/@$qTq@s*SA{è_qT{S*A6T@SA{è_` @Z5`@!Z{S[*D7@s Z kiT@RK¿r?kT7@!Z?@qT*B3R/vSA[B{è_ց"@!ZkT!K?k"ER"@r?kATK6"@BZ?kTk`ҹ{S[*7*k@! ځ@ `RSA[B{è_`{R*V*{_@{S*[@7*7@ Z3Zs<qTR!.`.SA[B{è_@t{S*[c** 7*~@KK@*!6qsZ[B*SAcC{Ũ_qT3*@O@kT.`5jx8@4R.jx8q@T*#l*{S*-**@SA{è{ 47* @{¨ @{¨_{ 67* @{¨ @{¨_{kz|@S[c*6*` @s!Z_@kT*V. 5X[BSAcCkD{ƨ_֓@Z<qTd _{S[*X-**[BSA{è{ a@!Z?<qT/!0?@ T@!Z?qT@ @{è_0{S*[m7a @3!Z~@uO@@SA[B{Ũ_@Z<qHT @T`@ZqiT`B`2{S[*,**[BSA{è{B\S*/@?q`TBD* /@?qT@ZSA{è_R{S!**P@7**@SA{èv@SA{è_{S[*\*7`@9~@u5qTR-K#*T@9qTR-*cK*6T@*SA[B{Ĩ_R{Sx,*SA{¨{S[c*k*s 7?q,T@SA[BcCkDsE{Ǩ_RRRRkq`XzTk@* QQ`8qTBQ?k+T kП ?kAT* o@a kT|@4*,<8kaTk@kLTqןKR48**1T1B``{S*[**`76@*SA[B{Ũ_֓RO?q UzT?1T?1S3O@ks?kTVkT3*s{Rsq @{¨_{S*7Q*SA{¨SA{¨_{S*!Q? 1Tf*7T*6@*SA{è_*kT*{S*[+*~@kkTq, 4b~@R,R@SA[B{Ĩ_sQsK R{Su?@4RT@*SA{Ĩ_֡+?s hT{S[3cUO@X+v4RcTe+Ox |@TkT,@5[B*SAcC{Ũ_{S[*'@t?@[BSA{Ĩ_?T1+?a!?TT5Q{ "B $/@WR @*{è_{S*7*҇*7*1kT5*@SA{è_{S[C?lTSA[B{Ũ_?5@ZhT 7RRC@**C@7qDIzT_ q`TT_qT_q T_q`T_$qaTq@s1DTq!T*o@9`5G@ 4`4sq@z#*\?@@{ //@"*6 @*{è_*qTTKHqT! $ ```|_`@ZqiT@! cZ?kT @B !Z_k(T@ @BZZ! ?k_ R{ 7e@Z@qTb&@RBZ@5 Rk@Ta @{¨_ ` @ @Z!"Z $?#T?TTH|@`|@˃T@ZT{*R{_`_@_{S*clS*BlS@5 A)sK!ZBZ! S !Zs ZN)@SA{è_{S**5&@cK!Za !Z&@!Zc cZ@SA{è_{S[ V* B|@@!Z*R`~@`6 @ Z Z!Z*v `7u& Z@"@!ZBZ}*w"@`"@SA[B{Ĩ_{S[*cks * 7z@)a"@Z Zz!Z@KR7a @ct!Zc0!9Ra*`4:4)a"@!Z!Q!K!Za"*SA[BcCkDsE{ƨ_|"@{a@* Z Z!Z!Ra7*`5`"@b@Z` Z`"@:R)@`R Z Z@@**{S[ 5a@#RR!Z6 w.5uj6@SA[B{Ĩ_{S*@5kmT Z4R@aSA"R{è @SA{è_{S*[c*5*'G@41T4SA[BcC{Ũ_ cctBt25s Z'@0R#**2{S***54@b~@h)@*SA{Ĩ_{S*v5*^?@ RBtB0@SA{Ĩ_{S*[*c#X5**61Ts*_@s* Qq)Tv @v Z"8*yR`5 R`j63B|@RB B~44(~@ )@R*#@SA[BcC{ƨ_ {S*b(**@SA{è{S*5*`7d @KRZ4aSA{¨PSA{¨_{S[*c@*7@ZnS@qT&@ZO**5*%*@5 R`O@ ZuZ`& OO@3F$qaTO@6SA*[BcC{Ũ_ր"@Z  kT|@` bT ZTa5TE** Z(RRr`V) R`)R@`{s@qT @Zq{¨_֠{bB841T@R{_{B 1AT R{_{ */@? qiT@s Z* @{è_`R_{SRRs.TR@SA{Ĩ_ҿqT@!@9?qT *@`@9@4sqT Z*a!tE|SD\PC@@_@@_@T@!@_@ ~? T@? T@? iT ~@?T@!@_@@ @_{S[d@ATs@#@SA[B{Ũ_?qT@s@{S[ck+ @?`TR&R@@kT6vd@ATs?ր@@@+@SA[BcCkD{Ѩ_R{@B@k-T*RqTvR*`+34_"{t?qT@@ts@<_AT_#hd8cJc@xcx` @J<_kLT_#hd8c @JSc|@xcx`J{*RZ{B?y%{¨_{RBrfR A)Sr $@)[Jcc cJkc %J4@)ݙR,@A) B Rr  Bd" 7r  J/R Ϩrc %J։cPC  J  EJ<f  mJJ k Rrk)  J "xB)E Jde  nJJ CŘRr c mˆR rcP   J &LC) o  J=m  q JJ  .,D)) 1 1J1 R0r  Jd 1 1 J1 Rhrc c JcP 1 1J1 54E) R J+r >w 1 xJ1J/  O$Rrr*  J 1F)/  Je  JJ x2Rr  ! G)S 9 9J9 qR7ϴr7  J> 9 9J9 6R6rv  * J9 9J9 ORþr  m J9 9J9 hRr  _ J9 9J9 7JRˤr  J J9 9J9 VR6r  2 J9 9J9 Rźr  m J9 9J9 xRHr  _ J9 9J9 7МR7rw  J J9 9J9 yRvrV  2 J9 9J9 ϼR/*1J1 DQ .Q SAE !*1J1  , 0*1J1 ɏRr ! !h ./*J ܜRſrc c cX# n$*J bR/`r  Df !*J .4Rr  , #*J AЏRarA ! !h "&*J BJC FRBr B cWRZr BX" D%* J c cDC d!*) J  $rRprd   ),! )[BcCkD{Ũ_{S*[c@@pS+T@@"CӘbtS 4*RKkT*SA[BcC{ĨK#sQ E#]w KqT`~SRLT2#I{S4`!@" CR!K`j"8?qhT*R"1R"`B)` )( #@SA {èR"R"KR{ "`Ң"qŸBŽB* @{Ȩ_!`ŸҡB!qŽB>RAzr| _{S[cks;*4%3&t҇:EP&ۭgHL@Q1TSA[BcCkDsE{ͨ_ @9!"\8+0\8-p\8  \88\87\8@@"P\8 ` 60]8` Z @\8k Z5p]84]8  `\8@@"\8 ` Z \8 Z  \8@@"\8` \8 Z Z  \8@@"]8` ]8 Z Z  ]8@@"P]8` Z @]8 Z  `]8@@"]8` Z ]8 Z  ]8@@` Z ]8 Z"]83]8>0^8  ]8#P^81p^8@@"^8`0^8` Z ^8s Z)^8s*_8  ^8/0_8@@` @^8 Z Z  `^8`@#^8` ^8$ Z1 Z1  ^8`@` ^8 Z Z )^8@ )^8` Z)_8Z)! * _8)A *P_8/a Z)@_8 Z)! *`_8)A *p_8)a *_8,_8; Z) ZJ! ,_8JA ,_8La Z Z,_8G*_8J! ,_8JA ,_8La Z ZK;@JAJ1@)k;@{JaJ1@);@@ *!@ *@, 7@l}{k@k}S KJ{@k @kJ ?@}Sn}b{@ k}S @@+ gk@Kʋ k ʜSk Jg@k 7@}bӭ|}S   J JJ}SJ{ L}S ʌ  ʭn}Sy }Sk m k kkk M}Sy j}S J  J}Sz J  ʎL}S n}Sy k km }Sk kk M}Sy  s}S s ss }Sy M ʭ  ʮm~Sn}Sy    }SJ Jp~SzJn   L}S }Sy    }Sk k1kN}Sy J J Pj}SJ J}S1z JG@ ʌ M}S  l}Sy K@+k }Sks ks lJs K}Sny @J J J J Jʋ_l Jq~S1 1 1 }SMy @KJ@* Jk J JJJp_  0~St@ j~SSy@JJJJJ ʔN_ ~SU) 4~Sz@Jtʔ@ |S}S@~Sz @J4ʔʔ}So}Ss s@s}Sz@J)ʵ ʵt~S1}S1 ) G@}Sz @)M JbJ- ))}S  ~S i~S3yK@6@ J ʶ.}S ~S7~SzvU|S}SW@~SzJv ʖ|Sd~Sss@s}SzJN t|St~Swʔ~Sy@nJ}S~Sw~Sz@sJʸv~S~Sy9~S{@J499~S~Sʵ~S0{G@9 YZZ7S~S99;9~SZ{K@>S{ v{x~Sv;S{{~S{{ UʸUʵy SpS  ʙUʌ+Sy~S+Z Z kS{ykuZ ʭʪ~SkULSk~S{ Pʌ j1 ~SJ}S  J jKS ky)ʚ }SOZ |SZJJJ}SL{ 1{ {:~S{QZ}S<Z ZZ|S`{ʭʛ{ { }Sm KSkkk[}Sj{ ) {{ ,}S l}S< \S{ZʌZb{B BB@S}S[ b}SBx + ʄ ʋkkk |SD |SJJ{J }Sky  {  cS{C}Sc |scc |Sy@ N ~|S{S\b|SBBB@}S x s` n C k~SsK|Snkkk c @c}S`}Sc  w}S z C|Sbxʔclcc c ~ST |SJJ J#kk~SvC}Sc kc c |S`yK KLkk ^}SkSXb|S{ B9B 9 jB JkJ +SyJW|S+  j|SCyjʌ JKJJ ~S@}SL  ʵ 1 ʵ@|SxkJJ`}S  ~SpJ~S z oʷJʯ)C}Sj |SWccZc~Sy 1ʵ"~SQb|S7BB{B|Sz ʭuwʵ}S  P|Ssu|Sz )UW/}S ~S7U|SzZBBB@S}SW~SBx0 |S|S}Sox {ccucS{~Swccc|Sz`ʜS\b|SBBB~Sx@sʠo~SO|Sww|Sz#c|Sc}SU|SzʂBc cP|S}ST4}Soxcʴʔ9 ʗt|S~Sv}SzVʔS~S ʵ~Sz9k/S~S7J ~Szvʌ1 }S }S~Szkʖ)p}S  }SwZ}SzvJʶʄT}S ~SW{ʔ}Sz 1ʜ5~S~S7sʵ~SzV ʭ}S ~SB~Szv  c.}S }S7 ~SzZʖl PS}SWk}Sz/ ʄʯʋ |S~SJ}Szj ʔʕ}S }S1 ʔ~Szp}S  ~Sw }SzB ʤʄM|SD}S ~SO|S~Syʏ|S ~Sy) |S kʭBc kB B |Sdyj|SCJ|S)Jc)c c k@# {@" ;@# )@ @;@B `);@@ @ v{S*[Rc#@@@ *K@"T@SzTsQ3 "R>b~S:brTsfz#@B@SA[BcC{Ũ#@SA[BcC{Ũ_B4_{S@#]b BZ+"}!@c?BZ/BBa!%R`N@99`&@y9`@|S 9`@9`^@99`.@y9`@|S9`@9`n@9"9`6@y&9`@|S*9`@.9`~@929`>@y69`@|S:9`@>9`@9B9`F@yF9`"@|SJ9`"@N9SA{è_{ "`"qŸBŽB#>RBzrK* @{ɨ_ ||{@@SHQ[hc@T_qTKh#*4N)1R @ @."D+ K@FJQF)-"<@QP@QK J ?8qHTd@9& c ƚf_8 !@~ if8@9@y!K$Ԛ5U8B0J#TB 6* rT?kTd@8 ! !K $  $ƚ?8qHTf@94 c Ԛt_8"!@ 6R~ jf8@9@y!K$՚f 6 ?k"Tu@96 "kHTc*V ˵"5  !K$ƚk)TKkBTdtdR$|S!c$R QKECK_ c b  $PSA[BcC{Ĩ_u@9!@c"֚K 5 kiT җjv8Wh68kTQB(?kT K k T  җjv8Wh68kTQF?kcT qT4@9F9`TBh KҔib8Th&8B?kT@)T@54 kiT җjv8Wh68kT@9F9B Q_8F8_8F8@9BD8DV@56Q@8T8|S qTjf8@9#*Uh&x!TB T_xqaT^ T*Tx&xTB$6@9D8f07"Q  ~ju8@9@y9dR&07&"Q ~ it8(7dDEdRE{*S[cksy"xB_@T_kTRF<@y5BkqT`@a(Ryy`@b"Ryy&xbxBifxi&x&yfx5@T) *yixxSkT)?AAT4q`AzT@C' R'y ygx) )=y<!T_k( T@4qTR_ k/RB_kB k!߽qD@zA Ti@Q*RRRX~xK?k Tk TKӸi`8i`x!*!o|&o@K 5~1 8i5879 y5Q!jA T4Q1  |isx1Q1>i3x5 k TX~x&xfx_kT k`Tq)I;E&K!U kT! ߽qD@zaTq@~~**j38q@1"9q@311Bqy*)xgx4)=Ӭiixi)x=ӧh,xR=0 R RSA[BcCkDsE{˨_RR R|Su&@x1K?qTJ1zS!|S%Q 4! ?kTi@ **R$%~! *i%879?yQ!?jATa5`@H.`R@4K R(R@?"4R  @?? ??4??$?P  DR_ {S* @c@+ (`&@`+`&`*@!RR`?`6K? Q_qT 0? SA{¨~ qMTcDR`? SA{¨_` _{ @`c&@# @`*@R`?cDRa@`?R @{¨_ _ |S<@_qT!@9!?iT! iT @_A_<qiT{뵂R쵂 'S[_ khT5@@SA[B{Ĩ_*_aTiT"ҡš!@_$hc8cB . &@9!@3_8$ _8s#0_81@_8c7P_810`_86p_8/_85_8*_8>_8J)_8 4_8c)(_8c _8cc c cc?Tǚ`ǚe@9@_8c _80_8@_8P_8`_8s p_8k_8 _8J_81 _8)_8c _8c _8c _8c c ccK<qTC|S!P#bBQ_1AT!@EmM #@8 _{S[ckso@s@`` @5`@,qaTR`v#@Rz@*y@t&@` @uR@*k6;c@pqHT;@Xcxa @``R`Wz| yv#t&`6@uR5`@\qT`#@kTt@"@c#@"R`+@2@A `?ր"R`w7SA*[BcCkDsE{ʨ_a @!5R4@@8Q ՚">q)T6cҟTRR{=*aBR3yc6{@*` R`*Ҩ`@`H` @6x Tš @ qT@Da2@ ?kT@Q!Rw ` ``7!R`R`\4@@8Q ՚">q)Tt qT sT`@`"S`@H6`@cBR3y*`@RR`~q)T`@@`@H6`@cR*``RR`>qT`@H`@`@H6`@cBR3y*`RR``@P6>qT`@tV@ `@H7RҠR``@P6bV@kC4a@!$ @%D)K?kiTi " ? kBKB0@ {{@`@ H6`@*{*{@`bV@KZC#BKbV5R`V`@ X64a@bDkc8A%@!0@`V@kTaVH 8qcBzT`@H6`@{Ge*G@`{@@KZC#5R`V`@ `64a@bDkc8A%@!@@`V@kTaVH 8qcBzT`@H6`@{G=*G@`{@@KZC#5R``@`H6>q Ta2@y?T@0<4@@8Q ՚"@\4@@8Q ՚"K|4@@8Q ՚"\`@cBR3y*`\`@ Z`@@`@4A@8Q! ՚"Ra@$I D!R`@HRR*``7`Rm4@@8Q ՚"~q)T@RR`tt7``@ 5zWR| yv#t&uRt ``7`R`o@qT`@4 r&RD4@@8Q ՚" q)T` SqT qTqT!` Ҡ`:@RCӵQ`@``RRR r&~q)TPӁ>@<@ 4`T@\4@@8Q ՚"RR`aVcV@4kÒkc4*??@@`V@ZKKK9`V4@@8Q ՚"6q)T&S6 S!Bb)N`:Q?xqhTxqT@@R`bz@<4A@8Q! ՚" q)Ta!>Q X`x C az x`@kCT!>!D HqIT`B`2`FR`reB dc"aBbRRM*@4@`"$@xB z"x R`cO)c @y_<qhTK& *! `bz!xa@?kTbr@i2@ "*E % @9kiT|4@@8Q ՚"_@qTkTK&a5@4``R``@lqTb~@`B`2aB`F R`reB dc" RG*4@U<4B@8QB ՚" Q B Bӵ Qez`x! ?kTBQ`@_1T* aez x_DqT khT&K  QB CRkT&KQB,G4B@8QB ՚"4B@8QB ՚"`F@`6RL`O)!@R*4@ @R`qEzTar@c2@  * %~a"@9*_k T\4A@8Q! ՚"z*| yv#t&uRTuR@z@y@t&@| @v#@`he8%@y`4<q(T   * !$! )~a$@9 _k T<4A@8Q! ՚"`hi8K%@y&šeVK&Ě4 /706@DR `^`R``^@5R`av@c6@  * %~a"@9*_k)T4A@8Q! ՚"4A@8Q! ՚"k(TbV@! ! A K&aV`he8%@y<q(T   * !$! )~a$@9 _k T܏4A@8Q! ՚"`hi8K%@y&šK&Ě06@i e )R``^@`4kHTbZ@! K! &A aZ`:@aZ@ K?kiT@tP4A@8Q! ՚"R`v4cJ)K?k T$ b>@KKa"@_kTe6@KB B k!kcKcV#hb8#k"8BkTaV@!4K9Q!C!*ARa64`V@Q 8@R` @ 5 R`` @`4`@ 5@R`7R4@@8Q ՚"~q)T`@Kk``@` Tc@!`@4q *``7a@?q`a@?@T@d`*`R`*R<|4@@8Q ՚"~q)T`"@T@RҾ6@52@#Rc 6u#@a@KkT*!@#ˍ6@~)` @k@k@4Ka#@ZK` @KK` `@``@`` @4u4b@a@`@!4* *``7a@)*q?,q!`S  aR@ `[4o@q!vTq>@!@5bK_k@$VBRk Ta@*"@!@5K6@V)>@F) k>_kT :*B|@<l|؉M{ @9@9 qaT|qT@\{_ք6b,@9`(@90  6b`85 6b`85D6? T@x@R@R_@T@ _5*@0 @ {S[cksC@ Ú`T@!+\!SA*[BcCkDsE{Ϩ_wT@!+!c|@b @9`@9Ú_ qaT|qT@6v/@9b+@9B0V  6bv85 6bv85@6  QkT@"VR8|@9K#тaтaw@*@#@A@` !?T@!+#_k@T@,#}._P.Rcu*4*@$rv6!z?R@5@!+0%R` Ts@kZARgKa*q T*@%Ms@**Jgwg@*Kk *k@@|@""TA@"BB7B "Rg@#7@k4@@&X7@4qT{[.OP.SRc**#*Sc*4*@$#@*SA[BcC{ͨ_֠@q7/Kc;{cR*qAz`Tc@5**@%;@ˠc{@41 T1T{S[*a@`7**SA[B$R{èSA[B{è_BB44ha8Cha8kT!?$AT R_Rh@@9GDq ,TDQ|@ q)Tc,T!ѿh+Tha8Eh!8!TA D@9<T@T@8B( %ˈE%_ E))T?#T!ˀ@8<hT&T@8%4<|@ ˿ TˈC%T@9 @9 @9A @9%9<SP)9%9%( 9T IT @9k,@9)! _8A,_8 8 <SP-8 8,8 TaB| D  )T EJk@99_AT  hi8,h)8) TJ@ DE@9%$_ DT T%he8! %8@9%8@9$8_8rT*˿CTˈT@9%9T! T@9c|) T@TT@8 4||@@9_8!*  @{¨_@T@4A@@'xa_{Bd"A!'qq{_ R{S*[ckC*|@P!***qlT5"*Sc;J)k T@9_qTQ`8@5/@C5*e3*5/@1 T SA*[BcCkD{ƨ_*{S[?|@!**y*qT@*SA[B{Ũ_*#@9?qTG@!Qa8@5'@ 5'@k֢*f*{S!*SA{¨_{ @ @!Z{¨- @{¨_{S*SA{è_/@?kTkTR`xaBZz!!{S* /Bk`kTSA{è_CxacZz!!{ */@?k @{è_{s{¨_{S[*ck*s@<SA*[BcCkDsE{Ȩ_~RcT7`F@Z4_qVzAT**`6wo1o@TbJ cTkT;44R*R@qR"ҁ ?)_k)Taz`!Zz sJ { *B/@kП @{è_*?AT_dxbBZ{S*[*sc**#  _!~B|"V83T96**#@SA[BcC{ƨ_*{S[*c*k*,qT**3*7*kD**cC*[BSA{ŨSA[BcCkD{Ũ_{S*[*c7***cC*[BSA{ĨSA[BcC{Ĩ_{S[*c*k+*7*****o@B@;@B99 s~@s~B~9~RbTkT*^* BR+@*SA[BcCkD{Ǩ_֔{465{Ũ_cR@5AC.!!AR_{ ` @ _|$lu@ R@ @5{@ @ {__ AiT{c [bkšS+ssT~{6|z ?qTAkb8jb8j"8@k"8BAT˔ T`HT`ۚT+@SA[BcCkD{ƨ__@!@ @!@@!@ {SqTqTqT qSA{¨_  *V q*@2iR {[*c*k9:SklTR ztc *57AL{@*SA[BcCkD _Y54ztc@* 5ztc@*@43R{S[*RkT*@SA[B{Ĩ_ցzsg `57Rz3s{S* @0@.R~ `@h4`@ `@SA{è_@{* *dBM9D7$RdB 9?B 9 @{¨_R_R{ !@@*aR$|ckTc5B!4`~)`@R TR @{¨_R RR TR_@RT_ւ~5hbqT @6 Ҁ@Ѐa @`@kITʀSA[B{è_{S4R[R{S3[c# R @kTaRTR@x~hxq-T!@ 5@*!! #@SA[BcC{Ũ_s{S[c*ksgX@ *!Q?1Ta @R`@q~hu41TkTR` @*Q 99k T` @K kTR`@h{1a TqJa8@ !@y @5g@qTd @`@*BR ?4 R_ TRSA[BcCkDsE{Ǩ_*`@*CR @ 4R`R`@@"w@  `@@`R`@ @*KkAT!@3 5g@qTvd @$`@*BR ?`5`@*CR @ 5`@@a@!7[ 7@ `@@``@ @*1!T`@h{`5g@qT`A)?k`TqR`@~h9t@< t@7  `@@@a@ !ax`@ vd @`@$* R?`4a@*!! lc*R`@*R @xa@!! 4*Yg RAR{R3SFG[*cR@5aR3T[B*SA{Ȩ_ք @*/@*"RҀ?4!RT@R*#RҠ  @:*4RT/@*{@S[c8ks@!}!<!||c!˦7 Tqן*{*R9RҠg @kbT~@c'/T 2R TSA[BcCkDsE{Ȩ_R@  % h`qT7@ @*;{R{@jTg@;@4@@9qT6s@D @@5@ s@ 9?kT?pqT@9!5 R@R ҤR RklT9 ހ`za@C@9C59zaC@b@95!9B8_k`T_pqaT9b@88{S|}c>|[ksc ˥kRTR2z**@Rp j384h ;`* 5@`C@RqЁ|@k5q~@ i~ RSA[BcCkDsE{̨_֠k@57@9qIzTqT`@8`4kT7@bT`@9@5I~545*5N4{_4qTT@9(q!T!iT@95sB!@!˂9cR@9q@zTk!Ta@94_k`T?kTqaT99V5*s4R*49`@8`4kT_9@95RTpqT#@9c4*!@85S *JcK!RRO@ 3*4{s*A{s4skT]{S3R[R @kbTR @b~6 !hb?qlTs ?ր4SA[B{è_{rDt+[a|@ccB<9S*d@z-TaK "!|@B5 `QkД| aK !|@ @SA[B{Ĩ_*{R Rcc.GR{Ψ_{RS$ĚBBDUHc85* 6@SA{è/c(Ts"Ě3TQ%FҠ ss&Ě&T!?d@zTs* D6 T6 *6cQUhc8{k|S[**cs?qTRs s5Rs a~! k T!h1 7k6v{ zS**RkTsKROkT~d`C3 R RkT!_58 [B*SAcCkDsE{˨_*q@TC@#{$** Z{  6"qTC@#{$ qTC@yc<@#{$xC@9c@#k$8`k!8!Ca8'|@Ha8hc8c cC4H86Fh'8!t{[|Sc**k+qTRs s5Rs ~ tStS>r|#*c4****g*zK@Rz~>{`4`+@SA[BcCkD{ƨ_5R*AT_$hc8c@{ *{ *_{*RZs@{¨_{ 6mz{5{_{*S!zҝx6R@SA{è_{ *ҋ @{¨_!!z{S*@SA{è_a! @9"hb8B(7_{ W `a ?T?9 @{¨"@9hb8"/6! @{¨_@" @yB`cQ?#cTy_C@C>C@!CR@y@'|Ql |@ ҿ T ig| 륐Bid)@i'  ˤ%AT_.)@ J_ ‘LT$@5 k)a_{T{_{S[cRk9z+97Z4@y@ 7p @yk T+@SA[BcCkD{Ȩ_c@*v@ d] `. 8; 8?rrT *8O sb4ZRKv.C !R! B !j( wy5R{S[@@y 7f@y"*GlT @@Tk!TB!$a@y! 4 Q TRc@}`eg@@kTfh`chh@@h  *bJT `TTB&!Tk!T!cџ낐GHT#T `j`#@@SA[B{Ĩ_$`@y?k T`@yRa@b@y|&`"4h UV`@y`y 7h``ѿ)T@|B%hc%h % @@ @ @y!( R_kTT|@HT{{_ǐ!D TR|&T!i%@_֟@T"iec@>_BфB@y@hT_֧@?BT$5@f*5`{*R@ T @ {_{ 9@ !&` {!X _{R` {_{ }{_cR_{S[c *qT qTq`T,_` RA *@yˍ@JQ8@U}@J6TS@?hTK@ss sbSHT $RRvT * @RSA[BcC{Ĩ_ֿ Tss2ڿ병s s|k`?ITJa@* A`  RO@TR|A !cbi``@@?BAT *  T{RRSsb [ @6ЂR R 69!S@@@s @t@W@CTR+BAT@"@ 7R %ҥX9ckR"RB9R`@SA[B{Ĩ_ց? T!RC@h@:@d8@S @a4@?T!!ITa@@c<@T!!TB@_BTA!˂R!A"@X6A@R3 B_qT!!9_C"8B_qT!!L:_C"A9@" @9q TTLqTqTqT_qTqTqATR@RR RRR Rf@Df8R_kkTR_b8%5Ee8DqTT<qT@qTHqTEBQb8_kTe8_kTbB BHd8/7 RfbB BHd8"/7bB BHd87k T*{*RS*bB~@$a$BK`B|@`B `SA{¨_{S*[5Rc*kZZ7+s8!4 Q@q(T@[`xa ֛@*a*5`*`8! *` `8s 5` `8@K?kJTR+@*SA[BcCkD{Ǩ_b b8*!5@ s@*a @5``8s 5R*****a *4**x``8s *a {*@4**@k T`8a! !hb8a/6s@kT`8a! !hb8/7@kjT`8a! !hb86@k T@kTba sb8a8*r@kTaoa8a a85}@qs\@k``8|!k s /``8|!"kb * :{S[*c*k9+9@;@** 5x+@SA[BcCkD{ƨ_ցjy8z@*! qz{S[*c8*k@:@**`4jx8y@*! 4ySA[BcCkD{Ũ_{*R0BQKqT (;{_ր%8{S**a8? qATb D|@b8qTcQsh$8s8hd8A !R BsQ*BRs38BKq T (; @SA{è_s38{S[RckBB*@@9?q THT?q TT 4?q T99!R<*EPy BRuB9y 2*09@@9qT ;` R!*qT*5 ,<RV`!8 @@9/{ !R9R@@95` @9qTRRRR` A @{è_{S*R[RqSzT@SA[B{Ũ_3*ROGBf he8#he8D4#4k`THd8g6c8g6cckT_T*K_RR@#hb8h"8B5_T$hc8h#8cd5_C@9B5#hb8h"8B5_@95%hd8e84_aT9_$hc8hc8c@k@zaT__aTR&hd8hd8`k@zT_!@9_kAT_b4!@9_kAT_4"@9b5 _!{*c@9?kTџiT{__`TC@9c5@_B{ v @{¨_Dh`84kTce@95_@9C5_֟kTBD@95A{h`85{_@9A48_@{@8{__@T&@R qTE˿HTCCc|B_T_h#c ah$8Tc@ T_T_$hch#c D˟hTD}B@!%hc8h#8c{K#g i'8{_T#T{{_"aT_dh`8$h 8_aTRhd8 hd8`kT_{+T  {_ @4!aT_d@8kTR_{Sws}*s~` SA{¨_{ ieH*s~` @{¨_{ Xs~H` @{¨_{SNssHTSA{¨_{SВtsaT@SA{è_֠_֠d !RRR&b8C45_q!R*R_A Q?<qT$6qBHc8jR{S4Д7RV5s~{!!`7 @@ hs@SA{è_s6qT{*S[c` 4&w:uG5oZGfZB y]ZB yҀNTZB y`"ҀbM +'`*RSA[BcC{Ũ_>G6yB .{[Uv S*cC#Uҡ@C0-ҹRjt8j`8Q'Ԛ`7s BT#@SA[BcC{Ǩ_sy8@!4J!DAJ J@_ր06 _{@RqqRRҐ{q{CC#KCOCDG'(D ,H%| S Rc0A !    cRDRg|| ScC9 c c+aT@_f|| S ÌcC9*c5@R|c|Se+`@9aT@ |!| S$D 9a5@!@A9ӐR)(RFRR? HT"ȚES,S | S0E l    || S8D  || S 8D| |S B8b|B| SCBc88{**S[*c*k+O06(qO 6y 6QR5*q TBq@ TRcR$3Ң !$ÚB|@hb8*h&8B6QwR4BqTQAR"9_k REKjT4BTw9s4bTR`9`BqaTT R*`9s 5R@R*c!qT*Q?1Z sR.6QRR QaRRXKBT9!qeT*Q?1Z s*RBT9BT`9sQ_kMTDQ*$cqT1RB`*BqT*Q1!+@ SA[BcCkD{˨_?bT@9%9!?BT#9!{S[**4">|@* 6ҟkLT|@qBRs aKkTkK!@ SA[B{Ĩ_BTf9cKkKTkBK!ПQBП5 s* RaiT@8aj"8B_BTE9B{S[cks;|@gT@T ;Y ?@@9@5;@BT9`BT8`KSA[BcCkDsE{˨_qTBT`9sR ?q T?qT"QB_$qTR$2A@9@?q@TT?q T?q T?qaT@ 7,G};@6K22222BRa;Q@9"QB_$q T@9?qa T@9QB_$q(TRFR#_qT,*g}<*!Q"@9@Q$q)T| @90QB_qT## b$š6:qT"@9_qaT: RA@9?qT?qT?q)T?`q)TbTR`9A@9`,4ITa9s IqT7,*}@*#_qT,}<R!Q?TqT?@AXaxbA!  7*RBT9!Q?qLTcQ`| {Ks "T7,*}@*b9s*RBQ_qTcQc| s#Z #?qT,}<?BT 9!<7<*}@***kk@*#qT<}<7<}7@F@9߄qTT4q`TTq@ T$q T1 T2,#qT<*}7<*7ߤqTߴqT2&#t! KRj`8"D) @hb8hi8L$8)9J5`T" +9@*[R**RFAT{_9**#:2@ @9{qT# Rjj8  * !Q?1!TJ|@ A _T?i!8*fa8F8,8@ @9q@ThTqT0qbR#qT`"R***@T` A@9ha8Z_@aT7@>BRR#! >-&RR*qbaT<7<*}@b*%#?qT<}<7<*}@b#?qT<}<bTa9A2RA@9?qaTZ22AR0qT\7<*}@****kk@ * ZRq Tx_hqTqTqT|7,*}@F<@B<@qB#?qT<}<#?qT,}<7,*}@*B|@#?qT,}<{Sҁ@SA{Ũ_{SCmEF T`Q@SA{Ǩ_{#KCODOCv{ʨ_{Sc"<{@fSA{Ĩ_{ C#KOCDC{Ȩ_{ c"#Ҝ*`4#Cm{@* @_{CC#KCOCDG{ɨ_Bpt9E$ŚcC8$T_"Bt!`9`#DChc88# @!HChc89!_{RS`@94@@9qSA{è_R{S=`@94@@9qSA{è_R@9F qaTd@9`@9hd8d6qTcR*҇Rd@9e@9hd8jTd6Q\QqkcTA#__qRB_q@Rc RBR{S*_@SA{Ĩ_*@?T"@94!!? T_(qTR@9q@T{{_{!@Cc $@9"@9chd8c6BB_qT_qT_qTvv"Bv#@9qaT"BA@9?qaTBB{_y{Sa џBT#_8BB Chc86_8Chc87S`SA{¨џTSaSA{¨_{S@y@7`@y*|n `@y2`yR@SA{è_a@yb@yB|a@B|@`@m`@ya@yKB| |R Rtuy{S**R4**o` R`yR@SA{è_ty Ruy@yA "B`DH`8?@T R"B52R"A5q _R0(R{ȚCH`  R-RA BBB*&!% 2R$A K7 R* ** *k)T?-qT* *B!{R )RA)_Q@T5q  R*{S[R@r@ykT&@y@?TqT2@A6@SA[B{è_`@qaTvAa@;` BTBRa@z!!zms{SҀz@ykT&@y@?TqT2@A6@@SA{è_֓@s`@@6` @b@a@? qTRa @b@ z!!!z!@a@@9?qAT{S[R@sZ@ykT@[BSA{è_`@qTvA)4a@*!` B)kTBKRB a@fz!!dzs@9?qT{[Sb@ykT@SA[B{è_֑"@sN` @6`@@4b@4a@**? qTRa@b@ d! !!d!Ka@!{@ைRɨr_kT<>R{_ @yqT> R{[6!c*WS 5RW SA[BcC{Ũ_*v6q6q @T**   tz _{#c*8DS[*!R!$ R 8* Ra 9R`99a9Ra99!6`9`",[c`:'`J#c`b[ Dr#@SA[BcC{ƨ{BMSЀMJ Jj TM5?6jJ` @!b J!<MSA{èa  J 4{ gqAD?T @ R{¨_aI!a ?q-T,j aR @R_{S*[c_lqLT[B*cCRSA{Ũ!@9`@9 *qTa @9`@9 * qaT`@9qT`@9qTز6M 4wb#ҥMK@?kTa@9`@9 *qTqTSA[BcC{Ũ_֡R*@R9v"`9`Js:҃!6~rye~@t*SA[BcC{Ũ J 4a:#fK@JkTw"EZ+*R*R?ЀrELaIrE    Jq_{S` R[99R9 R9 R9@R9d R 99"9&9R*9" 5.4`ZARa9Ra9|sa8|c8a8`8^x^` R^*q T R`9`R`9 R` 999e^ 4 Ra"sb`8 R`88RT^`*SR&8v9RRj68 R"9"R 9`R"9 9R"9"$ 9 9 9@mT@SA[B{Ĩ_@ZR.9R29|F69:9|>9B9R R`9@Rs`8 |`8a8s_8{S[Ta@9?qT@SA[B{Ĩ_t@9?qTT?q@ THT?qT? qT40~ ?Dq TT?0qT?<q T?pq?q TT?q@ T?qT?qATa `(!? q THT?qT?qT s4?q?DqTF@uj~@j a la @7Ma 07a 7~q-T*R!,/)a 2j58~@qT*R! ,(~@@*@j95~qMT*R!4,~@a @9@(9a P(Ҹf97&*a 48t{S?@`LR`jr?kaT`aR B(9:Bh96`5Bh96@a`SA{Ĩ-@SA{Ĩ_{?qS`R[`@zck!TqT`@9qT`@9q!T` @9qTwc[@!0+J_kTSA[BcCkD{ƨ_$_kT6`r5vBcҕ[@4ЙJ?q T?q@T?qATЕR !?qZSsEBRaR!!$Ws * R`r9`v9R`z9~9\E}c`BZb9B@9F@9@ B@9Z,C "HQcZc<_Lq Ta @9`@9 Z<@_ k+TNqT`@9 ?qaT qTR 4aB#ҜK@!M4?k`T1 Ta2#Ґa@9`@9K@ Z4@ T `&@9qT`R@9wRqT@9qA T@ab[BSA0{Ũm*Eg`b@9ebff@9*dV@9b^@9 `R@9[BZ `Z@9@9ZSA @9BZ@<{Ũ<B<DqT`b@9df@9 Z<q)TRѿB$Ta^@9cV@9*E Q`Z@9@ `R@9[B!Z `rSAcZ{Ũc<!<@SA[B{Ũ_`R,[ykTZAR,?qR_R{R*bSB,[y_kSZs>Rs!6 Za.@<@??qB9B9@RF9{S*`!6a2@9Z`6@9 *Zq@<@B yD<#*=(B d=TJxo8M ]*:2OA%2 W <~;G<;;- r w 3 5 aR F- ^ R l 8 > D I M U \ a g o X z xz x { {  0{ x W{ 8{ { l} H`$I FI zI \I J @N 3 RN 1 iN 2 N 4 VpV$USS< < A A `H    5 G Y k ~ IL QL ZL nL L L BX@A@TA>  NPa N N N NPp N@@B'@B@0u@ @ P@D)5:@ 0uP  'a'ȯ N'P''a:' N@B@BP0u::a Neȯ:8a  ':'0u N'P''::a:@B@Ba::hB Ne:8hB  ''a NP'':a'@B@B0u N':: Ne0u'8:  ''a N0u'': N'@B@Ba N':. Nea'8.  ''a N0u''::X@B@B N>X:' Ne NX8'Cm Bm [ Fm 7m >m /m Om 3m Hm .  3i  ~R R  /m [ 3m Fm 7m ;m >m Bm Em Hm Lm Om Sm &V 7   ,   ! + 5 = H P h    P R SO0R0T0W0r r r rW#W#U leDeepdmh Z c s ~     ?Y| { { { | !| =| Y| d| ,} D~ `~ |~ ~ ~ ~ ~ Y| ~   } ! * 6 D ~  ?~ ?~ +~ | Y|  } Y| } } ,} } W} } } } | |  } Y| } !} ,} <} W} g} } }  | | | | !| =| | Y| 4|XYWD D D D D D E E @(S Z  a @h 0o 0v 0 } 0@ @ P ` @@a ` a `@a p a p@a @a a 0 `a pa `a pa a `a pa* qa4 ` a? aJ @ aU @!a^ p!aj p"as Pz @a @ a @@a @a @a @a aa qa "a a&M %K &M %K n n E E E %E *E /E 5E ;E BE IE PE UE `E kE wE ~E E E E E ءȠ=w* m$ J1  6љ P Q (3 ' _  h L L = 4 &4 ,4  24 <4 64 @4 E4 J4 O4 T4 _4 j4 o4 t4 {4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 5  5 5 5 $5 ,5 25 4 4 >5 :5 E5 L5 S5 Y5 &V &V ;- b- "- o- (- - -- - 2- -  - 6- - &V &V = S3 ^3 s3 * 3 3 % 3 3 3 *& 3 $ o1 3 D- 3 3 3 3 && 3 3 3 4 T 4 &V &V ;- @- D- K- C X- &V &V - - U - j3 4 - . . . * 1. >. L. k. t. . . &. . %. . = . . . / / 1/ :/ S/ [/ rU i/ p/ }/ #/ / / / / / 0 0 $0 /0 D0 N0 \0 i0 |0 0 0 0 0 0 0 0 0 0 1 1 61 @1 _1 d1 o1 s1 1 1 !1 1 "1 1 $2 #2 'C2 I2 ([2 f2 )2 2 *2 2 +2 2 ,2 2 - 3 3 ."3 /3 &V &V pX /X GX @ /2)&, zzzqssxq0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-"3(;h+//W//r/////v $*5@LXcou8(H@ @ '@B@x}uu@x}e  @ @    @-%L4jPT"ESLf6v`ppp@@@@@@@@@(          @ @       @    6;ooooo2QdoooX\`ojol @ @`00 @ &+:cGcKNS(s*K>;$qxY  %=N4&mn!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@ !1Aa  0@`@@A@!  @a`10  @ #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      LL\\ \0\H`` &(*,M.&( *, .I02" 46{L@DH|LS`|h>gW_X[}a0d[}`kk |X|\0|X|\00'11`L|h}ie`>0`W XX_'H|L|L0| `H|L|L|h|h\0|h|\g0|\ | \r0 |\|h۸|hL|h#|#\H|L|LS0M2H|L|L|`|h|h M~b0MM|`|h(g|`lH|L|L~bW_X[}a0d[}`cak_00L2H|L|L|`00MeV Y_|\0|\L|d}h|`}U_|XX[}a1|Xd[}`'H|L|L|`L_$H|L|L|T(g00N@DS|h>gW_[X}a;1gX}`~bk|h>g Nۖ|P|P|h~g|@O7HDA@N@|T|L|LKBh1'1`OH(F`N(~(F@|T|X|\A|L|LA*1N|DHDH|L|L$H|LAAH|L|LAՒո1|D1'1N@|TDA'1NH|L| LEAҮҞ1N2H|L|L(D@|@T|X|\A1 O|h>gW_[Xa1gX`0&(T*,Z.0<2468&(*,.02468&(R* ,.02468l6 86868,8,8E,8E,888888888`88}`88,88,8}`888888b8]a888888888B,88888]C888888B,88=a88888888B,8888@88888888686868686856 86 86868,8,8 ,8 ,8@88-)8 88,*8886*8V8#"6868"685 68+ 68,6 86 86868,8,8,8,8@88D)6868686868C6 8&( *,.0\22468&(4;*|,.02(:468&(*B,.602t<468>&(*2, . 02468&( **(,.024 46^38:A<>@BDFHu-boot*EHCI Host ControllerU-Boot*XHCI Host Controller  * *__of_translate_addressfdt_fixup_memory_banksdo_bootvx_fdtraw_accessubi_remove_volinitcall_run_finitcall_run_rusb_setup_descriptor__put_mtd_deviceallocate_partitionverify_bbt_descrnand_transfer_oobself_check_aiubi_detach_mtd_devcheck_avubi_open_volumeubi_eba_initubi_self_check_all_ffwl_get_wleubi_dump_flashmvpp2_aggr_txq_initphy_device_createpinctrl_select_state_full_ehci_create_int_queuexhci_get_endpoint_intervalxhci_setup_addressable_virt_devxhci_ctrl_txalloc_double_indirect_blockext4fs_put_metadataread_blockubifs_read_nodetake_gc_lnumvalidate_sbvalidate_masterubifs_scanubifs_tnc_read_nodedo_kill_orphansreplay_budgzwriteadd_mtd_devicecreate_bbtnand_scan_taillate_analysisuif_initcheck_attaching_infoubi_resize_volumeubi_io_read_vid_hdrubi_wl_get_pebmvpp2_txq_initxhci_address_devicexhci_get_input_control_ctxrecord_transfer_resultext4fs_log_journaldo_readpageubifs_read_node_wbufinit_constants_sbubifs_read_superblockscan_for_masterubifs_scanned_corruptionread_znodeget_cs_sqnumvalidate_reffs_devreadnand_fill_oobvalidate_vid_hdrself_check_in_wl_treeubifs_finddirnand_detectself_check_vid_hdrubi_wl_put_pebubifs_lsself_check_peb_vid_hdrdo_workcrypto_comp_decompressvalidate_ec_hdrubi_do_workerubifs_decompressself_check_ec_hdrself_check_peb_ec_hdrubi_io_writeself_check_not_badubi_io_readcheck_corruptionautoresizeinit_volumesubi_io_read_ec_hdrubi_wl_initmvpp2_rxq_init_xhci_alloc_devicexhci_scratchpad_allocabort_tdubifs_readinit_constants_earlyubifs_read_masterread_pnodeubifs_start_scanubifs_recover_log_lebreplay_log_lebscan_pebio_initprocess_lvolself_check_volumeubi_io_mark_badgop_port_enablexhci_update_hub_devicexhci_alloc_container_ctxreset_epubifs_sizeubifs_check_nodemount_ubifsubifs_read_nnodeubifs_scan_a_nodeubifs_recover_lebubifs_replay_journalgpio_hog_of_to_platearly_erase_pebubi_attach_mtd_devubi_read_volume_tableubi_create_volumeubi_io_is_badubi_wl_scrub_pebxhci_configure_endpointsxhci_mallocxhci_bulk_txubifs_is_mappedfree_orphanscheck_lpt_crctry_read_nodeubifs_recover_master_nodeubifs_validate_entryfdt_find_or_add_subnodeubi_early_get_pebvtbl_checkdo_sync_erasewear_leveling_workerxhci_segment_allocxhci_wait_for_eventvalidate_inodecheck_lpt_typeubifs_update_one_lpinsert_old_idxvalidate_vid_hdrself_vtbl_checktorture_pebself_check_ecxhci_ring_allocxhci_queue_commandubifs_leb_unmapubifs_igetubifs_change_one_lpadd_to_listnor_erase_preparesync_erasexhci_ring_freeubifs_calc_lpt_geomnand_waitubi_add_to_avubi_io_sync_eraseerase_workerxhci_inval_cachefilldirnand_select_chipubi_compare_lebsself_check_writeself_check_in_pqxhci_flush_cacheubifs_printdirubifs_leb_read(((((AAAAAABBBBBB[addr [initrd[:size]] [fdt]] - boot Linux flat or compressed 'Image' stored at 'addr' The argument 'initrd' is optional and specifies the address of an initrd in memory. The optional parameter ':size' allows specifying the size of a RAW initrd. Currently only booting from gz, bz2, lzma and lz4 compression types are supported. In order to boot from any of these compressed images, user have to set kernel_comp_addr_r and kernel_comp_size environment variables beforehand. Since booting a Linux kernel requires a flat device-tree, a third argument providing the address of the device-tree blob is required. To boot a kernel with a device-tree blob but without an initrd image, use a '-' for the initrd argument. [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead For the new multi component uImage format (FIT) addresses must be extended to include component or configuration unit name: addr: - direct component image specification addr# - configuration specification Use iminfo command to get the list of existing component images and configurations. Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OSInsufficient RAM for page table: 0x%lx > 0x%lx. Please increase the size in get_page_table_size()PTE %p (%llx) is not a block. Some driver code wants to modify dcache settings for an range not covered in mem_map.PTE %p (%llx) for addr=%llx should be a tablePage table pointer not setup.Emergency page table not setup.FDT creation failed!FDT and ATAGS support not compiled in (fake run for tracing) Starting kernel ...%s /memory## WARNING: fixup memory failed! Bad Linux ARM64 Image magic! Image lacks image_size field, assuming 16MiB arch_numberTLB addrirq_spsp start Early malloc usage: %x / %x (%08x) elr: %016lx lr : %016lx (reloc) elr: %016lx lr : %016lx x%-2d: %016lx x%-2d: %016lx Code: Bad mode in "Synchronous Abort" handler, esr 0x%08lx Resetting CPU ... Bad mode in "Irq" handler, esr 0x%08lx Bad mode in "Fiq" handler, esr 0x%08lx Bad mode in "Error" handler, esr 0x%08lx "Synchronous Abort" handler, esr 0x%08lx, far 0x%lxresetting ... mikrotik,rb5009marvell,armada7040-dbCannot find PCA9555: %d Failed to read IO expander value via I2C Failed to set IO expander via I2C ERROR: %s image overlaps OS image (OS=%lx..%lx) Ramdisk image is corrupt or invalid RDCould not find a valid device tree FDTLoadable(s) is corrupt or invalid Wrong Image Type for %s command ## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x ERROR %dE: can't get kernel image! Can't get image type! Can't get image compression! Can't get image OS! Can't get image ARCH! Can't get image load address! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Can't get entry point property! Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover Failed to prep arm64 kernel (err=%d) Moving Image from 0x%lx to 0x%lx, end=0x%lx Unable to allocate memory %#lx for loading OS boot/bootm.cinitrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) Resetting the board... bootmRTEMS! FIT images not supported for '%s' - must reset board to recover! ## Transferring control to RTEMS (at address %08lx) ... filesize Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated NetBSD## Transferring control to NetBSD stage-2 loader (at address %08lx) ... QNXPlan 9confaddr## Transferring control to Plan 9 (at address %08lx) ... %s: %s Base path too long (%s%s) Retrieving file: %s get%s: returning err=%d boot/pxe_utils.cExpected string literal: %.*s Expected string: %.*s outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02x.dtb./localcmdNo kernel given, skipping %s kernel_addr_rSkipping %s for failure retrieving kernel malloc fail (FIT address) ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT Skipping fdtdir %s for failure retrieving dts fdt_addrfdtcontroladdrExpected include path: %.*s Couldn't retrieve %s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s pxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%sSetting use of fallback Selected fallback option, but not set pxe_label_overrideMissing override pxe label: %s Missing default: %s Error parsing config file menutitledefaultpromptlabelkernellinuxlocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedfallbackUnknown OSUnknown ArchitectureUnknown ImageXIPLoading %s %s Uncompressing %sUnimplemented compression type %d Unknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x Unknown Phasearchitecturecompressionoperating systemimage typebzip2gziplzmalzozstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot Imagefdt_legacylegacy Image with Flat Device Tree spkgimageRenesas SPKG ImagesfsplStarFive SPL Imagetfa-bl31TFA BL31 Imagestm32imagev2STMicroelectronics STM32 Image V2.0Invalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdoseEnea OSEplan9rtemsTrusted Execution EnvironmentU-BootvxworksVxWorksqnxopensbiRISC-V OpenSBIefiEFI FirmwareELF ImageInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vbootm_lowbootm_sizebootm_mapsize## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highin-place initrd alloc failed ramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... loadablesThe given image format is not supported (corrupt?) %d Bytes = Bad magic number Bad header crc Bad data crc Bad image type Empty Script Could not find config %s /imagesCould not find script in %s No FIT subimage unit name Can't find '%s' FIT subimage Not a image image Bad Data Hash Could not find script subimage data Wrong image format for "source" command loadaddr#size-cells%s: Bad cell count for %s %s: %s: %s fdt_root: %s serial#serial-numberWARNING: could not set serial-number %s. fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not set bootargs %s. 2025.10-OpenWrt-r32802-f505120278u-boot,versionWARNING: could not set u-boot,version %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. /aliasesethernetethaddreth%daddrlocal-mac-addressrangesThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dERROR: - must RESET the board to recover. ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) no-mapimage is not a fdtfdt_highFailed to reserve memory for fdt at %#llx Failed to allocate memory for Device Tree relocation device tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconfFailed to reserve memory for the fdt at %#llx - must RESET the board to recover. Unsupported %s address size descriptiondata-offsetdata-positiondata-size%s %s algo: invalid/unsupported key-name-hint (required)padding%s %s padding: %s %s %s value: unavailable HashsignatureSign%s Description: %s Type: %s %s Compression: %s %s Data Start: %s Data Size: %s Architecture: %s %s OS: %s %s Load Address: %s Load Address: 0x%08lx %s Entry Point: %sFIT description: Can't find images parent node '%s' (%s) %s Image %u (%s) /configurations%s Default Configuration: '%s' %s Configuration %u (%s) %s Kernel: %s Init Ramdisk: %s %s Firmware: %s %s FDT: %s %s FPGA: %s %s Loadables: Corrupted or truncated treeCan't get hash value propertyUnsupported hash algorithmBad hash value lenBad hash valueCan't get hash algo propertyuboot-ignore-skipped + error! %s for '%s' hash node in '%s' image node Can't get image data/sizeerror! %s in '%s' image node ## Checking hash(es) for FIT Image at %08lx ... Hash(es) for Image %u (%s): unknown## Loading %s (%s) from FIT Image at %08lx ... Bad FIT %s image format! (err=%d) Could not find configuration node Using '%s' configuration Could not find subimage node type '%s' Trying '%s' %s subimage Verifying Hash Integrity ... No %s %s %s Image Could not find %s subimage data! Can't get %s subimage load address! Error: %s overwritten Loading %s from 0x%08lx to 0x%08lx Error decompressing %s WARNING: 'compression' nodes for ramdisks are deprecated, please fix your .its file! Subimage data is not a FDT config with overlays but CONFIG_OF_LIBFDT_OVERLAY not set ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX Perform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsbootcmd ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC FIT image found Bad FIT image format! Bad hash in FIT image! Unknown image format! Trying to execute a command out of order Automatic boot of image at addr 0x%08lX ... iminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]aarch64-openwrt-linux-musl-gcc (OpenWrt GCC 14.3.0 r32802-f505120278) 14.3.0 GNU ld (GNU Binutils) 2.44 print monitor, compiler and linker versionERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s erase %s erase: device %d block # %lu, count %lu ... %ld blocks erased: %s ## Executing script at %08lx sourcerun script from memory%-12s= 0x%0*lx %-12s= 0x%.*llx boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit eth%iaddrcurrent eth = %s %-12s= (not set) %-12s= %pM ipaddr%dIP addr = %s fdt_blobdevicetree = %s serial addr width shift clockprint Board Info structurechanged to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u blkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigurebootikernel_comp_addr_rkernel_comp_sizekernel_comp_addr_r or kernel_comp_size is not provided! kernel_comp_addr_r is outside of DRAM range! Failed to allocate memory for the image at %#llx boot Linux kernel 'Image' format from memory%-15s Button '%s' not found (err=%d) buttonmanage buttons Get button state button list Show a list of buttonsflushOFFInstruction Cache is %s Data (writethrough) Cache is %s dcacheenable or disable data cache[on, off, flush] - enable, disable, or flush data (writethrough) cacheicacheenable or disable instruction cache[on, off, flush] - enable, disable, or flush instruction cacheList of available devices |-- %s (%s%s) | |-- %s coninfoprint console devices and information-e-sUnknown parameter: %s Driver model low level accesscompatdevresdriversstaticuclass-necho args to console[-n] [args..] - echo args to console; -n suppresses newlineInvalid ELF image cmd/elf.ctftpAutomatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified bootdev## VxWorks boot device not specified bootfilehost:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... bootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s) exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext4writecreate a file in the root directory [sizebytes] [file offset] - create a file in / directoryusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizefdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%sWorking FDT set to %lx fdtaddrControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s moNew length 0x%X < existing length 0x%X, aborting. No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structmvrename/move a file/directory [] - renames/moves a file/directory in 'dev' on 'interface' from 'old_path' to 'new_path'fstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type delete a file [] - delete a file with the name 'filename' on device type 'interface' instance 'dev'.mkdircreate a directory [] - Create a directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start. - Find file 'filename' from 'dev' on 'interface' determine its size, and store in the 'filesize' variable.Bank %s: -aGPIO device %s probe error %i GPIO: '%s' not found cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %u) value is unknown (ret=%d) Warning: no access to GPIO output value Warning: value of pin is still %d query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsNo I2C bus selected Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Error: Not supported by the driver Valid chip addresses: %02XCurrent bus is %d Setting bus to %d Failure changing bus number (%d) Bus %d: %s (active %d) %02x: %s, offset len %x, flags %x Invalid bus %d: err=%d readingError %s the chip: %d %04x: %02xwritingCRC32 for %08lx ... %08lx ==> %08lx: %02lx %04lx ? I2C sub-systemcrc32loopmmmwnmprobeolenUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .q, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=LED '%s' not found (err=%d) LED '%s': LED '%s' operation failed (err=%d) manage LEDs on|off|toggle Change LED state led Get LED state led list show a list of LEDstoggleblink %s ## Total Size = 0x%08x = %d Bytes Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'Base Address: 0x%08lx The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same %08x %0lx %04xZero length ??? halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data infinite loop on address range[.b, .w, .l, .q] address number_of_objectsprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmemory write (fill)[.b, .w, .l, .q] address value [count]memory modify (constant address)[.b, .w, .l, .q] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]%2u %2u-%2u = %5u %sFDXHDX100fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %sMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x MDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)No MMC device available OK, force rescanno mmc device at slot %x set dsr %s YesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s card capabilitieshost capabilitiesRd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: HC WP Group Size: User Capacity: WRREL Boot Capacity: RPMB Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state SD doesn't support partitioning userenhwrrelgpPartition configuration: User Enhanced Start: User Enhanced Size: No enhanced user data area User partition write reliability: %s GP%i Capacity: No GP%i partition GP%i write reliability: %s Partitioning successful, power-cycle to make effective Failed! #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device get mmc type error! MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s It is not an eMMC device boot areas protected MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc erase partname mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc hwpartition - does hardware partitioning arguments (sizes in 512-byte blocks): USER - <{on|off}> : sets user data area attributes GP - <{gp1|gp2|gp3|gp4}> <{on|off}> : general purpose partition MODE - <{check|set|complete}> : mode, complete set partitioning completed WARNING: Partitioning is a write-once setting once it is set to complete. Power cycling is required to initialize partitions after set to complete. mmc setdsr - set DSR register value wphwpartitionsetdsr0x%08x: %02x - 0x%012llx-0x%012llx : "%s" MTD device %s not found, ret %ld .dontskipbadOffset not aligned with a block (0x%x) Size not a multiple of a block (0x%x) Erasing 0x%08llx ... 0x%08llx (%d eraseblock(s)) Failed to get bad block at 0x%08llx Skipping bad block at 0x%08llx ReadingWriting [raw] [oob] [dontskipff]ReadWrite.raw.benchmark.dontskipffOffset not aligned with a page (0x%x) Size not on a page boundary (0x%x), rounding to 0x%llx Could not map/allocate the user buffer %s %lld byte(s) (%d page(s)) at offset 0x%08llx%s%s%s %s %lld byte(s) at offset 0x%08llx Failure while %s at offset 0x%llx %s speed: %lukiB/s Dump %d data bytes from 0x%08llx: Dump %d OOB bytes from page at 0x%08llx: Dump %lld data bytes from 0x%llx: %s on %s failed with error %d unavailableList of MTD devices: * %s - device: %s - parent: %s - driver: %s - path: %s - type: ROM NOR flash Data flash UBI volume MLC NAND flash Unknown - block size: 0x%x bytes - min I/O: 0x%x bytes - OOB size: %u bytes - OOB available: %u bytes - ECC strength: %u bits - ECC step size: %u bytes - bitflip threshold: %u bits No MTD device found Only NAND-based devices can have bad blocks MTD device %s bad blocks list: 0x%08llx MTD utilsmtdparts support missing. Offset exceeds device limit '%s' is not a number Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx Device %d: %sbootdevice ** No boot device ** ** Device %d not available .jffs2.e.iUnknown nand load suffix '%s' Loading from %s, offset 0x%lx ** Read error Fit image detected... ** Unknown image type ** Bad FIT image format %dx %s, sector size %u KiB Page size %8d b OOB size %8d b Erase size %8d b ecc strength %8d bits ecc step size %8d b subpagesize %8d b options 0x%08x bbt options 0x%08x nand_writesizenand_oobsizenand_erasesize (bbt reserved)correctableuncorrectable, dumping raw dataquiet no devices available Device %d bad blocks: 0x%08llx%s scrubclean-y.spread.part.chip NAND %s: Warning: scrub option will erase all factory set bad blocks! There is no reliable way to recover them. Use this command only for testing purposes if you are sure of what you are doing! Really scrub this NAND flash? scrub aborted .ecc.oob.oob.eccNo memory for page buffer Error reading page at offset %08lx, %d %s Page at offset %08lx dump: OOB: .raw.noverifysize adjusted to 0x%llx (%d bad blocks) %s: error at offset %llx, ret %d Unknown nand command suffix '%s'. %zu bytes %s: %s markbadblock 0x%08lx NOT marked as bad! ERROR %d block 0x%08lx successfully marked as bad biterrToo many pages in one erase block bit position 0 to 7 is allowed Error (%d) reading page %08lx Error (%d) nand_erase_nand page %08llx Flip data at 0x%lx with xor 0x%02x (bit=%d) to value=0x%02x Error (%d) write page %08lx nbootboot from NAND device[partition] | [[[loadAddr] dev] offset]NAND sub-systemInvalid address/size rootpathdnsipdomainping failed; host %s is not alive host %s is alive dhcpautoloaden1cmd/net.cen2pingsend ICMP ECHO_REQUEST to network hostpingAddressboot image via network using DHCP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpputTFTP put command, for uploading files to a serverAddress Size [[hostIPaddr:]filename]tftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocolactiveeth%d : %s %pM %s Could not find device %s Driver does not implement stats dump! %s: %llu NET sub-systemlist - list available devices stats - dump statistics for specified device stats%s=%s ## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d cmd/nvedit.c## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed edit: setenv## Resetting to default environment runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintexistssaveenvsave environment variables to persistent storage-bootableUnknown option %s %s%x0x%xSupported partition tables%c %s: ** Bad device specification %s %s ** Unknown partition type '%s' disk partition related commandsuuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition table part list [flags] - set environment variable to the list of partitions flags can be -bootable (list only bootable partitions) part start - set environment variable to the start of the partition (in blocks) part can be either partition number or partition name part size - set environment variable to the size of the partition (in blocks) part can be either partition number or partition name part number - set environment variable to the partition number using the partition name part must be specified as partition name part set type - set partition type for a device part types - list supported partition table typesParentDriver| %-*.*s| %-*.*s| %s Ops get_pins_count not supported by %s Ops get_pin_name error (%d) by %s Ops get_pin_muxing error (%d) by %s in %s %-*s: %-*s pin-controller device not selected %s not found Can't get the pin-controller: %s! Pin-controller device is not set! dev: %s pinmuxshow pin-controller muxinglist - list UCLASS_PINCTRL devices pinmux dev [pincontroller-name] - select pin-controller device pinmux status [-a | pin-name] - print pin-controller muxing [for all | for pin-name] -ipv6cmd/pxe.cpxefile_addr_rInvalid pxefile address: %s Out of memory pxeuuidConfig file '%s' found Config file not found pxeget and boot from pxe filesget [-ipv6] - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] [-ipv6] - boot from the pxe file at pxefile_addr_r default-arm-mvebu-mvebu_armada-8kdefault-arm-mvebudefault-armWrittenFailed to initialize SPI flash at %u:%u (error %d) No SPI flash selected. Please run `sf probe' updateERROR: attempting %s past flash size (%#x) ERROR: flash area is locked Updating, %zu%% %lu B/sSPI flash failed in %s step %zu bytes written, %zu bytes skipped in %ld.%lds, speed %ld B/s ERROR: trying to overwrite reserved memory... SF: %zu bytes @ %#x %s: SF: %zu bytes @ %#x Erased: protectstart sector is not a valid number len is not a valid number unlocksfSPI flash sub-system Reset SCSI scsiscsibootboot from SCSI deviceloadAddr dev:partSCSI sub-systemreset - reset SCSI controller scsi info - show available SCSI devices scsi scan - (re-)scan SCSI bus scsi device [dev] - show or set current device scsi part [dev] - print partition table of one or all SCSI devices scsi read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' scsi write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr' scsi erase blk# cnt - erase `cnt' blocks starting at block `blk#' Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** Hex conversion error on %c Invalid bitlen %d generic_%d:%dspi_generic_drvError %d during SPI transaction sspiSPI utility command[:][.][@] - Send and receive bits - Identifies the SPI bus - Identifies the chip select - Identifies the SPI mode to use - Identifies the SPI bus frequency in Hz - Number of bits to send (base 10) - Hexadecimal string that gets sent-pSpecify a filename or set the ${bootfile} environment variable ext2fatInvalid filesystem: %s Error reading config file sysbootcommand to get and boot from syslinux files[-p] [addr] [filename] - load and parse syslinux menu file 'filename' from ext2, fat or any filesystem on 'dev' on 'interface' to address 'addr' time: %lu minutes, %lu.%03lu seconds run commands and summarize execution timecommand [args...] Error compiling regex: %s truedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-z=~Volume %s not found! UBI volume update was not initiated Couldnt or partially wrote data size > volume size! Aborting! Cannot start volume update Failed to read leb %lld (%d) cmd/ubi.cFailed to write leb %lld (%d) updatingdamaged volume, update marker is setNo size specified -> Using max size (%lld) Read %zu bytes from volume %s to %p read from corrupted volume %dNO MEM read err %x UBI partition '%s' already selected Partition %s not found! %s,%sUBI init error %d Please check, if the correct MTD partition is used (size big enough?) dynamicSettCleardetachError, no UBI device selected! Device %d: %s, MTD partition %s UBI: MTD device name: "%s" UBI: MTD device size: %llu MiB UBI: physical eraseblock size: %d bytes (%d KiB) UBI: logical eraseblock size: %d bytes UBI: number of good PEBs: %d UBI: number of bad PEBs: %d UBI: smallest flash I/O unit: %d UBI: VID header offset: %d (aligned %d) UBI: data offset: %d UBI: max. allowed volumes: %d UBI: wear-leveling threshold: %d UBI: number of internal volumes: %d UBI: number of user volumes: %d UBI: available PEBs: %d UBI: total number of reserved PEBs: %d UBI: number of PEBs reserved for bad PEB handling: %d UBI: max/mean erase counter: %d/%d -numericError, no volume name passed create--skipcheckIncorrect type No space left in UBI device! Name too long! verify_mkvol_req failed %d Creating %s volume %s of size %lld removeRemove UBI volume %s (id %d) It's read-only mode Error changing Vol tabel record err=%x UBI: reserve more %d PEBs ubi%d error: %s: cannot remove volume %s, error %d %sing skip_check on volume %s Please see usage %lld bytes written to volume %s ubiubi commandsdetach - detach ubi from a mtd partition ubi part [part] [offset] - Show or set current partition (with optional VID header offset) ubi info [l[ayout]] - Display volume and ubi layout information ubi list [flags] - print the list of volumes ubi list [flags] - set environment variable to the list of volumes (flags can be -numeric) ubi check volumename - check if volumename exists ubi create[vol] volume [size] [type] [id] [--skipcheck] - create volume name with size ('-' for maximum available size) ubi write[vol] address volume size - Write volume from address with size ubi write.part address volume size [fullsize] - Write part of a volume from address ubi read[vol] address volume [size] - Read volume to address with size ubi remove[vol] volume - Remove volume ubi skipcheck volume on/off - Set or clear skip_check flag in volume header [Legends] volume: character name size: specified in bytes type: s[tatic] or d[ynamic] (default=dynamic)UBIFS not mounted, use ubifsmount to mount volume first! ** File not found %s ** UBIFS not mounted, use ubifs mount to mount volume first! No UBIFS volume mounted! ubifsloadload file from an UBIFS filesystem [bytes] - load file 'filename' to address 'addr'ubifslslist files in a directory[directory] - list files in a 'directory' (default '/')ubifsumountunmount UBIFS volume - unmount current volumeubifsmount - mount 'volume-name' volumeUncompressed err :%d Uncompressed size: %zd = 0x%zX unlz4lz4 uncompress a memory regionsrcaddr dstaddr dstsize NOTE: Specify the destination size that is sufficiently larger than the source size. Uncompressed size: %lu = 0x%lX gzwriteunzip and write memory to block device length [wbuf=1M [offs=0 [outsize=0]]] wbuf is the size in bytes (hex) of write buffer and should be padded to erase size for SSDs offs is the output start offset in bytes (hex) outsize is the size of the expected output (hex bytes) and is required for files with uncompressed lengths 4 GiB or larger unzipunzip a memory regionsrcaddr dstaddr [dstsize]Uncompressed size: %ld = %#lX lzmadeclzma uncompress a memory regionSee InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudioHuman Interface, Subclass: NoneBoot KeyboardMouseMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d 12 Mb/s+- %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dmsusbstarting USB... resetting USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part ## Copying '%s' subimage from FIT image at %08lx ... Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... Image too large: increase CONFIG_SYS_XIMG_LEN GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-imageDevice "%s" not supported by U-Boot image Device "%s" is inactive Erasing 0x%x - 0x%x:...Error! Done! Writing %d bytes from 0x%lx to offset 0 ... Failed to probe SPI Flash Erasing %d bytes (%d blocks) at offset 0 ...Writing %d bytes from 0x%lx to offset 0 ...Error: SATA device not found Error: SATA 0 not found No SD/MMC/eMMC card found %s(%d) init failed Error: MMC 0 not found Error - failed to obtain block descriptor Error - written %#lx blocks Error: usb_init failed Error: USB storage device not found Error: USB 0 not found flash-image.binBurning U-Boot image "%s" from "%s" to "%s" Error: Read not supported on device "%s" Error: Failed to read file %s from %s ERROR: Bad MAGIC 0x%08x != 0x%08x Error: Bad Prolog checksum. 0x%x != 0x%x Error: Bad Image checksum. 0x%x != 0x%x Image checksum...OK! Error: Image header verification failed Error: Write not supported on device %s Error: Unknown source "%s" Error: Unknown destination "%s" bubtBurn a u-boot image to flash[file-name] [destination [source]] -file-name The image file name to burn. Default = flash-image.bin -destination Flash to burn to [spi, nand, mmc, sata]. Default = spi -source The source to load image from [tftp, usb, mmc, sata]. Default = tftp Examples: bubt - Burn flash-image.bin from tftp to active boot device bubt flash-image-new.bin nand - Burn flash-image-new.bin from tftp to NAND flash bubt backup-flash-image.bin mmc usb - Burn backup-flash-image.bin from usb to MMC No CLI available%.*s%*s syntax error ERROR : xmalloc failed ERROR : xrealloc failed ** Abort *?[\%u%s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS\$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodonebootdelaykernel-offsetkernaddrrootdisk-offsetrootaddrHit any key to stop autoboot: %2d  0 Hit any key to stop autoboot: %1dBTN '%s'> %s common/button_cmd.cbutton_cmd_%d_nameNo button labelled '%s' button_cmd_%dNo command set for button '%s' fdtdec_setup%s(): initcall %s() failed initf_malloclog_initarch_cpu_initmach_cpu_initinitf_dmboard_early_init_ftimer_initenv_initbaudrateserial_initconsole_init_fdisplay_optionscheckcpuDRAM: dram_initsetup_dest_addrarch_reserve_mmureserve_archreserve_stacksdram_init_banksize (total setup_bdinfoclear_bssinitr_dmboard_initinitr_lmbstdio_init_tablesserial_initializeCore: %d devices, %d uclasses, devicetree: %sWarning: Device tree includes old 'u-boot,dm-' tags: please fix by 2023.07! arch_initr_traparch_early_init_rpower_init_boardNAND: %lu MiB MMC: load-environmentcpu_secondary_init_rstdio_add_devicesjumptable_initconsole_init_rconsole_announce_rshow_board_infointerrupt_initboard_late_initNet: Model: %s NULL device name! mdio_register: non unique device name '%s' %x - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY extended status read failed, assuming no 1000BASE-X PHY 1000BT statusPHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T 1000BASE-X PHY AN duplexPHY duplexPHY AN adv duplex read failed, assuming half duplex unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) %s: invalid max packet size unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dusb_ignorelistusb_ignorelist parse error in "%s" usb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) Error: Cannot find high speed parent of usb-1 device cannot reset port %i!? usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times usb_hubusb-hub Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry usb_storage_blkusb_mass_storageusb-mass-storageEnter choice: y Y yes YES stdinstdoutstderrpre-reloc realloc() is not supportedalloc space exhausted ptr %lx limit %x common/malloc_simple.cCRC32 for %08lx ... %08lx ==> %08lx md5sha1crc16-ccittbootsecure## Error: Secure boot command not specified ## Error: "%s" returned (code %d) Problem No valid hush parser to use, cli will not initialized! %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d INVALIDEMERGALERTCRITERRWARNINGNOTICEINFODEBUGCONTENTIOcoredriver-modeldevice-treebloblistacpieventexpo%s.%s,%s:%d-%*s()loadxy_timeoutUnknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available ## Unknown partition table type %x Partition Map for %s device %d -- Partition Type: %s Whole Disk** Bad HW partition specification %s %s ** UBI** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") Could not find "%s" partition Couldn't find partition %s %s hdusbdmmcsdxx%s%c%dblk_partitionFATFAT32** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %08x-%02x Extd Boot%3d %-10lu %-10lu %08x-%02x %02x%s%s Part Start Sector Num Sectors UUID Type DOSPart Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %pUl guid: %pUl EFI%s:%d(none) IDE device %d: Device %d: unknown device %s.%ssatanvmenvmxipefiloadervirtiopvblockblkmaprkmtdlinux,codebutton_gpiogpio-keysgpio-keys-polledcompatibledrivers/core/lists.c/clocks/firmware/reserved-memorydrivers/core/root.croot_drivernopdrivers/core/device-remove.cnot-boundchild unbinducdevice '%s' failed to unbind simple_bussimple-bussimple-mfd %-10.10s %3d [ %c ] %-20.20s | `-- |-- uclass %d: %s %-3i %c %s @ %08lx, seq %d(out of memory) Class Seq Probed Driver Name ----------------------------------------------------------- Driver Compatible %-20.20s%-20.20s %s Driver uid uclass Devices %-25.25s %-3.3d %-20.20s %-51.51s%-25.25s Driver Address %-25.25s %p little-endianbig-endiannative-endiansysconbootph-allbootph-some-rambootph-pre-rambootph-pre-sramu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplu-boot,dm-vpl/configphy-modephy-connection-typephy-handlephy-deviceinternalrev-miirev-rmiirgmii-idrgmii-rxidrgmii-txidrtbismiixlgmiimocaqsgmiitrgmii100base-x1000base-x2500base-xrxaui10gbase-r25gbase-rusxgmii10gbase-krqusgmii1000base-kxinputoutput-highoutput-low%s: missing gpio-hog state. %s: wrong gpios property, 2 values needed %d line-namegpio-hoggpio_hog%s: %s: error: gpio %s%d not reserved get_valueset_valueset_dir_flags%s.%s%d#gpio-cells%s%d: %s: %d [%c]%s%soutputunusedngpiosmvebu%d_gpio_mvebumarvell,orion-gpiohvcsmcarm,psci-0.2psci-sysresetarm,psci-1.0arm,psciu-boot,i2c-transaction-bytesgeneric_%xi2c_generic_chip_drvclock-frequencydrivers/i2c/i2c-uclass.cu-boot,i2c-offset-leni2c-chipi2c_genericcell-indexu-boot,i2c-slave-addri2c_mvtwsimarvell,mv64xxx-i2cmarvell,mv78230-i2callwinner,sun4i-a10-i2callwinner,sun6i-a31-i2cfunction-enumerator%s:%s-%ddefault-statewhitegreenblueambervioletyellowmulticolorrgbpurpleorangepinkcyanlimegpio_ledgpio_led_wrapgpio-ledsError enabling VMMC supply : %d Unknown modeStatus Error: %#08x drivers/mmc/mmc.cTimeout waiting card ready MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd eMMC >= 4.4 required for enhanced user data area Card does not support partitioning Card does not define HC WP group size User data enhanced area not HC WP group size aligned GP%i partition not HC WP group-size aligned Card does not support enhanced attribute Total enhanced size exceeds maximum (%#x > %#x) Card does not support host controlled partition write reliability settings Card already partitioned vmmc-supplyvqmmc-supplyCard did not respond to voltage select! : %d MMC: no card present unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode: %d Man %06x Snr %04x%04x%c%c%c%c%c%c%s - probe failed: %d MMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)boot0boot1rpmbgp1gp2gp3gp4MMC Device %d not found eMMC%s: %d (%s)mmc_blk Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed Removing MTD device #%d (%s) with use count %d Warning: MTD name "%s" is not unique! drivers/mtd/mtdcore.cBUG at %s:%d/%s()! BUG!%s: unlock failed, writes may not work mtdidsmtdparts"%s" partitions still in use, can't delete them mtdparts=Wrong mtdparts: %s MTD name too long: %s Could not find a valid device for %s Could not parse device %s Failed parsing MTD partitions from mtdparts! Failed parsing MTD %s OF partitions! Minimum partition size 4kiB, %lldB requested No closing ')' found in partition name Empty partition name No partitions allowed after a fill-up Unexpected character '%c' in mtdparts 0x%08llx@0x%08llxmemory allocation error while creating partitions for "%s" mtd: partition "%s" is out of reach -- disabled mtd: partition "%s" extends beyond the end of device "%s" -- size truncated to %#llx drivers/mtd/mtdpart.cWARNING at %s:%d/%s()! mtd: partition "%s" doesn't start on an erase block boundary -- force read-only mtd: partition "%s" doesn't end on an erase block -- force read-only Not enough space to save partitions meta-data Partition size must be a multiple of %d Error when deleting partition "%s" (%d) fixed-partitionsread-onlyMTDnand%ddrivers/mtd/nand/raw/nand_bbt.cNo space left to write bad block table nand_bbt: can't scan flash and build the RAM-based BBT ToshibaSamsungFujitsuNationalRenesasST MicroHynixMicronAMD/SpansionMacronixEonSanDiskIntelATOUnknownTC58NVG0S3E 1G 3.3V 8-bitTC58NVG2S0F 4G 3.3V 8-bitTC58NVG2S0H 4G 3.3V 8-bitTC58NVG3S0F 8G 3.3V 8-bitTC58NVG5D2 32G 3.3V 8-bitTC58NVG6D2 64G 3.3V 8-bitSDTNQGAMA 64G 3.3V 8-bitSDTNRGAMA 64G 3.3V 8-bitH27UBG8T2BTR-BC 32G 3.3V 8-bitH27UCG8T2ATR-BC 64G 3.3V 8-bitH27QCG8T2E5R-BCF 64G 3.3V 8-bitNAND 4MiB 5V 8-bitNAND 4MiB 3,3V 8-bitNAND 8MiB 3,3V 8-bitNAND 16MiB 1,8V 8-bitNAND 16MiB 3,3V 8-bitNAND 16MiB 1,8V 16-bitNAND 16MiB 3,3V 16-bitNAND 32MiB 1,8V 8-bitNAND 32MiB 3,3V 8-bitNAND 32MiB 1,8V 16-bitNAND 32MiB 3,3V 16-bitNAND 64MiB 1,8V 8-bitNAND 64MiB 3,3V 8-bitNAND 64MiB 1,8V 16-bitNAND 64MiB 3,3V 16-bitNAND 128MiB 1,8V 8-bitNAND 128MiB 3,3V 8-bitNAND 128MiB 1,8V 16-bitNAND 128MiB 3,3V 16-bitNAND 256MiB 3,3V 8-bitNAND 256MiB 1,8V 8-bitNAND 256MiB 1,8V 16-bitNAND 256MiB 3,3V 16-bitNAND 512MiB 1,8V 8-bitNAND 512MiB 3,3V 8-bitNAND 512MiB 1,8V 16-bitNAND 512MiB 3,3V 16-bitNAND 1GiB 1,8V 8-bitNAND 1GiB 3,3V 8-bitNAND 1GiB 1,8V 16-bitNAND 1GiB 3,3V 16-bitNAND 2GiB 1,8V 8-bitNAND 2GiB 3,3V 8-bitNAND 2GiB 1,8V 16-bitNAND 2GiB 3,3V 16-bitNAND 4GiB 1,8V 8-bitNAND 4GiB 3,3V 8-bitNAND 4GiB 1,8V 16-bitNAND 4GiB 3,3V 16-bitNAND 8GiB 1,8V 8-bitNAND 8GiB 3,3V 8-bitNAND 8GiB 1,8V 16-bitNAND 8GiB 3,3V 16-bitNAND 16GiB 1,8V 8-bitNAND 16GiB 3,3V 8-bitNAND 16GiB 1,8V 16-bitNAND 16GiB 3,3V 16-bitNAND 32GiB 1,8V 8-bitNAND 32GiB 3,3V 8-bitNAND 32GiB 1,8V 16-bitNAND 32GiB 3,3V 16-bitNAND 64GiB 1,8V 8-bitNAND 64GiB 3,3V 8-bitNAND 64GiB 1,8V 16-bitNAND 64GiB 3,3V 16-bitbad blockbbt reservedAttempt to erase non block-aligned data Size of erase exceeds limit Skipping %s at 0x%08llx %s: MTD get bad block failed: %d %s: MTD Erase failure: %d %s: MTD writeoob failure: %d Erasing at 0x%llx -- %3d%% complete. Cleanmarker written at 0x%llx.Attempt to write non page-aligned data Attempt to write outside the flash area Size of write exceeds partition or device limit NAND write to offset %llx failed %d Skip bad block 0x%08llx Attempt to read non page-aligned data Attempt to read outside the flash area Size of read exceeds partition or device limit NAND read from offset %llx failed %d Skipping bad block 0x%08llx drivers/mtd/nand/raw/nand_base.cnand_base: Failed to configure data interface to SDR timing mode 0 ONFIEPPSJEDECnand_base: Could not find valid JEDEC parameter page; aborting nand_base: Could not find valid ONFI parameter page; aborting nand-bus-widthnand-is-boot-mediumnand-on-flash-bbtnand-ecc-modesofthwhw_syndromehw_oob_firstsoft_bchnand-ecc-algohammingnand-ecc-strengthnand-ecc-step-sizenand_base: must set both strength and step size in DT nand-ecc-maximizenand_base: Invalid ECC page accessors setup MX30LF1G18ACMX30LF2G18ACMX30LF4G18AC%s %s: failed to perform OTP IO: %i drivers/mtd/nand/raw/nand_macronix.cudevice *)(NULL%s %s: failed to leave OTP mode after %s Invalid OOB size valueCould not get ECC info%s %s: Timeout on RDDREQ while draining the FIFO drivers/mtd/nand/raw/pxa3xx_nand.c%s %s: Ready timeout!!! num-cspxa3xx driver supports single CS only marvell,nand-enable-arbitermarvell,nand-keep-configmarvell,system-controller%s %s: alloc nand resource failed pxa3xx_nand-0%s %s: There is no chip on cs %d! %s %s: Error: timings not found %s %s: Failed to set timings: %d %s %s: ECC strength %d at page size %d is not supported %s %s: unsupported page size on this variant %s %s: failed to scan nand at cs %d %s %s: non-supported command %x %s %s: Wait timeout!!! Failed to initialize %s. (error %d) marvell,armada370-nand-controllermarvell,armada-8k-nand-controllermarvell,mvebu-ac5-pxa3xx-nanddrivers/mtd/spi/sf-uclass.cspi_flash@%d:%djedec_spi_norspi_flashSF: Failed to set up slave drivers/mtd/spi/sf_probe.cjedec,spi-norw25p80w25p16w25p32w25x05w25x40w25x16w25x32w25q20clw25q20bww25q20eww25q32w25q16dww25q32dww25q16jvw25q32jvw25q32jwmw25q256jwmw25x64w25q64dww25q64jvw25q128fww25q128jvw25q128jww25q256fww25q256jww25q512jvw25q512nwqw25q512nwmw25q512jvqw25q01jvw25q01jvfimw25q02jvw25q80w25q80blw25q16clw25q32bvw25q64cvw25q128w25q256w25m512jww25m512jvw25h02jvw77q51nw%s %s: Erase operation failed. drivers/mtd/spi/spi-nor-core.c%s %s: Program operation failed. %s %s: Attempted to modify a protected sector. %s %s: flash operation timed out %s %s: unrecognized JEDEC id bytes: %02x, %02x, %02x m25p,fast-read%s %s: failed to read SFDP parameter headers %s %s: 16-bit opcodes not supported %s %s: non-uniform erase sector maps are not supported yet. %s %s: Failed to parse optional parameter table: %04x SF: Detected %s with page size , erase size , total drivers/mtd/ubi/attach.cubi%d error: %s: inconsistent vol_id ubi%d error: %s: inconsistent vol_type ubi%d error: %s: inconsistent used_ebs ubi%d error: %s: inconsistent data_pad ubi%d error: %s: inconsistent VID header at PEB %d ubi%d error: %s: unsupported on-flash UBI format ubi%d error: %s: VID of PEB %d header is bad, but it was OK earlier, err %d ubi%d error: %s: two LEBs with same sequence number %llu ubi%d error: %s: erase counter overflow at PEB %d, EC %d ubi%d error: %s: no free eraseblocks ubi%d error: %s: 'ubi_io_read_ec_hdr()' returned unknown code %d ubi%d error: %s: this UBI version is %d, image version is %d ubi%d error: %s: erase counter overflow, max is %d ubi%d error: %s: bad image sequence number %d in PEB %d, expected %d ubi%d error: %s: PEB %d contains corrupted VID header, and the data does not contain all 0xFF ubi%d error: %s: this may be a non-UBI PEB or a severe VID header corruption which requires manual inspection hexdump of PEB %d offset %d, length %dubi%d error: %s: 'ubi_io_read_vid_hdr()' returned unknown code %d ubi%d: "delete" compatible internal volume %d:%d found, will remove it ubi%d: read-only compatible internal volume %d:%d found, switch to read-only mode ubi%d: "preserve" compatible internal volume %d:%d found ubi%d error: %s: incompatible internal volume %d:%d found ubi%d: scanning is finished ubi%d error: %s: %d PEBs are corrupted and preserved Corrupted PEBs are:ubi%d error: %s: too many corrupted PEBs, refusing ubi%d: empty MTD device detected ubi%d error: %s: MTD device is not UBI-formatted and possibly contains non-UBI data - refusing it ubi%d error: %s: bad is_empty flag ubi%d error: %s: negative values ubi%d error: %s: bad vol_id ubi%d error: %s: highest_vol_id is %d, but vol_id %d is there ubi%d error: %s: bad vol_type ubi%d error: %s: bad data_pad ubi%d error: %s: bad ai->min_ec (%d), %d found ubi%d error: %s: bad ai->max_ec (%d), %d found ubi%d error: %s: too high PEB number %d, total PEBs %d ubi%d error: %s: bad lnum or used_ebs ubi%d error: %s: non-zero used_ebs ubi%d error: %s: incorrect highest_lnum or lnum ubi%d error: %s: bad leb_count, %d objects in the tree ubi%d error: %s: bad highest_lnum ubi%d error: %s: bad ai->vols_found %d, should be %d ubi%d error: %s: VID header is not OK (%d) ubi%d error: %s: bad sqnum %llu ubi%d error: %s: bad vol_id %d ubi%d error: %s: bad compat %d ubi%d error: %s: bad lnum %d ubi%d error: %s: bad used_ebs %d ubi%d error: %s: bad data_pad %d ubi%d error: %s: bad highest_lnum %d ubi%d error: %s: bad last_data_size %d ubi%d error: %s: PEB %d is not referred ubi%d error: %s: bad attaching information about LEB %d ubi%d error: %s: bad attaching information about volume %d ubi%d error: %s: mtd%d is already attached to ubi%d drivers/mtd/ubi/build.cubi%d error: %s: refuse attaching mtd%d - it is already emulated on top of UBI ubi%d error: %s: already exists ubi%d: attaching mtd%d ubi%d error: %s: multiple regions, not implemented ubi%d error: %s: min. I/O unit (%d) is not power of 2 ubi%d error: %s: bad write buffer size %d for %d min. I/O unit ubi%d error: %s: unaligned VID header shift %d ubi%d error: %s: bad VID header (%d) or data offsets (%d) ubi%d: MTD device %d is write-protected, attach in read-only mode ubi%d error: %s: failed to attach mtd%d, error %d ubi%d error: %s: cannot clean auto-resize flag for volume %d ubi%d error: %s: cannot auto-resize volume %d ubi%d: volume %d ("%s") re-sized from %d to %d LEBs ubi%dubi%d error: %s: cannot add volume %d ubi%d error: %s: cannot initialize UBI %s, error %d ubi%d error: %s: cannot spawn "%s", error %d ubi%d: attached mtd%d (name "%s", size %llu MiB) ubi%d: PEB size: %d bytes (%d KiB), LEB size: %d bytes ubi%d: min./max. I/O unit sizes: %d/%d, sub-page size %d ubi%d: VID header offset: %d (aligned %d), data offset: %d ubi%d: good PEBs: %d, bad PEBs: %d, corrupted PEBs: %d ubi%d: user volume: %d, internal volumes: %d, max. volumes count: %d ubi%d: max/mean erase counter: %d/%d, WL threshold: %d, image sequence number: %u ubi%d: available PEBs: %d, total reserved PEBs: %d, PEBs reserved for bad PEB handling: %d ubi%d error: %s: only %d UBI devices may be created ubi%d error: %s: %s reference count %d, destroy anyway ubi%d: detaching mtd%d ubi%d: mtd%d is detached UBI error: too many MTD devices, maximum is %d UBI error: cannot open mtd %s, error %d UBI error: cannot attach mtd%d UBI error: cannot initialize UBI, error %d UBI error: too many parameters, max. is %d UBI error: parameter "%s" is too long, max. is %d UBI error: too many arguments at "%s" UBI error: incorrect bytes count: "%s" UBI error: bad value for max_beb_per1024 parameter: %sUBI error: bad value for ubi_num parameter: %subi%d error: %s: bad CRC at record %u: %#08x, not %#08x drivers/mtd/ubi/vtbl.cubi%d error: %s: bad data_pad, has to be %d ubi%d error: %s: too large reserved_pebs %d, good PEBs %d ubi%d error: %s: volumes %d and %d have the same name "%s" ubi%d error: %s: volume table check failed: record %d, error %d ubi%d error: %s: self-check failed ubi%d error: %s: the layout volume was not found ubi%d error: %s: too many LEBs (%d) in layout volume ubi%d: volume table was restored ubi%d error: %s: both volume tables are corrupted ubi%d error: %s: more than one auto-resize volume (%d and %d) layout volumeubi%d error: %s: not enough PEBs, required %d, available %d ubi%d error: %s: %d PEBs are corrupted and not used ubi%d error: %s: found %d volumes while attaching, maximum is %d + %d ubi%d error: %s: too large volume ID %d found ubi%d: finish volume %d removal ubi%d error: %s: bad attaching information, error %d ubi%d error: %s: no volume info, but volume exists drivers/mtd/ubi/vmt.cubi%d error: %s: bad alignment ubi%d error: %s: alignment is not multiple of min I/O unit ubi%d error: %s: bad data_pad, has to be %lld ubi%d error: %s: update marker and corrupted simultaneously ubi%d error: %s: too large reserved_pebs ubi%d error: %s: bad usable_leb_size, has to be %lld ubi%d error: %s: too long volume name, max is %d ubi%d error: %s: bad name_len %lld ubi%d error: %s: corrupted dynamic volume ubi%d error: %s: bad used_ebs ubi%d error: %s: bad last_eb_bytes ubi%d error: %s: bad used_bytes ubi%d error: %s: bad skip_check ubi%d error: %s: volume info is different ubi%d error: %s: self-check failed for volume %d ubi%d error: %s: volume %d already exists ubi%d error: %s: volume "%s" exists (ID %d) ubi%d error: %s: not enough PEBs, only %d available ubi%d error: %s: cannot create volume %d, error %d ubi%d error: %s: out of volume IDs ubi%d error: %s: too small size %d, %d LEBs contain data ubi%d error: %s: not enough PEBs: requested %d, available %d ubi%d error: %s: cannot open device %d, volume %d, error %d drivers/mtd/ubi/kapi.cubi%d: force data checking ubi%d: recover PEB %d, move data to PEB %d ubi%d: data was successfully recovered ubi%d: try again ubi%d: try another PEB ubi%d error: %s: LEB:%i:%i is PEB:%i instead of %i! drivers/mtd/ubi/eba.cubi%d error: %s: no enough physical eraseblocks (%d, need %d) ubi%d error: %s: node with incompatible UBI version found: this UBI version is %d, image version is %d drivers/mtd/ubi/io.cubi%d error: %s: bad VID header offset %d, expected %d ubi%d error: %s: bad data offset %d, expected %d ubi%d error: %s: bad erase counter %lld ubi%d error: %s: bad EC header ubi%d error: %s: bad magic %#08x, must be %#08x ubi%d error: %s: self-check failed for PEB %d ubi%d error: %s: bad copy_flag ubi%d error: %s: bad compat ubi%d error: %s: zero used_ebs ubi%d error: %s: zero data_size ubi%d error: %s: bad data_size ubi%d error: %s: too high lnum ubi%d error: %s: non-zero data CRC ubi%d error: %s: non-zero data_size ubi%d error: %s: zero data_size of copy ubi%d error: %s: bad VID header ubi%d error: %s: bad VID header magic %#08x at PEB %d, must be %#08x ubi%d error: %s: error %d while checking if PEB %d is bad (ECC error)ubi%d: fixable bit-flip detected at PEB %d ubi%d error: %s: error %d%s while reading %d bytes from PEB %d:%d, read %zd bytes ubi%d error: %s: bad CRC, calculated %#08x, read %#08x ubi%d error: %s: read-only mode ubi%d error: %s: cannot mark PEB %d bad, error %d ubi%d error: %s: validation failed for PEB %d ubi%d error: %s: cannot allocate memory to check for 0xFFs ubi%d error: %s: err %d while reading %d bytes from PEB %d:%d, read %zd bytes ubi%d error: %s: flash region at PEB %d:%d, length %d does not contain all 0xFF bytes ubi%d: hex dump of the %d-%d region ubi%d error: %s: bad VID header CRC at PEB %d, calculated %#08x, read %#08x ubi%d error: %s: cannot write %d bytes to PEB %d:%d (emulated) ubi%d error: %s: cannot allocate memory to check writes ubi%d error: %s: self-check failed for PEB %d:%d, len %d ubi%d: data differ at position %d ubi%d: hex dump of the original buffer from %d to %d ubi%d: hex dump of the read buffer from %d to %d ubi%d error: %s: error %d while writing %d bytes to PEB %d:%d, written %zd bytes ubi%d error: %s: cannot erase PEB %d, error %d ubi%d error: %s: cannot erase PEB %d ubi%d error: %s: cannot erase PEB %d (emulated) ubi%d error: %s: cannot invalidate PEB %d, write returned %d ubi%d: run torture test for PEB %d ubi%d error: %s: erased PEB %d, but a non-0xFF byte found ubi%d error: %s: pattern %x checking failed for PEB %d ubi%d: PEB %d passed torture test, do not mark it as bad ubi%d error: %s: read problems on freshly erased PEB %d, must be bad ubi%d error: %s: work failed with error code %d drivers/mtd/ubi/wl.cubi%d error: %s: self-check failed for PEB %d, EC %d, Protect queue ubi%d error: %s: self-check failed for PEB %d, EC %d, RB-tree %p ubi%d error: %s: %s: work failed with error code %d ubi%d error: %s: read EC is %lld, should be %d ubi%d error: %s: erase counter overflow at PEB %d, EC %llu ubi%d error: %s: failed to erase PEB %d, error %d ubi%d error: %s: bad physical eraseblock %d detected ubi%d error: %s: no reserved/available physical eraseblocks ubi%d: mark PEB %d as bad ubi%d: %d PEBs left in the reserve ubi%d error: %s: error %d while reading VID header from PEB %d ubi%d error: %s: too many erroneous eraseblocks (%d) ubi%d: scrubbed PEB %d (LEB %d:%d), data moved to PEB %d ubi%d error: %s: error %d while moving PEB %d to PEB %d ubi%d error: %s: error %d while moving PEB %d (LEB %d:%d) to PEB %d ubi%d error: %s: PEB %d not found ubi%d: schedule PEB %d for scrubbing ubi_bgt%ddubi%d error: %s: new PEB %d does not contain all 0xFF bytes ubi%d: reserved more %d PEBs for bad PEB handling drivers/mtd/ubi/debug.cubi%d: dumping %d bytes of data from PEB %d, offset %d Erase counter header dump: magic %#08x version %d ec %llu vid_hdr_offset %d data_offset %d image_seq %d hdr_crc %#08x erase counter header hexdump: Volume identifier header dump: magic %08x version %d vol_type %d copy_flag %d compat %d vol_id %d lnum %d data_size %d used_ebs %d data_pad %d sqnum %llu hdr_crc %08x Volume identifier header hexdump: Volume information dump: vol_id %d reserved_pebs %d alignment %d data_pad %d vol_type %d name_len %d usable_leb_size %d used_ebs %d used_bytes %lld last_eb_bytes %d corrupted %d upd_marker %d skip_check %d name %s 1st 5 characters of name: %c%c%c%c%c Volume table record %d dump: name NULL crc %#08x Volume attaching information dump: vol_id %d highest_lnum %d leb_count %d compat %d vol_type %d used_ebs %d last_data_size %d data_pad %d eraseblock attaching information dump: ec %d pnum %d lnum %d scrub %d sqnum %llu drivers/net/mvmdio.cXSMI bus read not valid mvmdiomarvell,orion-mdiomarvell,xmdioCannot find eth driver mvpp2-%d%s: Wrong port mode (%d) drivers/net/mvpp2.c%s %s: Tx stop timed out, status=0x%08x timeout: packet not sent from aggregated to phys TXQ timeout: packet not sent %s %s: bad rx status %08x (crc error), size=%zu %s %s: bad rx status %08x (overrun error), size=%zu %s %s: bad rx status %08x (resource error), size=%zu %s %s: port %d: cleaning queue %d timed out %s %s: mvpp2_prs_mac_da_accept BC failed %s %s: mvpp2_prs_mac_da_accept MC failed %s %s: mvpp2_prs_def_flow failed %s %s: cannot allocate Rx queues %s %s: cannot allocate Tx queues %s %s: Marking phy as invalid, link will not be checked %s %s: cannot connect to phy %s: No link fixed-link%s %s: could not find phy address %s %s: incorrect phy mode %s %s: missing port-id value phy-reset-gpiosmarvell,sfp-tx-disable-gpiogop-port-id%s %s: missing gop-port-id value illegal port number %dRequested port mode (%d) not supported %s %s: invalid queue size parameter %s %s: BM pool %d is not %d bytes aligned %s %s: failed to create BM pool %d, size %d %s %s: failed to initialize controller %s %s: mixing pool types is forbidden %s %s: cannot allocate %d buffers for pool %d %s %s: pool %d: %d of %d allocated %s %s: failed to init port %d mvpp2_basemarvell,armada-375-pp2marvell,armada-7k-pp22mvpp2(null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d phy_aneg_timeout%s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! PHY reset timed out Generic PHYWaiting for PHY realtime linkmarvell,reg-initMarvell 88E1680Marvell 88E1310Marvell 88E151xMarvell 88E1240Marvell 88E1149SMarvell 88E1145Marvell 88E1121RMarvell 88E1118RMarvell 88E1118Marvell 88E1111SMarvell 88E1011SComphy-%d: %-13s Comphy-%d: %-13s %-10s marvell,comphy-a3700marvell,comphy-cp110%s %s: comphy: No compatible DT node found drivers/phy/marvell/comphy_core.cComphy chip #%d: marvell,armada80401.25 Gbps2.5 Gbps3.125 Gbps5.125 Gpbs6 Gbps10.3125 GbpsUNCONNECTEDPEX0PEX1PEX2PEX3SATA0SATA1SGMII0SGMII1SGMII2USB3USB3_HOST0USB3_HOST1USB3_DEVICERXAUI0RXAUI1SFI0SFI1APIGNOREmvebu_comphymarvell,mvebu-comphyComphy %d isn't configured to SFI drivers/phy/marvell/comphy_cp110.cmarvell,mvebu-utmi-2.6.0UTMI PHY PLL address is invalid UTMI PHY base address is invalid utmi-portUTMI PHY port type is invalid Impedance calibration is not done PLL calibration is not done PLL is not ready Failed to initialize UTMI PHY %d UTMI PHY %d initialized to USB Device USB Host%d max-lanescomphy max lanes is wrong mux-bitcountcomphy mux bit count is wrong mux-lane-orderphy-typeno phy type for lane %d, setting lane as unconnected phy-speedphy-invertclk-srcend_pointmarvell,armada-8k-ahciSATA node not found in FDT SATA address not found in FDT PLL is not locked - Failed to initialize lane %d gpio-controllerpinconfigpinctrl-namespinctrl-%d%s %s: %s: uclass_get_device_by_phandle_id: err=%d drivers/pinctrl/pinctrl-uclass.c%s %s: could not find pctldev %s %s: %s: pinctrl_config_one: err=%d marvell,ap806-pinctrlmarvell,armada-8k-cpm-pinctrlmarvell,armada-7k-pinctrlmarvell,pinsmarvell,functionpin-funcpin-countmax-funcbank-namereverse-regmvebu_pinctrlmarvell,mvebu-pinctrlmarvell,armada-8k-cps-pinctrlregulator-min-microvoltregulator-max-microvoltregulator-init-microvoltregulator-min-microampregulator-max-microampregulator-ramp-delayregulator-force-boot-offregulator-state-memregulator-off-in-suspendregulator-suspend-microvoltregulator-always-onregulator-boot-onregulator-name%s %s: '%s' has nonunique value: '%s drivers/power/regulator/regulator-uclass.cregulatorstdout-pathNo serial driver found## Baudrate %d bps not supported ## Baudrate may not be deleted reg-offsetreg-shiftreg-io-width ns16550_serialns16550ns16550aingenic,jz4780-uartnvidia,tegra20-uartsnps,dw-apb-uartintel,xscale-uart%s %s: Cannot set speed (err=%d) drivers/spi/spi-uclass.c%s %s: Cannot set mode (err=%d) spi-max-frequency%s %s: Invalid cs %d (err=%d) Invalid bus %d (err=%d) %s %s: Invalid chip select %d:%d (err=%d) %s %s: Warning: SPI speed fallback to %u kHz spi-cpolspi-cphaspi-cs-highspi-3wirespi-half-duplexspi-tx-bus-widthspi-rx-bus-widthspi_generic*** spi_xfer: Time out during SPI transfer mvebu_spimarvell,orion-spimarvell,armada-375-spimarvell,armada-380-spimarvell,armada-xp-spimiscid%dlun%dnamdrivers/scsi/scsi.cscsi_blkscanning bus for devices... unable to unbind devices (%dE) unbRx: failed to receive: %d Waiting for Ethernet connection... done. unable to connect. r8152 Unknown Device r8152_ethusb,device-classusb,interface-classgeneric_bus_%x_dev_%xusb_dev_generic_drvScanning bus %s failed, error %d Bus %s: Port not available. Bus %s: probe failed, error %d companionFailed to get companion (ret=%d) Bus %s: No USB Device found %d USB Device(s) found No USB controllers found usb_dev_genericEHCI fail timeout STS_ASS reset out of buffer pointers (%zu bytes left) EHCI failed: timeout when disabling periodic list EHCI failed: timeout when enabling periodic list EHCI failed to shut down host controller. %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue Timeout poll on interrupt endpoint unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error EHCI fail to reset USB EHCI %x.%02x marvell,armada-3700-ehcimarvell,ac5-ehciehci_mvebumarvell,orion-ehciHost not halted after %u microseconds. non-bulk pipe (type=%lu)non-interrupt pipe (type=%lu)Evaluate ContextConfigure Endpointdrivers/usb/host/xhci.cERROR: %s command returned completion code %d. Could not allocate xHCI USB device data structures non-control pipe (type=%lu)The request port(%d) exceeds maximum port number unknown value DT_STRING %x unknown value %x unknown feature %x Unknown request Setup ERROR: address device command for slot %d. Device not responding to set address. ERROR: Incompatible devicefor address device command. ERROR: unexpected command completion code 0x%x. Failed to configure xHCI endpoint Register %x NbrPorts %d Starting the controller USB XHCI %x.%02x  drivers/usb/host/xhci-mem.cVirt dev for slot[%d] already allocated Failed to allocate virtual device drivers/usb/host/xhci-ring.cWARN urb submitted to disabled ep WARN waiting for error on ep to be cleared WARN endpoint is halted ERROR unknown endpoint state for ep Unexpected XHCI event TRB, skipping... (%08x %08x %08x %08x) XHCI timeout on event type %d... Resetting EP %d... abort_td: Expected a TRB_TRANSFER TRB first vbus-supplyFailed to turn ON the VBUS regulator xhci_mvebumarvell,armada3700-xhcimarvell,armada-380-xhcimarvell,armada-8k-xhcienv_buf [%u bytes] too small for value of "%s" ## Error: illegal character '=' in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d %pMmissing environment variable: %s autostart*** Warning - %s, using default environment env/common.cbad CRCCannot import environment: errno = %d import failed${...}${Loading Environment from %s... not initialized Failed (%d) Saving Environment to %s... not possible ^%s$eth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,.callbacksspi_flash_probe_bus_cs() failedErasing SPI flash...Writing to SPI flash...malloc() failedspi_flash_read() failedSPIFlash** Unable to write file %s ** fs/fs.c %s/ %s %8lld %s %d file(s), %d dir(s) ** Unable to create link %s -> %s ** Can't set block device ** No boot file defined ** ** Reading file would overwrite reserved memory ** Failed to load '%s' %llu bytes read in %lu ms (%llu bytes written in %lu ms** Unable to create a directory "%s" ** Supported filesystemsext4ubifsunsupportedpart_offset is %lu total_sector is %llu error: overflow occurs No Memory %s: Device read error! invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** Block full, trying previous All blocks full: Allocate new Directory uses extents Directory exceeds limit no block left to assign no inode left to assign Badly aligned ext2_dirent Invalid path It is a Directory file found, deleting Failed to iterate over directory %s fs uses incompatible features: %08x, ignoring fs/ext4/ext4_common.cError in ext4fs_log_gdt Error in getting the block group descriptor table error in File System init Unsupported features found %08x, not writing. fs/ext4/ext4_write.cUnsupported RO compat features found %08x, not writing. hash tree directory No memory Not enough space on partition !!! Error in copying content ** Cannot support non-zero offset ** ** Error ext4fs_write() ** *** Not enough journal entries allocated fs/ext4/ext4_journal.cInvalid input arguments %s buffer ptr is NULL _get_node: malloc failed Journal Recovery Completed Journal Scan Completed Recovery required update journal finished Invalid FAT entry: %#08x fs/fat/fat.cFAT sector size mismatch (fs=%u, dev=%lu) FAT cluster size not set FAT cluster size too big (cs=%u, max=%u) UNo current device Interface: %s No valid FAT fs found Filesystem: FAT%d "%s" Invalid FAT entry Error reading cluster %02X%02X-%02X%02X%s: Error, no memory for malloc! Symlink recursion, aborting %s/%sUBIFS error (ubi%d:%d pid %d): %s: invalid compression type %d fs/ubifs/ubifs.cUBIFS error (ubi%d:%d pid %d): %s: compression type %d is not compiled in UBIFS error (ubi%d:%d pid %d): %s: %s compression is not compiled in UBIFS error (ubi%d:%d pid %d): %s: cannot decompress %d bytes, compressor %s, error %d UBIFS error (ubi%d:%d pid %d): %s: bad data node (block %u, inode %lu) other %s: Error in ubifs_iget(), ino=%lld ret=%p! %.3s %.3s %.2d %.2d:%.2d:%.2d %d %9lld %24.24s UBIFS error (ubi%d:%d pid %d): %s: cannot find next direntry, error %d %s: Error reading inode %ld! ubifs: Error offset must be a multiple of %d ubifs: Error offset (%lld) > file-size (%lld) %s: Error, malloc fails! UBIFS error (ubi%d:%d pid %d): %s: cannot read page %lu of inode %lu, error %d Error reading file '%s' Loading file '%s' to addr 0x%08lx... Done Unmounting UBIFS volume %s! zlibdeflateUBIFS error (ubi%d:%d pid %d): %s: sequence number overflow %llu, end of life fs/ubifs/io.cUBIFS error (ubi%d:%d pid %d): %s: reading %d bytes from LEB %d:%d failed, error %d UBIFS error (ubi%d:%d pid %d): %s: unmap LEB %d failed, error %d UBIFS error (ubi%d:%d pid %d): %s: ubi_is_mapped failed for LEB %d, error %d UBIFS error (ubi%d:%d pid %d): %s: bad magic %#08x, expected %#08x UBIFS error (ubi%d:%d pid %d): %s: bad node type %d UBIFS error (ubi%d:%d pid %d): %s: bad CRC: calculated %#08x, read %#08x UBIFS error (ubi%d:%d pid %d): %s: bad node length %d UBIFS error (ubi%d:%d pid %d): %s: bad node at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: bad node type (%d but expected %d) UBIFS error (ubi%d:%d pid %d): %s: expected node type %d UBIFS error (ubi%d:%d pid %d): %s: bad node length %d, expected %d UBIFS error (ubi%d:%d pid %d): %s: bad node at LEB %d:%d, LEB mapping status %d UBIFS error (ubi%d:%d pid %d): %s: orphan list not empty at unmount fs/ubifs/super.cUBIFS error (ubi%d:%d pid %d): %s: inode is too large (%lld) UBIFS error (ubi%d:%d pid %d): %s: inode %lu validation failed, error %d UBIFS error (ubi%d:%d pid %d): %s: failed to read inode %lu, error %d UBI volumeUBIFS error (pid: %d): cannot open "%s", error %d UBIFS: only ro mode in U-Boot allowed. UBIFS error (ubi%d:%d pid %d): %s: too small LEBs (%d bytes), min. is %d bytes UBIFS error (ubi%d:%d pid %d): %s: too few LEBs (%d), min. is %d UBIFS error (ubi%d:%d pid %d): %s: bad min. I/O size %d UBIFS error (ubi%d:%d pid %d): %s: bad write buffer size %d for %d min. I/O unit UBIFS error (ubi%d:%d pid %d): %s: can't format empty UBI volume: read-only %s UBIFS error (ubi%d:%d pid %d): %s: cannot mount read-write - read-only media UBIFS error (ubi%d:%d pid %d): %s: 'compressor "%s" is not compiled in UBIFS error (ubi%d:%d pid %d): %s: too small LEB size %d, at least %d needed UBIFS error (ubi%d:%d pid %d): %s: too small log %d LEBs, required min. %d LEBs ubifs_bgt%d_%dUBIFS error (ubi%d:%d pid %d): %s: no LEB for GC Error reading superblock on volume '%s' errno=%d! No UBIFS filesystem found! UBIFS error (ubi%d:%d pid %d): %s: on-flash format version is w%d/r%d, but software only supports up to version w%d/r%d fs/ubifs/sb.cUBIFS error (ubi%d:%d pid %d): %s: on-flash format version %d is not supported UBIFS error (ubi%d:%d pid %d): %s: unsupported key format UBIFS error (ubi%d:%d pid %d): %s: min. I/O unit mismatch: %d in superblock, %d real UBIFS error (ubi%d:%d pid %d): %s: LEB size mismatch: %d in superblock, %d real UBIFS error (ubi%d:%d pid %d): %s: bad LEB count: %d in superblock, %d on UBI volume, %d minimum required UBIFS error (ubi%d:%d pid %d): %s: max. LEB count %d less than LEB count %d UBIFS error (ubi%d:%d pid %d): %s: too small journal (%lld bytes), must be at least %lld bytes UBIFS error (ubi%d:%d pid %d): %s: too large journal size (%lld bytes), only %lld bytes available in the main area UBIFS error (ubi%d:%d pid %d): %s: bad superblock, error %d UBIFS error (ubi%d:%d pid %d): %s: unexpected node type %d master LEB %d:%d fs/ubifs/master.cUBIFS error (ubi%d:%d pid %d): %s: bad leb_cnt on master node UBIFS error (ubi%d:%d pid %d): %s: bad master node at offset %d error %d UBIFS error (ubi%d:%d pid %d): %s: too few LPT LEBs fs/ubifs/lpt.cUBIFS error (ubi%d:%d pid %d): %s: LPT ltab too big UBIFS error (ubi%d:%d pid %d): %s: invalid crc in LPT node: crc %hx calc %hx UBIFS error (ubi%d:%d pid %d): %s: invalid type (%d) in LPT node type %d UBIFS error (ubi%d:%d pid %d): %s: error %d reading nnode at %d:%d UBIFS error (ubi%d:%d pid %d): %s: error %d reading pnode at %d:%d UBIFS error (ubi%d:%d pid %d): %s: calc num: %d UBIFS error (ubi%d:%d pid %d): %s: bad pad node at LEB %d:%d fs/ubifs/scan.cUBIFS error (ubi%d:%d pid %d): %s: bad padding length %d - %d UBIFS error (ubi%d:%d pid %d): %s: cannot read %d bytes from LEB %d:%d, error %d UBIFS error (ubi%d:%d pid %d): %s: corruption at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: first %d bytes from LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: garbage UBIFS error (ubi%d:%d pid %d): %s: bad node UBIFS error (ubi%d:%d pid %d): %s: unknown UBIFS error (ubi%d:%d pid %d): %s: empty space starts at non-aligned offset %d UBIFS error (ubi%d:%d pid %d): %s: corrupt empty space at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: LEB %d scanning failed UBIFS error (ubi%d:%d pid %d): %s: LEB %d scanning failed, error %d UBIFS error (ubi%d:%d pid %d): %s: cannot change properties of LEB %d, error %d fs/ubifs/lprops.cUBIFS error (ubi%d:%d pid %d): %s: cannot update properties of LEB %d, error %d UBIFS error (ubi%d:%d pid %d): %s: old idx added twice! fs/ubifs/tnc.cUBIFS error (ubi%d:%d pid %d): %s: cannot read node type %d from LEB %d:%d, error %d UBIFS error (ubi%d:%d pid %d): %s: current fanout %d, branch count %d fs/ubifs/tnc_misc.cUBIFS error (ubi%d:%d pid %d): %s: max levels %d, znode level %d UBIFS error (ubi%d:%d pid %d): %s: bad branch %d UBIFS error (ubi%d:%d pid %d): %s: bad key type at slot %d: %d UBIFS error (ubi%d:%d pid %d): %s: bad target node (type %d) length (%d) UBIFS error (ubi%d:%d pid %d): %s: have to be %d UBIFS error (ubi%d:%d pid %d): %s: have to be in range of %d-%d UBIFS error (ubi%d:%d pid %d): %s: bad key order (keys %d and %d) UBIFS error (ubi%d:%d pid %d): %s: keys %d and %d are not hashed but equivalent UBIFS error (ubi%d:%d pid %d): %s: bad indexing node at LEB %d:%d, error %d UBIFS error (ubi%d:%d pid %d): %s: bad key in node at LEB %d:%d inode(%lu, %s)(%lu, %s, %#08x)(%lu, %s, %u)truncate(bad key type: %#08x, %#08x)bad key format %dunknown nodeR5unknown/invalid name hashsimpleunknown/invalid formatNot a node, first %zu bytes:fs/ubifs/debug.c magic %#x crc %#x node_type %d (%s) group_type %d (%s) sqnum %llu len %u pad_len %u key_hash %d (%s) key_fmt %d (%s) flags %#x big_lpt %u space_fixup %u min_io_size %u leb_size %u leb_cnt %u max_leb_cnt %u max_bud_bytes %llu log_lebs %u lpt_lebs %u orph_lebs %u jhead_cnt %u fanout %u lsave_cnt %u default_compr %u rp_size %llu rp_uid %u rp_gid %u fmt_version %u time_gran %u UUID %pUB highest_inum %llu commit number %llu log_lnum %u root_lnum %u root_offs %u root_len %u gc_lnum %u ihead_lnum %u ihead_offs %u index_size %llu lpt_lnum %u lpt_offs %u nhead_lnum %u nhead_offs %u ltab_lnum %u ltab_offs %u lsave_lnum %u lsave_offs %u lscan_lnum %u empty_lebs %u idx_lebs %u total_free %llu total_dirty %llu total_used %llu total_dead %llu total_dark %llu lnum %u offs %u jhead %u key %s creat_sqnum %llu size %llu nlink %u atime %lld.%u mtime %lld.%u ctime %lld.%u uid %u gid %u mode %u xattr_cnt %u xattr_size %u xattr_names %u compr_type %#x data len %u inum %llu type %d nlen %d name (bad name length, not printing, bad or corrupted node) size %u compr_typ %d data size %d data: inum %u old_size %llu new_size %llu child_cnt %d level %d Branches: %d: LEB %d:%d len %d key %s last node flag %llu %d orphan inode numbers: ino %llu node type %d was not recognized znode %p, LEB %d:%d len %d parent %p iip %d level %d child_cnt %d flags %lx zbranches: %d: znode %p LEB %d:%d len %d key %s %d: LNC %p LEB %d:%d len %d key %s (pid %d) dumping pnode: address %zx parent %zx cnext %zx flags %lu iip %d level %d num %d %d: free %d dirty %d flags %d lnum %d not categorizeddirtyfreeemptyfreeable0 (GC)1 (base)2 (data)commit restingbackground commit requestedcommit requiredBACKGROUND commit runningcommit running and requiredbroken commitinode nodedata nodedirentry nodexentry nodetruncate nodepadding nodesuperblock nodemaster nodereference nodeindexing nodecommit start nodeorphan nodeno node groupin node grouplast of node groupdirentryxentryUBIFS error (ubi%d:%d pid %d): %s: orphaned twice fs/ubifs/orphan.cUBIFS error (ubi%d:%d pid %d): %s: invalid node type %d in orphan area at %d:%d UBIFS error (ubi%d:%d pid %d): %s: out of order commit number %llu in orphan node at %d:%d UBIFS error (ubi%d:%d pid %d): %s: failed to recover master node fs/ubifs/recovery.cUBIFS error (ubi%d:%d pid %d): %s: dumping first master node UBIFS error (ubi%d:%d pid %d): %s: dumping second master node UBIFS error (ubi%d:%d pid %d): %s: unexpected return value %d UBIFS error (ubi%d:%d pid %d): %s: corrupt empty space LEB %d:%d, corruption starts at %d UBIFS error (ubi%d:%d pid %d): %s: corruption %d UBIFS error (ubi%d:%d pid %d): %s: Not a valid node UBIFS error (ubi%d:%d pid %d): %s: Node a CS node, type is %d UBIFS error (ubi%d:%d pid %d): %s: CS node cmt_no %llu != current cmt_no %llu UBIFS error (ubi%d:%d pid %d): %s: failed to get CS sqnum UBIFS error (ubi%d:%d pid %d): %s: unrecoverable log corruption in LEB %d directory entryextended attribute entryUBIFS error (ubi%d:%d pid %d): %s: bad %s node fs/ubifs/replay.cUBIFS error (ubi%d:%d pid %d): %s: bad key type %d UBIFS error (ubi%d:%d pid %d): %s: bad index head LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: first log node at LEB %d:%d is not CS node UBIFS error (ubi%d:%d pid %d): %s: first CS node at LEB %d:%d has wrong commit number %llu expected %llu UBIFS error (ubi%d:%d pid %d): %s: first node is not at zero offset UBIFS error (ubi%d:%d pid %d): %s: file system's life ended UBIFS error (ubi%d:%d pid %d): %s: bad sqnum %llu, commit sqnum %llu UBIFS error (ubi%d:%d pid %d): %s: bud at LEB %d:%d was already referred UBIFS error (ubi%d:%d pid %d): %s: unexpected node in log UBIFS error (ubi%d:%d pid %d): %s: log error detected while replaying the log at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: no UBIFS nodes found at the log head LEB %d:%d, possibly corrupted UBIFS error (ubi%d:%d pid %d): %s: bad truncation node UBIFS error (ubi%d:%d pid %d): %s: unexpected node type %d in bud LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: bad node is at LEB %d:%d ** Invalid Block Device Descriptor (NULL) fs/fs_internal.c** Read outside partition %lu ** %s read error ** ** %s read error - block * %s read error - last part linux,phandleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGS#address-cells%d.%d.%d.%dlist passed to list_sort() too long for efficiency invalid distance too far backinvalid distance codeinvalid literal/length codeunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkError: Bad gzipped data Error: gunzip out of data in header %lu/%lu %lu bytes, crc 0x%08x uncompressed %lu of %lu crcs == 0x%08x/0x%08x %s: size %lu not a multiple of %lu %s: start offset %lu not a multiple of %lu Error: gunzip out of data in headersize of %lx doesn't match trailer low bits %x %s: uncompressed size %lu exceeds device size Error: inflateInit2() returned %d %s: weird termination with result %d Error: inflate() returned %d abort No valid device tree binary found at %p okayseparatefitembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-init## ERROR: unsupported match method: 0x%02x Env export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! , Build: %s%llu Hz%s%lu.%ld %cHz%s%u Bytes%s %ciB%s %0*lx### ERROR ### Please RESET the board ### %s.count = %#x %s[%d] [%#llx-%#llx], %#llx bytes, flags: no-overwriteno-notifyinvalid %#x lmb_dump_all: Unable to init LMB lib/lmb.cRE is too long (code overflow)RE is too long (data overflow)unknown cmd (%d) at %d Jump offset is too bigNo closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\mbrmsftraidswaplvmu-boot-envcros-kerncros-rootcros-fwcros-rsrvEFI System Partition## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d U-Boot.armv8bootp_archInvalid pxeuuid: %s bootp_vciHost Name*** WARNING: %s is too long (%d - max: %d) - truncated Root PathNIS Domain NameError: Failed to allocate pxelinux_configfile *** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE bootpretransmitperiodinitbootpretryperiodbootpretransmitperiodmaxBOOTP broadcast %d Retry time exceeded; starting again netretryyesnoonce ICMP Host Redirect to %pI4 *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Cannot autoload with TFTPGET Abort Bytes transferred = %u (%x hex) nvlanUsing %s device done octetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedblksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again TFTP error: '%s' (%d) Not retrying... Retry count exceeded %s; starting again T TFTP server diedfromtftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' TFTP %s server %pI4; our IP address is %pI4; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Save address: 0x%lx Save size: 0x%lx Saving: *Load address: 0x%lx Loading: * Error: eth device name "%s" has a space! Error: %s address %pM illegal value Warning: %s failed to set MAC address Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Warning: %s (eth%d) using random MAC address - %pM ethactethrotatenet/eth-uclass.cethprimeeth%d: %s [PRIME]%s %s: couldn't allocate mii_bus net/mdio-uclass.creset-delay-usreset-post-delay-us%s %s: couldn't get reset-gpios: %d device-name%s%daddr%saddreth%dmacskipethmacskipSunMonTueWedThuFriSatbootdelay=5baudrate=115200loadaddr=0x800000mtdids=mtdparts=boot_devices=ubi usb netbootcmd=for b in ${boot_devices}; do if test ${b} = ubi; then run ubiboot; fi; if test ${b} = usb; then run usbboot; fi; if test ${b} = net; then run netboot; fi; done;button_cmd_0=run recovery_bootcmdbutton_cmd_0_name=resetnetboot=echo Booting from Network; dhcp; tftpboot ${loadaddr} ${openwrt_initramfs}; bootm ${loadaddr};openwrt_initramfs=openwrt-mvebu-cortexa72-mikrotik_rb5009-initramfs-uImage.itbrecovery_boot_devices=usb netrecovery_bootcmd=led green:sfp on; led blue:hdr1 on; led blue:hdr2 on; for b in ${recovery_boot_devices}; do if test ${b} = usb; then run usbboot; fi; if test ${b} = net; then run netboot; fi; done;ubiboot=echo Booting from NAND (UBI); ubi part ubi; setenv loadimagecmd ${ubiloadimage}; ubi read ${loadaddr} kernel; bootm ${loadaddr};usbboot=echo Booting from USB Storage; usb start; load usb 0:1 ${loadaddr} ${openwrt_initramfs}; bootm ${loadaddr};scriptaddr=0x6d00000pxefile_addr_r=0x6e00000fdt_addr_r=0x6f00000kernel_addr_r=0x7000000ramdisk_addr_r=0xa000000fdtfile=marvell/armada-7040-rb5009.dtb0123456789ABCDEFcompat Dump list of drivers with compatibility strings dm devres Dump list of device resources for each device dm drivers Dump list of drivers with uclass and instances dm static Dump list of drivers with static platform data dm tree [-s][-e][name] Dump tree of driver model devices (-s=sort) dm uclass [-e][name] Dump list of instances for each uclassarocsdxbimdefault [-k] [-f] -a - [forcibly] reset default environment env default [-k] [-f] var [...] - [forcibly] reset variable(s) to their default values "-k": keep variables not defined in default environment env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...]  addr [-c] [-q] [] - Set the [control] fdt location to fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.0123456789abcdefbus [muxtype:muxaddr:muxchannel] - show I2C bus info i2c crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length [-s] - write memory to I2C; the -s option selects bulk write in a single transaction i2c flags chip [flags] - set or get chip flags i2c olen chip [offset_length] - set or get chip offset length i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedaddr part [dest] - extract from legacy image at and copy to addr uname [dest] - extract subimage from FIT image at and copy to LZO  JanFebMarAprMayJunJulAugSepOctNovDec- generic operations on memory technology devices mtd list mtd read[.raw][.oob] [ []] mtd dump[.raw][.oob] [ []] mtd write[.raw][.oob][.dontskipff] [ []] mtd erase[.dontskipbad] [ []] Specific functions: mtd bad With: : NAND partition/chip name (or corresponding DM device name or OF path) : user address from/to which data will be retrieved/stored : offset in in bytes (default: start of the part) * must be block-aligned for erase * must be page-aligned otherwise : length of the operation in bytes (default: the entire device) * must be a multiple of a block for erase * must be a multiple of a page otherwise (special case: default is a page with dump) The .dontskipff option forces writing empty pages, don't use it if unsure. #(-27][:[]|#[]] - Run script starting at addr - A FIT config name or subimage name may be specified with : or # (like bootm). If the image or config name is omitted, the default is used. !R\248>Ž ; \' lA<u v < lA+ A lAHux x &c lA,c ?c l lAu u 1 lAՇ Ax @\)A$ : a lA0a /a l lA,Vu ju  @lAt0  ՘ lA,ۘ : lAAl { l lAu u @J lAĞFJ bJ c @lA@Qp lA8A ֙ æ @lASʦ m @lAEv :5 lAX9 U v @lAxI &V Bs AIs is A0%&F ?F  lA b b A @lA\6E m :e A!e ;e AhD &V $ lAeZ j ) lAe2 H  @AE ͞ : lA\ d @lAص  L AV h  lA > yL AܢL 5 lAg: N  lA|j L l @lAmϱ lAA  < lA AD v 9 @Al8 b @lAm lAv  p Az A  AP B AN c lA  " lAT( > lA\E T ( lA0 H J lAJ &V UH X  ޔt (] BJ@ @ 8} k          3@ s@ C@ S@ 5 @* u @@ E @W U @n 6@@ v@@ F@@ V@@ x@ 9@ y@ r@ I@ t@ Y@& q@n @n @ @ @ @ @ @ @ @   = & T l        " 8 M b x       $ : @P :@f *@} J@  < , L  > .1 N0PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~N()*+,-./0123456789:;<=>?&#xa #~a 1tbBVMMVBbt0Fb b b ,b ,b ,b ,b b b (P<dPd_( ((s+n a< #a<  a< B ) .,`sdIHHHHDHEHFHGHŒdFHܰŠwtFHGH ŠtDHCHŠ< II (*uI'uI$u%t,@ uI  uH (N @sIIH@ @va  bHrI b.!/%q$ @ qHIHH&:XluI  tI1$4`rI hjlnntI(uIqIqI 虁qILuI  tI ԶuHǯ蚁qI,왁qIpIHʘȘ̘ΈpI CȘ ̘ΈpI@ 3@qH@0HLNNqI LNNqIq4$@qH@HLNNqILNNqIq`34eI  tIA$40@sIIH@ @vaTdbHrI b.!/%q$ @ qHIHH 6a $3aH  aIH#HagB ĄsIqr ĄsI0P$+3:<paHp2D0 @HBBpI@ 08K aHHHH 0v< F@sH@@sII IH@ ,uI2Fq@sIO0&bI"rI%%006,u<`sI !%0w!"#$.s!%$Ig.u"&IIII <uIF&rIC"r%% 00@s@I7SH@fd'0Fc;-40++%&0"s% ,'@820$6rFw @FDwD_D '@ Tܥ/@I ӡ ӥ'1 7 ӥ'1 7"s%00drh#1@s:H@,u!%  vd@Hb!H@3ŠtI0Šss(ŠtI&Švt 7Ţs#@s3@ ŠtAHŠvbHH ŠtHH H(@s:H@,u!%  P:3ŠtI0Šss(ŠtI&Švt 7Ţs#@s3@ ŠtAHŠvbHH ŠtHH H(tvnfbIdq`b_`aYAI IYsI Ћ?HЛQK@c0H I GA@cH@g?i32(@30I*Hi30@v.@!H~trIvkI oZ P ؄Ԉ$WH3ajGWaHA $I aI8H+aH/aH)aII Ha $%8I1aI H)'#HfbIdqĄsIqr ĄsI0 Xdy8;IZ~0efaI>aI<aI cI I2qIH0HaHډJ`I1HHH0eI2H>HJ @HBBpI@ < cI 0K`aIpaHp aHԉr 0+Šw(ŠdHHHdH Šd@HAHHŤdDHd@HĀsĂ Šd@HAHBHŠl:؆ aH @aH 2468,u!%  @sH@@sII IH@N`,uI)Fq@sIO0&bI"rI%%006,u2`sI !%'wIg.u"&IIII6buIF&rIC"r%% 00@s@I7SH@fd'0Fc;-40++%&0"s% ,'@820$6rFw @FDwD_D '@ Tܥ/@I ӡ ӥ'1 7 ӥ'1 7"s%00drh#1@s:H@N3ŠtI0Šss(ŠtI&Švt 7Ţs#@s3@ ŠtAHŠvbHH ŠtHH H("@x]1`rII,br&pI/Hb$p`$`#,u!% I`uIPH` H`8҄ 3ŠtI0Šss(ŠtI&Švt 7Ţs#@s3@ ŠtAHŠvbHH ŠtHH H(" q rIIH @sH@@sII IH@`,uI)Fq@sIO0&bI"rI%%006,u2`sI !%'wIg.u"&IIIIjuIF&rIC"r%% 00@s@I7SH@fd'0Fc;-40++%&0"s% ,'@820$6rFw @FDwD_D '@P Tܥ/@I ӡ ӥ'1 7 ӥ'1 7"s%00drh#1I(*.s!%"#/#-!sIsH@" 4 vIF@s:H@6dI%uGkG`uIcG a<`uIHaN!ŠsI1H I c~FuFkFIdI ŠsH0ԬT,4)  @ @  d8| ȷ *    @  0 u P}}~L\`4|Tl\^  8 _ AH|T`\^ ̋LĔt|Tl\^ dLt|Tl\5j :j 2- 2- ;- &V ^ }  } >    / * ȴS/ дzC شj3 zC zC ^= zC zC zC zC zC zC (zC 0zC 8zC @zC HzC PH0 XzC `6 hzC pzC xzC zC zC zC _1      ȵ* е4 صT   W ` %  \  \ (! 0-s 8r @=s Hr Pr Xr `6s h( p6 xD      Ċ ъ   ȶ ж ض "V    HbPcXcx78 ط58`5L4 t9P4X h pE 5D ȸGS ظS +S    ( 0Ҕ 8 @ H P X) `< hQ pc xt      ` ` ` ` ȹJ й` ع` ` a ř Ι  ҙ I  E @ P p \ T [ zC I `,d "- 8(- P-- h2-  6- ;- * л* B * * * * 0* @* P\+ `+ p + + ^= + *+ 1+ м=+ P+ Z+ c+ n+ x+ @ Hu P X ` h p' x'+ . 9 = D K P U q ؽ+ /  8* X4 x9 > B ؾM W a 8i X݇ `s x;-   r w  3  5  ȿaR п ؿF-  ^  R l 8 > D I (M 0U 8\ @a Hg Po `Xz xz x { 0{ @P0{ `xpW{ 8{ { l} H `($HI XFI hzI x\I J @N 3 RN 1 iN 2 N 4 VpV$U S(SH< X< xA A `H  0 @ P px    5 G Y k ~     IL QL (ZL 8nL HL XL xBX@A@TA>Cm 0Bm H[ `Fm x7m >m /m Om 3m Hm .  83i P h~R R  /m [ 3m Fm 7m ;m >m Bm (Em 8Hm HLm XOm hSm x&V               7       ( 0, 8 @ H! P+ X5 `= hH pP x   h   leDeepd(m0h` pZ c s ~     Y| { { { 0| @!| P=| `Y| pd| ,} D~ `~ |~ ~ ~ ~ ~ Y| ~  0 } @! P* `6 pD ~ ~ ~ +~ | Y|  } Y| } } ,} 0} @W} P} `} p} | |  } Y| } !} ,} <} W} g} } 0} @| P| `| p| !| =| | Y| 4|XYWD D D D D D E E @H@P(X`S Z a h o v } @ `       @ `       @ ` * 4 ? J U ^ @j `s z      @ `   &M %K &M %K n n  E (E 0 E 8%E @*E H/E P5E X;E `BE hIE pPE xUE `E kE wE ~E E E E E ءȠ@w* P$ ` p1  љ   3       0 @= H4 X&4 `,4 p x24 <4 64 @4 E4 J4 O4 T4 _4 j4 o4 t4 {4 4 4 04 84 H4 P4 `4 h4 x 4 4 4 4 4 4 4 4 4 4 5  5 5 5 ($5 8,5 @25 P4 X4 h>5 p:5 E5 L5 S5 Y5 &V &V ;- b- "- o- (- - -- - (2- 0- @ H- X6- `- p&V x&V = S3 ^3 s3 * 3 3 % 3 3 3 *& 3 $ 0o1 83 HD- P3 `3 h3 x3 && 3 3 3 4 T 4 &V &V ;- @- D- K- C (X- 8&V @&V P- X- hU p- j3 4 - . . . * 1. >. L. k. t. . . (. 0. @. H. X= `. p. x. / / 1/ :/ S/ [/ rU i/ p/ }/ / / / / 0/ 8/ H0 P 0 `$0 h/0 xD0 N0 \0 i0 |0 0 0 0 0 0 0 0 0 0 1 (1 861 @@1 P_1 Xd1 ho1 ps1 1 1 1 1 1 1 2 #2 C2 I2 [2 f2 2 2 (2 02 @2 H2 X2 `2 p 3 x3 "3 /3 &V &V    pX /X 0GX @ A P lAX (` t h *t x  lA  M &V gN A  pN N F- lA  FI  &V @I 0 lA8 @ FI H &V X T h Ap x T T O lA P O 5 $ lA  hI   Κ  lA A Ԛ (  8 T H AP $X T ` T p  A    ?P lA ԩ FP UP t lA  t  u  Q ( lA0 P8 Q @ &V P  ` lAh ,p %u x 1u l lA p t t P lA ȫ P Q   lA ,A   0  @ ЮH AP   \' lA( <0 u 8 v H < X lA` h + p A  lA H ux x &c lA  ,c ?c l lA  u  u ( 1 8 lA@ H Շ P  `  p Ax x    \) A $ :  a lA 0 a /a  l  lA ,( Vu 0 ju @  P lAX t0`  h  x ՘ lA , ۘ  : lA A l { l lA  u  u @J 0 lA8 Ğ@ FJ H bJ X c h lAp @Qx p   lA 8A  ֙ æ lA S ʦ  m  lA E v (  0 :8 5 H lAP XX 9 ` U p v lA x I &V Bs A  Is is  A 0% &F  ?F   ( lA0  8 b @ b P A ` lAh \6p E x m : e A  !e ;e  A hD  &V $  lA e Z j 0 ) @ lAH eP 2 X H h  x A E  ͞ :  lA \  d  lA ص    L A( 0 V 8 h H  X lA` h  p > yL A ܢ L  5 lA g : N  lA |j   L ( l 8 lA@ mH ϱ P  `  p lAx A   < lA  A D v 9 A l 8 b    lA m(  @  P lAX v`  h  x p A  z   A     A  P   B 0 A8 @ N H c X  h lAp x   " lA T ( >  lA \ E T (  lA  0 ( H 8 J H lAP X J ` &V p  H  X   P `  # ] $ } H$  x$  $  $  %  8%  h%  %  %  % * (& @ X& W & n &  &  '  H'  x'  '  '  (  8(  h(  ( & ( n ( n ()  X)  )  )  )  *  H*  x*  *  *  +  8+  h+  + = + & + T (, l X,  ,  ,  ,  -  H-  x-  - " - 8 . M 8. b h. x .  .  .  (/  X/  /  /  / $ 0 : H0 P x0 f 0 } 0  1  81  h1  1  1  1  (2 1 Ha xa pa ~a a b a b a b a b a b b b (b b @b b Xb b c B 8c @c c c .x Ԭx x x y Ty (y ,0y 4xy dy 8y |y y  y ȷ(z @z  Pz uXz  `z P}hz }pz ~xz Lz \z `z z z 4z |z Tz lz \z ^ z z  z 8z {  { _{  A{  { H({ 0{ 8{ |@{ TH{ `P{ \`{ ^ p{ ̋x{ { { { { L{ Ĕ{ t{ { |{ T{ l{ \{ ^ | | | | d | (| L0| 8| t@| X| |`| Th| lp| \| 5j | :j | | 2- } 2- } 0} ;- 8} &V H} ^ X} `} } } E81(1Rmikrotik,rb5009marvell,armada7040marvell,armada-ap806-quadmarvell,armada-ap806 &MikroTik RB5009aliases",/ap806/config-space/serial@512000"4/ap806/config-space/serial@512100psci arm,psci-0.2(cp0-sdhi-pins-089:;<=(cp0-spi-pins-0 (cp0-nand-pins4(cp0-smi-pins#$(cp0-spi-pins-1/012(gpio@440100marvell,orion-gpioJD@9 @Pgpio@440140marvell,orion-gpioJD@@94@Penable-usb-power:enable USB powerenable-leds-power:enable LED-s powersata@540000marvell,armada-8k-ahciJT ? g ndisabledusb3@500000$marvell,armada-8k-xhcigeneric-xhciJP@ > g ndisabledusb3@510000$marvell,armada-8k-xhcigeneric-xhciJQ@ = gnokayspi@700600marvell,armada-380-spiJpP \ g ndisabledspi@700680marvell,armada-380-spiJpP \ g ndisabledi2c@701000marvell,mv78230-i2cJp   V gnokayudefaulti2c@701100marvell,mv78230-i2cJp   W g ndisabledi2c@211000marvell,mv78230-i2cJ!   ndisabledcomphy@441000*marvell,mvebu-comphymarvell,comphy-cp110JDphy0phy1phy2phy3 phy4phy5utmi@580000marvell,mvebu-utmiJX  utmi@58000cmarvell,mvebu-utmi-2.6.0JX D D@ ndisabledutmi@58100cmarvell,mvebu-utmi-2.6.0JX D DDnokaysdhci@780000marvell,armada-8k-sdhciJx E ndisablednand@720000Dmarvell,armada-8k-nand-controllermarvell,armada370-nand-controllerJrT  g 1nokayudefaultpartitionsfixed-partitions partition@0YAFFSJpartition@800000ubiJ?ethernet@0marvell,armada-7k-pp22J$g Kpp_clkgop_clkmg_clknokayeth0 %W_nokay k10gbase-reth1 &W_ ndisabledeth2 'W_ ndisabledpcie0@600000#marvell,armada8k-pciesnps,dw-pcie J` tctrlconfig f7pci~C$   g  ndisabledpcie1@620000#marvell,armada8k-pciesnps,dw-pcie Jb tctrlconfig f7pci~C$" " g  ndisabledpcie2@640000#marvell,armada8k-pciesnps,dw-pcie Jd tctrlconfig f7pci~C$! ! g  ndisabledchosenserial0:115200n8memory@000000007memoryJ@leds gpio-ledsuser green:user :onsfp green:sfp :hdr1 blue:hdr1 :hdr2 blue:hdr2 :keys gpio-keysresetreset : compatible#address-cells#size-cellsmodelserial0serial1methodrangesregno-mapinterrupt-parent#interrupt-cellsinterrupt-controllerinterruptsphandlemsi-controllerarm,msi-base-spiarm,msi-num-spismarvell,odmi-framesmarvell,spi-basebank-namepin-countmax-funcpin-funcmarvell,pinsmarvell,functionngpiosgpio-controller#gpio-cellscell-indexclocksstatuspinctrl-namespinctrl-0spi-max-frequencylabeltimeout-msreg-shiftreg-io-widthclock-frequencydma-coherent#clock-cellsclock-output-namessar-driversar-namegainoffsetdivisorbootph-alldevice_typeenable-methoddevice-namecore-clock-output-namesgate-clock-output-namesgpiobasegpio-hogoutput-highline-namemux-bitcountmax-lanesphy-typephy-speedutmi-portmarvell,nand-enable-arbiternum-csnand-ecc-strengthnand-ecc-step-sizemarvell,system-controllerclock-namesport-idgop-port-idphy-modereg-namesbus-rangeinterrupt-map-maskinterrupt-mapnum-lanesstdout-pathdefault-statelinux,code  B0_binary_u_boot_bin_size_binary_u_boot_bin_end_binary_u_boot_bin_start.symtab.strtab.shstrtab.data   0 Iy !