@ ttp@@@@@@@@ᆳ1)  ,U/   000@00 00000P!:0@" Р pG8F F^0?"3@SB#@BؿO)F F8@>?DpGpF FA0o)F F;8"#F6@BؿO)F Fp@6?DП P-O TР Р 440 SPР </$  !F=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡ pGHsLP0J  C?@ pG-MC#FF  p /x8 s36` 44t4'`p M(@/i(@/c(@/иpF F&Bp6ѾK\i!!1@ OB8RK!`d":`h-NM$t(@/$(GM(@/VOABJDdDQ`D(@/ (@/(@/(@/(@/(@/(@/(@/(@/(@/p /DA J`Rj 8(@/(@/(@/(@/(@/(@/p /?}DtD KXjpG *L @/~(&Hw @/q @/k @/e @/_ @/Y @/S @/M @/G @/A @/;p /н@ m-Ki_@tKh_;+       `8(4     #rO#r pGO`pG8(Ha /_Ow30I `_K`_-J`_S`_# d_Kd_d_d_ e_d_Sd_d_d_eL @/ѿ_Ow2K`_Z`_"d_Zd_d_d_e @/ @/yp /'8g"L @/` @/M_#J_OrOL @/ ѿ_#+8C @/M; @/5 @// @/)p /@ (Jh_#_`pG KZl_LlXh_pG &K_7`_O Zh_Ca+*f#O$Ȳ"c+j+* h#i#<4@0c+*j#e+ Hi_@k#"`#c+j+(  JF_;1(o'`}# `pG(o'`i#(o"`_#pNuh_L @/@ـ%5_Ku`P!_տ_"T!hL @/@怕K4_ p_JT1SL @/#L @/F @/ {KB~IJi_K"R ;B#_Ka( @ ` ` / (𣀿_KqK"iL @/@lJh_C_`aL @/@]JiC@aYL @/VJSjC@Sb @/@_O;TJ&_"$_ %_Or&_'_'_(_"&_'_'_( p @/? @/? @/? @/? @/?%@5z @/ "Ji_#SCc_aWf @/bW^ @/?bW @/?[P @/?TI @/RKA @/`@  {# pG%,L @/? @/9 @/3 @/- @/'Ki_AS+B#*&+*+K*#ѿ_O1J_1__1O# K*O#++O#C@  8!L @/ѿ_KLM#a(@/)(@/#п_O! @/ @/ @/ @/ @/8_Ka_awwKh\i(!1 p$K$MhBi#Jd4TC^jX(@/)R(@/#L(@/F(@/@(@/:(@/ 4(@/.(@/K@F? F1p  =6n(s FM+N0@/0@/+hC!k[I3KC!11?!$@@hF@.p+hC i[ 6n(KFh'Oi]j8@/. 8@/8@/ @ ` ` /..E$ ...%4E4d! xi(U$! Kh0 C0pG# )pFop"KI1@h oC g #UM(@/N(@/NO@q3h3ẖ C`>(@/8(@/2(@/3hO@ql3" KhZitdi@_1)H aCi@K0XCi@(((Ck@!!F ! @ 6n Kh[iZD G! ! aj \F-A(#'+/mq'/KhiChKXC1@8AsAIAKLhi @/j+՗H} @/w @/q @/k @/e @/_ @/Y @/?1A{N|L3hkE @E/{,)FsH6 @/0 @/* @/$ @/ @/ @/ @/3h]HCi[3XCdATKhiAq)T))aOCiKK@0XC! EL0i^i @/dI#(FɲF((FyCF:FIHLUп_"khTd (FV(ljhIH0oj Kn-AFe?8FEE$8F F8FF(0%L@j@0ٿ87#%@jLF@08-M$$KNF dh FF"Cm@ 0۲_C_ 0 FYAɲEF0 F`(F# fh CRqh@C\F۲_#/C۲_CT_ @C#CT  R\_F;GE F*%@! F FE F_"p Ҳ_  E2xҲ_B_2p88( FF# J"Sa!" K3a!F ( K)F08@88#@j]h[h[hGFpG7F))" o Fia 0$&1[hP1hFoO0h[hhGFOzp|" F FO`m F#0#FYhkh K@ @BCCC" Fc #p0#F F&l0" F>p+`p)F(ѢABAAr@d)sL!!&CBB@r"(FFH>Fp!OtFiF(FF8Rod 0FBomoL!Z#0#F ] -MFFFF@h?F`(Fz(*iB-H&0F Fo(ѣhZhi-52FAF FGFFE]F(UF-4""i o)## FF- !! F@ H9F*FBo /DѪ"#0##Or# ]0Jh}B }0 ?$?!FPQ(ѕ 0BoI 0Bѕ 0Bѕ 0B"t(@p)F F}!+ #"!0FF%- ?%?)F0Fp K*F F }p#oFhrJ?C|BF}ƀ ?%?)F`F(@P@Op}P(Or)F 0+]JR#]K`B@0RBR^#C3BOPpSK("bB0r00pZ*#s0n0 q 7 o [0#00[0#F02x<"<D*Ao02 #CR3#0EAЕ0ѹ#"F FEF#0iso [CSR"#0ԕ0p0&0F }P( #P1o o?@@-EFF'_ q0"#!(FC F(? N1F(FF(F| FF(ڣh[hh F@G Bh\iiB(!FB8FAbwμpG-EEiFF-@#d1# F#webh[h[i+vO`oh F[hhGF(@oLcg#\#b F*F)F F FF(k F#r0h FhJK@+ #Os#*F(0+BK`@8?N7#"0# F(>)#0#hhhREOCC F0+۸JOzp FG(ck#xscccsa#Jhl0B2`%(F n) FW F)! FfFk+ 0Fxzd 5#H1omHo^FhFhCSCCcHh[hh+! F @#Hcaoz#I1-MGiF'%(F`8F(I1+^%H1IQ+^#",0# 1F Fs``F(@>"\#3l0*F`#1F Fs`F(@'h"+1Fl0 #3#s`l0 F`F(@ihehpiOdP`e?b:*8 FhF(ЎkHQ+ F(FF! FF(@ۀk+ 0Fz6d sOBa#`l0tJ`I\IQ#0OSC"igcg1C\L!d@-O C|CCuF 3  #E CXCO O 5Or(D"0$&(*,.gakZ "2"1F F`r`#O3l0"1F F`F(J# Fq0F(A F(z FF(@hrI*Ł7#H0l0F!c F1F`F3#3##O *? `00BF1F FF #caVJ8VJ6VJ4VJ2@sCs0O0bd+ `+`KHOKKFP`H#khDCS#cFKdB.O ? (?#d0#@# # Fl`S`IF(0պ 0B#kC#cORO^#kbk*M@#xs"+hB %K5B$H$M$KKO khV+@ кOк_6к_€"o F\!agL! +O @| \@@@@L\$ O7#1#l FB@"AF(!# H A FOH@BF(Ѻ_## F#bdhKB\+h\1+@o"9F FggL1s\1`1L1Osg F#CsoF13!;#A19!!9!?Ba4""a o@+@ @@+a#+wE0Z0#caDOo+h#+6O#0#!KH"@#`# ?*? F`S` (0CE?y +qJR#pKBKAu#s!cmIP1Bu jHjN&c0T1gJ FF&cHFckH&c" Fo@O ]O]KB)F\HW< 3B`< E7W<, C B=W H#i` "jCcbj[b # p4F)!h {FH!OptF0 Fo 0F>h &`;z#c{hc`hcd;idjCsb"Fj*0CC0l+0C0;Ksc2lcHC#7IHC@)`5Ii`O@ B`3HO6 8Fd(.Hom(FX FUOC`!kQ)OS`!k)#S`DC`"mCK`+abhKBjakaOsa#3fl((+0m#Cbm##CCCsC0!F(F(&`ciofoc;zlZ !F4 #`0FC` F@-0@HKh(d 0Cs0@iG@iG@iG@jGFCj F@GFj F@G8FF<8kjGK _h_pGK_@pG (F _Kd _R KFO2 h_@# L0_#I0b__D'0_#0_"K _ _տ_@r _ _OB _+" _$@_@> FHpG-EhFj F "G7FWO < B$;#h h`hxe+уx-+.jy+yC# SиK`hx0; +Z!0XxC۲p#@+@#+q#kq3hj+*F!F0FG( F-!رиxs+<0 *ٕ *n+ѶCxb+s+PFPDt+1@*!B2Y_*хKh2*`?xCh "P? ; BK`pG`h ;h -AFFoFU FE FBFDDFFoI p"bpp pGh/{hxh(:~((~ !RF(F"yhB x[#P@ pcp;xB76(шIx/c? C; F<2(Hx/?Cx/? C QoґH0hFi,%TBTA ST/) : B0%$15j0 :pF&hj@ B @xxR" [ِp ph3FS(/@ @B6j >@ 0(0@B(:F$0վ#O 0" oXF0`Khhȹ#FSTO < B?`h"FR(?@;@3B$j[F2FQF(ݷ[F2FQF(ݯXhl[F2FQF(ݡ0+@9ch"h #O p2q3ppppchOh!O 1qO OZrrr#h[i+4xN.ch3y  D3q p#p # 0#0  #hhiG00000 0xxB":Os0+@h# FJ#FSTo > Bod!*1~B6j+ hhSx+ ѓxC#lCd\/*уjG Fd!0iPFG*_1)@~ I!+5h*h /:F("+'h+a._Xk(ZЃj +V1FGF+h+M.KXk(Fj"1FG!+hph*9+(+ Si{F)p F%3CT(@8@BЅHPB l@800+@k(Ck+MGo^"F`0 [(?x0+>i NpjF F+: k+7Haj@(bdJd` jKG(cl"lS``##dcdca10ԢhC1010hC1010Z"iC10pFoF0(QcBo0 pG-A F ~F)Eh+BFRT? ; B''am e("bab ` Fh(,0pGcj"jS``'bgba+h[i+ (h,b0F~Bj!j@;@Ei *hQal@;ooF`0+3ز`opGChisL#h[h K` `HQ##`op Fh(o(F.M.N(ps F(m(rsh0F+'H8 F((t0tt!@ F( F~o t"!K)F+`@#+#vK F`=F(#hHjv(@! oI 8F3s#ss;h[i+!8FGm ܐ"KppGl K`FbF FIHu FL PpG8 j-)F8@H_Liam) ) )єl0 #o #ce8mcn+#HEee 8 F j!H8@5hx*FH\i]jbn=BQbmaf*h*Fm1)m+Decn#ce8Ham))#H  4 : -ACi xiyuy`F&%Kx+ L.4F(L$I"F(h#0Bl`$${"dAsxh)FhiG(#+b ,Kx +ыx++ $" K$+aKh "K4F+aKhZe)t mp j$!FSHphx-)FPH@ &KiBxxB"QBhбB @FB9@VBX@BCH@ 6Bh@ @B?JlPgH"l@gZeyxB"AyBByBbeDzzA!zzAAAa e/HYfpLO2g"lPZeyxB"AyBByBbeEzzA!zzAAAa HYffelPg"ZeJlPg"ZeAzzB"zBBzBbZfel@gyxB"AyBByBbf"Ze "eppG  M p phFh!FGFXF`1F@ `(h!F(FhG$ Fp8Fi(-JMòp(hJr(!@ (`!"w)hK F `K`K`K bKKbKbKbK cKK`KKc8@ռo 8t 4E1Foh[hGh[hGoKh4oohhG#g0ch'hhG#0L h##`t -Ei F( KOp9F@FFo4@FQF(кx KpK gpsh \a~u-ACiFF oih*h<#IGF!IhhGCuA!oF0Bh)FhK3agtaOaF0Bh!hK3a`tao0#ce#Pp0(FIGFIhh~u8F H M+h0  H 8 F t  FgHfLgN(@(F~!hohKm;+J7h#";iF!#hoQ`oohi"G#!hKe0+Jm*w0NHahiG0#hIH0YhN"#hZe"p1+PA!#hoQ`oohi"G #!h#;Onm@/@':F8A!#hoQ`ZnoZfmo:Dehi"G#!hn,H#hn;x+)H )K#hnٱ'H#h$"n!!FyhH{hG#!he gH*T0Ja"hiG0#h H0Yh"#hHo t VxxV  3 t 9 L m F XcbpG8j(;BыBo B jj(l`%`bbjs2 8jogbi+ИGJm JPm Ck F;xJlId k F@ CkCx Kl FO4D! ((bb,Kd -MMIlFh#00CkmxjZ JmD!U$<F``aO@F(O@A*a!R R @RA D@!F@"!i1a*ړF1fi< K[m"0FZ`#00 FCC08h5h- F%+4@_g(F@6h pCkFx F0 ѕ003$I%HoFp#Bccahk?1!?Dj((bbb`00 k0bkB ##cah@ ?1!?ac* co ckcc3T(F pNlh@_DHP#3mBRZP_@pD F Fx\c b"ydyB"@*L$i,@"B  -ELlho__gn__f_O3&'FOO kg0cx:m 3 H6.8п_" E# pG-MMlhfh__@GBf`|wpWԱro_Hn_@Pl@Fh.l"(_" 0H#p&f)MCp FD0jj(J``@!"bb 0 [B5гO+l+@_O0Pcl_@co##@"+aOr#8 Qpp3Bȿp +ъ F"0& C+$aJs`px `Eѱ 8"Sp "hhhi1FG3+8o_+п_(g#0+# O@@BphmOvGX7K7JO *8F@i[E~#S``#$`d` 0BmT$D?1T(l!?PFQDVET,!iT( D0㱤(1FT<GD0JDpx1F;#pD$|`0:FiG8;q.   "0[Cs_{ar`hhhiA#!s`3hpZpiHG(:@0F{shBDڲ2h9F H"i;[E 3F3h0FF  W  Klh\h_ H F p Llh_OCOHp+`l# Fp@[iGp 8 Mlh_K #`vl+m_a_#f_O3cg#hC#C#` 8 -MF(؀h+Ԁi+ЀCi+̀! fJFȹO@qOPmbL epO@r)FMO@q@ ``e8 mGo (FO O@r)F7TJ-̿OVFO m P 5Fm(F(F .5FCJO( BN("P(FAI``X?Ke`0x00\cff7KO 1("(F=(bb0h   `*K`*a`8(M("'H!h`H1$I`QdQhDa`(" 811h1`|aAF`p#l`mYphGF(WdToQX @ lD(`pGhn_#C_fpGCh[h_Bh1 pGLP0A-AFFFF4h_ 5c<@DE=O0 -MOuFFECO!|p"6K 01KD41KQF81K@F<1+;D[FF(@ch+h+܀Ҁh_#C_h!`FpKh0[FQF@F(@chh_տ_ha@;D`"!FO C"dO0Bbd@"Fe=_Oz! z 5=Da(F`"$(F4! 1COQF (uOz# zE !P3_ Q !_0Za0Yh_2KpxyB"Bp qxyB"Bp qOuuhh_#C_h`hl_C_hdhh_A0*khh_HB #``HzO60FFo  ga9 % KS 0k_`pGP pG(-MFFFF Ozp(FF0 8Fjp /-O-bKbJcI_O`_O1`_OAR`sChlBr`htB`h-"rD`bPKS%`_OCc@1 #@18@_f-BsBB v?K?J@Iq!(FFEL.1C1_OS11BpC1Q}oz2k BB2cE2k "@B2c>_3`3kC@C3c(FEFл r 1_R0FE.oF@1C@1@1_BsB $ (  P   KIFH[DB pGAhB0pFh F0Ci;)F Fp@Go%pF Q/b:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/Q ; aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P-PA/P-PA/-PbP _PĀ=PN;PBjdjejdjdkdBkdididBididЂkPTsXtT6L6P@6\CtmPPsHs@r?   resetting ... spl: ERROR: unsupported device Unsupported MXC CLK: %d MMC_CDSD_CDMMC boot device not availableCommercial temperature grade DDR3 timings. Industrial temperature grade DDR3 timings. error %d from write level calibration error %d from dqs calibration serial_mxcmmcsdHDMIwvga-rgbwsvga-lvdsSPL: failed to boot from all boot devices Trying to boot from %s SPL: Unsupported Boot Device! U-Boot SPL 2022.01-OpenWrt-r32912-6639b15f62 (May 04 2026 - 22:30:45 +0000) spl: unsupported mmc boot device. spl: could not initialize mmc. error: %d spl: could not find mmc device %d. error: %d spl: mmc init failed with error: %d spl: mmc partition switch failed mmc_load_image_raw_sector: mmc block read error spl: mmc: wrong boot mode MMC2_2MMC2MMC1usb_dnl_sdpSDP dnl register failed: %d SDP init failed: %d USB SDPalloc space exhausted ### ERROR ### Please RESET the board ### %s:%u: %s: Assertion `%s' failed.FATFAT32DOSEFI%s: Arbitration lost sr=%x cr=%x state=%x %s: failed sr=%x cr=%x state=%x %s:trigger stop failed %s: failed for chip 0x%x retry=%d %s: give up i2c_regs=0x%lx mxc2mxc1mxc0MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Card did not respond to voltage select! : %d MMC: no card present unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d MMC Device %d not found The SD card is locked. Can not write to a locked card. CMD11 to switch to 1.8V mode failed, card requires power cycle. Timeout waiting for DAT0 to go high! MMC/SD: Reset never completed. FSL_SDHCvoltage not supported by controller Cannot find console ?!cdev->configcompositeusb_dnloadci_udc%s: failed!, error: %d Status: %d Wrong State: %d Unexpected report %d done Invalid state: %d Reading %d registers at 0x%08x... Downloading file of size %d to 0x%08x... Unknown command: %04x SDP: initialize... CTRL+C - Operation aborted. SDP: handle requests... Jumping to header at 0x%08x Header Tag is not an IMX image Jumping to 0x%08x Error in search header, failed to jump Found header at 0x%08x error in submission: %s %s: ep0 transaction already in progress inoutEP%d/%s FAIL info=%x pg0=%x ep0ep1in-bulkep2out-bulkep3in-intep-EHCI fail to reset USB EHCI %x.%02x (((((AAAAAABBBBBBi2c_imx_stopwait_for_sr_statei2c_init_transfer #(-27<6@HHF<>F>@PHFL8J    HHH00$000 0000000000H0L0000(0 00000l0x000|0000000PtX 3333 3333$3333(3333H3333 H3333$H3333(H3333@6 TyZUd2,&0#ZPPU vU@'231B00@9H9 XH<8*C@$&jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-IBI SYSTZHh" Das U-BootRUNTSERVZPQȃ=ȃȃ%̓΃̓ǃ !΃#??OopG@@7#???Oo8F F0?"3@SB#@BؿO)F F8@>?D#???OopF F0o)F F8"#F6@BؿO)F Fp@κ6?D_00;0 0Q@o0  CA_oveb^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovebVY@T S@No/N-N/pGFT w. & /ПM P-JxР+AР+AGGLРT P<E,,0 SGG </@0 _/_ РP/< /0Od@P TP  Q:< 80QR:/xT# lRl#iF#]pGs0Fk`H F,>H!HY("HHKIt,FHHO@WO`S0;  FGp0k#pGF H,03 F HGRH F@$pFF(F0Fpo!F(F(FO6F`I>Z(^HP@KS0G%@$0C#&@CC'@CcLBLBH* )@(0C#*@CC+@Cc `-@,0C#.@CC/@Cc` hFHH (oboxu K1_? ""#@;_`h_@ѿ_K0'pG H߿|'Hٿ'K Bӿ_"0'pG_ 0 8F FFIHH4$*F I HH% KBؿ_"0'8_pG 4 F=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡ0Hk H HH HL@ORHG%.5?L H L :L pGOCiF8 FH:H0J3 `pG@pG pGHGA]-AF"KI5kkIH%lGg pF PkP kYAHGVj"kak?HGP#jbjj=HGJ#iHGk F;c kF4*HGuk F;ckF4HGak F;ckF4HGMk F;ckF4HG9k F;ckH*LP0F& DH@ FFHG  OB < R< < o< < pG0AQA@aC pGR"rP OFF@ B ?1!? ?AF@fL%`5 0 l Sll SB!0?CS?opG??#S?opG0pG# F!0_ #P?0o CY?OU3??C?o?C?o?[ Oa$OopGF FFZ-MC#FF  Bp /x8 s36` 44t4'` M(@/(@/(@/иpF F&Bp6Kh2Jh_`_`hpGK (P(wHpGwHpGQ8>(S %!W)!WWWWWWWWWWWW !!! !! !!  !!!WWWWW  WWWWWWWWWWWWWWW         1!i    4HpGos+?op(S   [  -!&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpG&HpGuh!G(4S_o  $)-16;>;0F0FEHGDLF }AH Gq@HpN(F((D:H eB `Q 3HGQ2HO1HGHjF!g @&*HG9*H8P (/(.(-$I%K(F$HG$ 0"H"H(I K(F@(IK(FIK?FIIIIIIC2P]ĵNe )Jt`R[zlK\iG!1J @  L @/ @/ @$  LF Kh_i_ LQa\c 3DCrD@H\ DD + Op@@#OB8RK!`d":`huNM$t(@/l(gGM(@/VOABJDdDQ`DW(@/Q(@/K(@/E(@/?(@/9(@/3(@/-(@/'(@/!(@/p /DA J`Rj 8 (@/(@/(@/(@/(@/(@/p /?}DtD KXjpG *L @/(&H @/ @/ @/ @/ @/ @/ @/ @/ @/ @/p /н@ k-Ky_pG0-E8H+8NFFܠx$0'FB%(FFP4F0'FB0+=@FG(9P'H)FG'5'i$H)FG 0!O H4(۝04,$H,#H8#l!0# (HHH#f!0# (?a i     * Q     : h        -A$-H(*H~)H{%@!'H!F$ "!FF ! HDcLF'FOzx#x++%ùcax0# h qxHDD`D6w. H8(Fa$ " : PȄi K\ -AF FFP#Ho" F*F8Ho F(Fz+"!F Hoso HB DD@GFF(F_3F"AF(o3F"AF   s$yF0y@0C(HDO0p+yN0;3ky!F0;sD,!F(F,qD&!FD K` F -MOq@ wF86HDo 0FOr!!(FXFH+h-Jo B,Kop(F"p#OxFFD BEК0@+Ѣ*0к0 C FKڈB*"ڀT")XF0 B"0BB A CCc J `)H. @Ϧ-M(FFm݋hx-*^xyNBNAOq@ FPHD$ F m&Or!\TKx+=.@UhFIDhF (IKxY+@B,:#IhF0DhFFH@)FFHCбYFHC|p@0_'#!#,.,h(@SY,L @/ ###0( @/##YFHCH(O8@/Y,1#/#v8@/WѸ0+.@󷀚00;000;00A;0.@!eHDkK`#kL&cp-#pgK&phA""q" Cp cqaKXI+`aKk`D"!F+a1F"!(F(1FTHDa8@/8@/ 8@ /HK8@BFK8@BY,=#?#XYFAHCY,@0ѳ_##G_##AYF6HC(|YF4HC0Y, # #/YF/HC(PY, # #!*HD$(F'IhFD{hFF<#IhFDrhFFEhHD$,?论 #9#. R o    @@XpP     ;;#8#A#"#*8FFO08 IXhC (!F(F8@# I`hC((FHD! JPS۲C 0CpGu"L "HD#!J!hp#Sp-#p @Cp! qSq2H)IH) "hLIHD#yIA3c"HD IH I KQ  J HDA KۈCr r pGKFhSHC0! FKJ:qKڈIDb#!J F:a HCs0! F K J:V IW\o-EFF6MFF*F#9F0F0.HD0۱BBB BA!F$HD, BBK:F;1F#PFHBB0DBB!FHC#9F0F#J( HDBҺ\5ZF'> F-MtF0C 0Or!H5H)NF#F)FBZ#0@Q  Bȿ O NFF((izHh7)FyHD*hxKBwH}OpM0+nsHsOk(FnH(F kH_(FiHDVhHTi)fHDL-Ы+ ++@0h0+ZK!(F`@")FXFC#K\sdSHhd#)F0F ,( d3e ped@F((1AH000000 0@D000000++n0J! (l0j+HXiml(HOiml$HFiml!H=imlH4l-iml(H%X%_'VH@L hkl+hЫi00+ 0 D0|xՙJ)D@Ւ0++ #RF (ǮvWo` 0 Os0k1F0FZF@F (3 @F K F&  o@F+mCoJiml-(mHmH} kHDkHD-cgHD?1&?!?0  ѳEI BF BCcl+<Д"0+XH RLF(MH(KH("ԔwFxop _ F@HD?HRB40F'0FF(hx"9,3{;#FObQFF ?M?KSF O8A#FRF@ GF(H;5#FRF GF(#FRFOpGF(OL5VzanypGoFO,@78 AHC  A H HC#08 F-AFFF&B۽U FBO(hB6Do ZlB@H!FCG  Uo FFF#[lH(P!D -F #:F)F@ H!FCxG H(F(0FB o-E FFFD[l "0+%O --&FW(BB0EED0Fc #:F)FFq@H!FC13FQFJGjF!PF+H(K(FF #p H FFF(oP IB0H(C p1F(F0G$-MFJHFF(LFhFO 0FBBغ!@HC#FZF(FMJF=) Z,f*!@FC<J GF0HC ocl+=0)8(FI(FFH )FJ:3H(F`Bt#D+F0FJI (9IFHCe F  HCY F HU-DjiqFFFF>+F1F:F FG0+дpO0 KS pG˄hx *pG3`hFBhHC -AF xF/+ FF}{ñ#0(FBFBD*FHCo# }Or!iB)FB HCBF IC+F FfhG( +h;`sFF FF(h!C8( 3F)F FpooF@h h i`iii j`j F@-E# FFhK`xF )F )#) F+R *#k`44` ) #*0,IF+"\ *ѧo(`X#E(h3#0#(o o$)FHCoDFHD0 F0 0 I00C` oIim-M& F K"1FFD"1F% FF#b#k ckBۙH(#F`iP aObH a @(FB9"F(F? h+ahHC- i+ f3F@FJf(ahHH(0hC>FB"B{IB "B#@FvJhB(ahtHjrH([FqH(WFpH(SFoH(O;F2FmI%Cj jIBq!)(#t0jfi.QaO!Ob67.0F8FBF%BDB6Doai)F8FBF%BFBObF!F*FKHCe!Ob6B1%6B96B5Ob a6 a/H y=H aCt0H(#i ˱BgF iBcD60F1HC].#i1F/J C" -H(`H@ր#j+N` c`+6%`h+1h+5% F#F*F)*!y18AKSc#l~ׅH(]F(P}H(WF|H(SF-CzO{JE j B&j (A1 tKuI/(F 0F BF BD(FB 8FB F6PFDB F B ^DDD0F F`HCt[O=FZJFF`WFXK  1F#jSJCU]F#YFQJ@FF(F. #i3ahJHCs%dj,?(DH'!CF8QF(@H'?HCX)FCF#x +/ F:IBFX jRF!FFB# 0(FB5X#)F@F+Jx()F+HC,(F F&IBF(4%FOQ8F XF8)FHYF8F ()FH%H'l`(?ͮK`P ` y# / !_ z   F(" U-E FF FFF(( RF!hHCo F2FQF(FQFHC;F2F1F(F(E  -MFF+@6!HCxo F'/aBi:FF  +++)F_ "3"+FRD(F*2FHC> VF7@ XF(f@"!!+( 2FHC F~oi8acc`"  +R#dcfcf=ecfcfcfeee fMfcfcfcf#f1f?fcf]f" V + +khc`hBh`8o N2FSHC (OIhBnF(B0 a(1FB8#3pF@I`iBN !0FBs1FBFaBi/cUi+^mFi+S#j+L cj+E$#4#ci(" +QR#efg%g dgwddgggggf[dfgggf !@!Dž[! F&hhqn`,ڄA3"+FRD*"FH $mc!F}H FFAF FA8D"F I HBo# }IB2F(F!!!pF%Fh"`hUhB Fp@880F6hsF FF"! caa#2F1F#F(F( F$ Fp-M FhFQ>M#*hfGr(hFOh8I 3!6KCF"i hF(V'F"WE+Ѹ AF(F(0/ah&HB=(FF(F30FdiB.T <#0F8$h8 SIXFBZFYF(FS((FMah!Z4 AFFMgfffZ!9߅-AFFFF!"[0g``#s(FA(FA a=# "iTH/!(FA(C3oo #i%pFFF HB p#a!F(F# F !FF@"hFA& @"iFchXBXAFh@O3 @iXBXA< S/pG0FFFB"@T!0;`<<5B0D0`W?3#D 8`h+ pGB 0 FFh FFIH"FIH"FIH޿"<-M F9`زF F,FuKIHBFBB #D;` FHB-)FHBo% EO3YF@F:ZFQF@F ?&(o"""""FIH"@F  "5I6HB3I5HB wF`}FF;F2F)F+HB&I*HBh"i"I&HBbiI$HB*% FIFHBs%B)F F*FIHBc+% IHBW5 +!ihH R@9@BF3#'#8#G#X#n#####8FF#h+O0`h()FA h8 4FIH^)FIHݿ8FIHӿ(<FIHɿ#@F2BqK` MH'L @!B`OPl+8H'< "!B84P@@8 ,DBH8@'( "!BF`v+l+H'@ӿ"!B+BA4pGs N FFF1hX1h+F F-F FB FpM#iF3]KhB7Y@ @ 'Vl8 pG-EF#(vF;`3` MhE(FhIA#lcl+Д"0+!h`HB8! h%l # #m[LQF(F XQF(F F(FB ($(o-:!(FA(!0B BKl@I F (Al j :HB 9K*hB8Ho[(F@>3H(F\1H(FF.H.H++ kE+Ѹѫ+@FF%HB-@h*:`D3`x## F ( fe eHo +M)&+'V++-EF(HFFF'@!BF#+`;`"Fc.OR!FPF@z(`H;O0B3.`"F1FPF;`@ @s":`)h HB O3"F1F(hw?(h!?HF,R,n,-MlF l(F(S(Fl')N*K#(F'J;F8 (  ###)F FH ((F (F +(F(O + @^E70SE0 G   HB D D ,D ,sF0VF(F51F(F8*+F F]pFFHBl F@!J@,ĵFH] FZ@HU,,-MF F74F F7GB! F8J7 F77F ( -# )F F7 FzFBF9F@( 'H:FSF$HB 5#)F F!J?eFp)F F?RH)FJ F?LO (7 OCF:FYFv@( HZF3FvHB)F F7Fe--E-u-y--MhFFF+dh0F7F(2HO P/H@W&xYFB%BF:F1F F@P'H OR9F F;@F@#H@F(?R?2!F"DHB|:F!F0F8 HFOR 9F F@?R;?21FHs`2DB\4F@p HP----.?.--EF!FF1`F)`% F(Rcl+|Д"0+x!hpHB ! h +kkH!FB F7(ÀgHhBݿh/Уl#wmXQF8FuXQF8FF8FBg8Fl(!(rPH '#mLKKl FII(A0 CHB F@H F >HH F :H:H+8H 7H@@F7}4H,'i?BGE /H!FB~4`ch+`hBB'H AF8FAO18F  F({fcffHBGch BH//-//M.O......d/.// pGFF FF ( 1HB O5/HB(F F h(+H F()H F ,'H&[ "!B(,#HA/bh!F8F@H! F 0;0#c`!F8F@ F  F(% FD(8F HA*F00#0F0m0~00FF7p$%F"DB * e9FHAO0%FPK$ 4`0-AO`#!FFF@\FPCEAF8FA0` 4,`-AO`:!FFF@@FPCEAF8FA0` 4,`FJ7 `@ @B18 FIF7.*F F8@781FJ7l0ò #p#O09FJ7X0ò #p#O0AFJ7D0ò #p#O0$FJ700ò #p#O0#FJ.IFJ(C7FFJ7(` "`0FO0S@#FJ7 h #`o1#FJ7 h #`o#1#FJ7 h #`o11FjFFFFhjF9F F`h0 D9F FxD4`+`+F2F9F F@oFJ7 `@ @B;17FFJ7(` "`0FO0n-EFF FF1F,HFA)F FF((HEA %HA CF)F$J F7UCFF)F F!J7NFQFHAHAHA#)F FJ77F :F1FHA)F FF:F1FHA<HH]A4BH@1Q1_f1t1_}1ĵ1111U`-AF" FF7FH@ IF8F@w8 K2F)F FAjH@IF8F@fK1111-AFFF/F)FmHAl.kHAf9F Fi`0F@)FFdHAW9F  Fm)FF^HAH9F FF)FYHA=bSHA7)FUHA3]NHA-.\Os@"9F  F)FFHHA+.x9F  F)FF?HA?K@G9F F*F)F:HA5/HA>.9F FF)F2HA.7&HA.HAp,HA].#9F F7(F+HA.9F F()FHAHA+*F1F F1F K@Ք11122.2A2W2. m22Ѕ2ChDpGF FFF( 2F Fh)FhG Zh`O0-EFFFF7S(F k6N"!F(F7WF3H@72IFPF@!F(F-N!F"(F7A"F9F(F7;"FF1F&HA  #HQFA!F(F!J7_x+ hSHAH!F(F7!F(FRFAF0FyNBN@( N N 31L44_i4v444*4=437F F"7jF)F F:@#)F F0@R)F" F7IFHA 044F r0XBXA F 0XBXA 8F F6aعclh(F$!F7FFF J(F7x(F I7^(o F8ooo)11 FIF7D ]9F0FJ7F8F#!(F@FpD`NF)F"%FT9F*F0F7F, Fo 2!0F77F0 F#8 FlFF*F F(o8o-MFFt| h h 3+JNR#`H:F1FAO18FFF`F1FHA F kF8Fw#F,-1FHA8F SڤHo!F8F6FHA!F2Fd8F"FF8F62FHAq!F8FJЏHf!F8F(H^o HX!F8FEL0_BF!F8F0(d"!F8F(]"!F8FF(Uѻ@<"!F8FF"!F8F(@'"!F8F(@"!F8F~(@"!F8Fv(@"!F8Fn(@"!F8Ff5%!F8FLFpF@F!FF*FQHAo'%(!F8FT1FEH'X.!F8FH%1F=HAo+Qzh:D ГBҹB1F1HAo*F1F.HA8F!F ?(fѝ?0 +aЫ+]ٻ#BCF FF *F[F9F Rp1FHA_oʄ44 55C5f553555 6,6Q6h66FUF(F6H(B)FBF8F=Fѝ?0H `! ` +?O +F `D-%B66l FF I:FF(####9FF F '-M#F *uh+uh,s F@F(#!@F(bF"+FFBE<#Z##1F  ΀0F@gJF 0F7g( ,@E4sh3DE/^HAp'o`  ```8F@F(FO2FO SE(SFBJ 0F."F0F6K##Z##1F <("3HA  ,T#! F?F#;'!F0F%JF 0F6,FF jhro F  F(H@o wF(F7iH@mYFXFD7\H9FXF \XF708F1' Mo h.7;7N7z77FFFG*pFFT!A"FF H@"Fq(FFH$@ FpO477-E8FFFF /Xh@xA:)&#)$ "I`h`hI,  BH@UO0$ 9F0Fs#KBF@sSFxR8 FH%!F@,"sF HF% p I?F(K`hH@kF"!F(F 9M97ML#d FIFaCH0m۶*̿XhH@#"iF >@HH 3]j::-MFF FFFFP6ܸqbI`h?F(@Fh@1YFFh@,YFF i@'FCF9F2hUH@#FBF(F1hpQJQKFBFFOH@` "KIBF`h?[F(?Ѡh@FF(F`4`CH@m"BI`h?E0(F "9I`h?8X(F1h/(9F6H@O "4I`h?&O0(F(9F.H@;+I"`h?F(Ѡh@FF(F("F9F#H@#"I`h?F(Fh@YFFh@YFF i@FCF9F2hH@#FBF(F1h JKFBFFHh;; n;;'ÅH;; ;g&;c;sH;;FHp=Hto @l *9 74Nh4O,<,3Bclbh 3F;F-I.H@vcl FFi#)H^*j#'HX!hk@*$H$I@Zj,<l >>b=n=x===========AX==1>>!>)>#2>8>L>T>d>\>*-AFFW I"Xh@hCF:F1F(FFA`GO0 T*8F"XhF@C"FFh@=FF(F*F!FH@ 8O0>'H@ ]>-AFFW I"XhD@hCF:F1F(FFA`GO0XT**O0!Kh#xB+cxM+TH@ !Xh@F}}|B"#~`~BB|BbC#!}HCCa}Ca@q#aHC!@j!C# HCCCa@[ M??@&@xFB+ FFCxM+( H@@ po m8#*F!F3F8 ?sF&hFFf :- --/Kh(Fp1F`h@F1F`h@IFh?h1Fh@ Ih?0GsGp!h@sO0M*-AFFW I"Xhd@hCF:F1F(FFA`GO0T ` qFH@ @8ML(h3 h3#J+``J#``8TXPL#7F F3- FiF.F-rd$A H@)H@{3l-((F5 F0@@-EF 0F*BFFJhDB"!F(F2)8O1(FFFKP`BF9F0F0 K`<*F F0 F3K`pPLTX-AFOr!9TN3lE%ql"OH)D?F(rl*DQ||C#||CCSc FH$RXEH$N8DH@CL Fh!@\ @H@?LF@F5(_#BF!F0F0(M#0#Oc"F1FCF8FFM| IF>h F I>P FI>8 @B  B=**O0Xh(((F 9GKI(FH?BpG**O0Xh(( ([ $_KI(FH?C-EXFH ,hB TD,H .#I# .!O!<?w N OD  V;SE9h H?iFE S$hDD`tֆŅ pG*FFF"Xh IFXAhB1FhGF F@*O0X  ?   *FFIXh>F$%F#  W% #5B %*!Xh?s pG$%$%$%$%$$%$%$%$%$%p*FH? "p#h`h Fh+88+F2FahH? +GIJ$%$%f$%uFFZ,zI(x:8+Z\ pG *((ܰ@ pGpG-AF7H F$!?F!F0FF0H 1%BܽA,H )O7-)H !0F 0F>5D0F>0D%ѧB"F1FAH?H?,4OeEHA?V(JHE:F ?BH? OBH KbB;Fq]F H?5GOWOTOYOiO!la#kOtOvOKF`H$\}O-M*FFO4H"IXh>F(_ѾѝKh{$8Ih>e(=!O 5!(h? F (и-l .!hh?JhB#FH &l0 (FIH?] F1FH$IFF58FFF6(5iFwH??nN3huH :"sIhh>F(5/Fh?0`0F C(!Fh?/F0hChFAF658F_H?t!F(i?FF0hBhBZH?e@FA$"VIhh>ȹ/Gh0hh55 FNH"F0h6@(5FJH"IIhh>F(@܀/$h0h 5 /ZFQF=K0h5(5F9HZFQF0h5FoF3H0Hh#(ix<+\E(K)x>)ЧB(Hz!4X$P"(F?*x?* 2`23Q))FHYF)x2 );\OOOO}OOO PzP}PPPPQ>\YQP>QQ[+*0MJx])F )14X$0BS\Dx])?U?J3 CFM>(F>S4BDBED2hhxg+@#/A/њ0s+8)i0h 50n+s+H/F!F0h5n!FF0h40Fn+/!hi?>FO5{BݓB 5n* ]E !F"0h5F@F!F0h4gښ0s+@Fi$O;EH?!FZF0h5F ?I琳,0ݚ0v+!F)F,*h7I , YF2I6?Dh0h5cu/0h h5RZ5yFpH5P5oFlHhhxh+h/ѫhxg+$eN)iV >4 ,єX$h #o*\H P?3hZHZh,F?3hWHh ?3hUHh ? 3hSHi ?!FQH?3hPHi ?,3hMHi ? 3hIHj ?,3hFHYj ?0h4FCH?BI">F0h?T3ha"F"Fh?"FFh!F?BF;F0h tQ".Ihh>F(@𝀫hxp+f0h4F'H?'H?EAF0h4vD5FHFdYQOQQQQQRR$R?Rф[RjRRRRRRRSS/SFSlEJSuՅeSAFRH2?>a+"Fh?" FFAF(i? #F:F0h5(5GFAHܻd+qFh?F0h553F8HȻ"7Ihh>h0h(?5F0H"/Ihh>Fй//@Fh?i!FFh?dF0h B"F9F0hڻF I"hh>Fȹ/ 3h+?-h?F (?#0h (?I"hh>F(/Шh?(F0h RSSSSS F}-(a$$u$$$%$%$%%3%7FF F?(`Bx+o 0o*-MFF*yIh>m , O78FO%!jFV# F(F(@FfI=F(1, #aH)F?B ,F(!FUH>!F(F(@PH4>6@FMI=Fh,#IH)F>Bҳ!FAH>!F(F(o6,FM(u@F5I=p,?nO!Z(:(c2FYF+H>U*H  (H 'P1FXFp6DEC@FI=L(;,?8&!Z&(.*FAFH>a)F@F(65BH;@ZRZ`ZfZlZ ~ZZ~[[[…-AFF")FFFh**#h)КՆ[ #h##`1F H>#h##`)FP#jF8FF0iFH>Ho]Ѕƅ-E*FFF@*+ЄIh=FO4%h"PFI=(g+x+%( O F8FE.O 4OEFO CF;FC(=Fm$B"F1FV4F1F(F=p(x+!>#F1F?CE0s+c+i+O4t+&"(FFNF)F=H>R!F8F@F F&&&5IF01H>6瞹FF)F+H>(_!F(H>!$..F_Fذd !Fv$$H>ֱ_FH>7$BH-?T(Ff7.$7y]軅|]]]]]R]^*-AFFW I"Xh L@hCF:F1F(FFA`GO08dKh+H o` `^FFF. 8F.FH>  Fhh>FFH>z!F8FF(FH ^_/_0H>\ ]P_7F F@+F"!F0@Do0shFFFFH.$F"hh>FH 1%.ۮB ")F )F H>45- @ pO6 t__* X0lH>$O1Xh!>|FF H>!F+ F@FH>  K`___`FBhlH>clաlH>H> F#hChhRhH>__ĵ_*+ h,<,3B  Fj!Xh>FF+ BF(!FH>{ `*sFF(!Xh>F0FIH>_$. Fh>FFH F#H>G FpO4/`7`Y*sFF,!Xh>iFF0FIH>'$ .Fh>FF( FpF(H> O4/`7`Y#\.*D@x08pG3+O0pG-M*FFO4 FFKDKhCKhCKhzF8s$1FF$!Fxh>@!Fh>;Fh(Fܺ!Fh>-FFFO )FSFFF'F)F%H>WEۺUD'!H WE nK`K`K`KH7>h ^* H ]7 H>Vextp/`7`N`3T`#a*-AFO0Xh!>!Fh>Fh)(F!h>!F i>F@FHk;F"F1F(FIH> )F(/`7`-AF+FO5(F!ph>k!Fh>fFh(F(FF@{9FF!h>M!0i>D!Fc+ #NF0B = 1FFIH>% Z`7`-MFS+FFM g!ph>!Fh> !Fh>Fh(F@F!0i>F8FF8k)F5PF:F I!H>b'8FFF!FD E ЫhC`#LF(B =!F Ipi=(ѫhRF#`!FCFF(оZ`7`b`*-EFO5(FXh!>!Fh>Fh(F(FFs1FFع!h>u&bFD!FH>FF'D;+ܺ 2FIH>FIH>%#!F F  @F" ,4FAFH>e`/`7`L-E*FFO60F@K@Kh@Kh@FAF@{Y9F[F(R8I_h! !Fph>!Fh>Fhz(F,+Hٲ>k*H %DD K K` K`, !H"H !H>,F'KB#F)FF(Ѻ%D)FH>5#F)FF(FIH>'&{,lhdZ````Յo`/`7` S P-A*FFGXh!>{!Fh>vFh(F7@FF8k )FF8IH> !h>U(( .F i!>NF+F9FFIH> F=)OztO0Z`7`/`x F**O 0>$,,xh>,O3$@ x*+!0>$+Cx{+0FF;}+# p"ݽ+FpG pG-MFFFF=`F4Lh BF(F!h=9(T h=REOeh>PFF8FF F=-G @ 8 (Կ  (̿  C1FPF|1FF8Fw-! #XBXA  B  BBB  4\E)FH= ڄ`*FFh L(F(3 H (hahho#O0`*-MFF:|pKhKh!F @l;F)F"F(F; K5D`Kp`!h 1F> KhD1F>FO0 e|*L!Xh= `!hH=u ||a*FFFF IXh<6X!5<;F2FEH !5hhhĵi4i:i#2F80)FwH=)FvH=1FuH=}$6^E5UE?oFF80#6  @C2F)F80(eH$3F8*F_H=M#$ 65ZE kZH=@3۲SE?4EFTO;;xCE[EC3\h*FLH= # ;BEH=GK7B # ~hDHfs@=r*Q@)@08J9N_2F! "5H=-H= 32J*))F0Fs.IE-KF,H=籈E @)т)F0F + #I$J+F))F0FI# l"I <(.8h4giiiihĵׄi؄j  /j#+GhBh^jth_hLh[sFFF"=FB0`x-) PRxB"!= ` p #`O0-M*FFF@[hKh Kh KhKhKhKhKMHKFhhH<(2kh[xx+.Ѩh@kh 3ChSjw[j+jѸrцH  #~w>.U&!=s?>F#r6.U&p.!8F;F(<Р ZF9F;t h  # .'г+.hF(h 8(Ѹl@Yf #O338kh 3,KHh (8S+P B@  [EDE:FYFSF F&kGkh*rѺ?3 /0kvRF9F(FG(@&  SE7A"i(h2{+ (k.:FSFk绲8k.O2 #kG(h8k.O2#kG(h@k6 O2k #G(h(k.߀O2#qqYFj:FSF(F~GC h)FeH< [E8YF`HS+`< Bu  6SF*FYF FjGrh+`Ѻ?SH< -jñRF)F0FG(F-)FKHH=Kh0=3;H:I x9H9I x8H8Kh0=6H5Kh0=3H2Kh0= 0H/I x.H$8F)hF F hh;9lhF F:DBK#Obih3p!hh;"KOb`#h3pO4$,M}AKh18ȐF 2F .F *-AFFF" FWI bChB -сh KB h;F)F0FFA`GO0 hፁp<F$ :HMh,<,3B pl H<|KlB+FbhH; j,<#i*FO0Xh3 K`( =(ahH; H; ⃅-M(FF"}Z(^&O FZK#x-+ F.I:F(A6BO6B>  RF e(D,="Or!0F%|:F)F s2xI+F*YF FI;i0F:55@-1F F~  H;wO0 "}ODF  $!#A.-EF!} FF!Or +CjF ( !} "AFh; xFBFù!F (//0JOq ;. h h w0#FJH; O0FЅ*FFO57IXh:Fй3+hh ( . i(F#*H;%(I`h:8#@#I`h:F8#@]I`h:"I`h:"I`h:zF(.FH LKON*F (H8`0 *F (*F (V) o Fo }eQLi*!Hȱ!;(| FXH;+ FH;%$HO4w&Ë7F =)F  FKx"F)F H; 0  (F! q(FYhH簌ՌFF P  F !F H;(H; (F!FH$;*pFF'*!h;:FI`h:0(Fp@%I`h:uxKh3(Fp@(F( p M+h3 ((`!F0Fp@"K`e`i-AFx F**0!0;4F,& %%%%x0` O1:F@F yF0 H;No BF)F# FUh4!;o&-M FFFF % UE O PF*F0F: :(.;h#D[H;FB ХBr2PFq:"F0F ;hd#D;`z-M};b<x2F` Fpb`90LXH: XF9]F#xcbkFD"$2F! F/zk  <aR#F)F0F9Hj+{YFBH:$t2+#htach{a9;jBBcF7H:tj9O0C\;chj18  !_:ѻk(Fj{iihiR4"F(лh;j$3"0{`9 :{h(:iBj0Fch#h#9j08F(ч $wFˎMFFFF89@#H:  M <(FjF)FH F9OBOAH: P!F09 C@3h POAOSg0( R)F2H: Q(F1%X*-AFFO60F!h #FFh,(GYIh9p,,,9FhhF8FAλLIh9UH# hh_FFIh9F,h9g(#AF(iF88F&hx-++)8F9IF F9E0D0kF -H:@&9F9!F@F9AFhh3F%H:.@F8F F H/+ $+,%; +)#(((((^+ |+GhhTV99!F8F=\F!F8F= H:_cd&h{-E*FFFPF E 9IXh9F&=4--4HF8 -.H!F-Ih9v,Ih9qF*Ih9kXh(H:gi!H9F%ch!h@F:(AFH%#QFJH:|9F(H:q2FF  瞒w}]&ƒFF F"!hF::hFhxh [`"#1F(F# #`-AF )F-29 KF4 M\l|hh9d d @-EFF F9)FFPH:, ,F, 7(,  (W,9i k([, $F@H: ",!h;H:y "/U|"sT#6U!chF;+1J2JR# 10H[:Z@F9S( HSFBF)F(H:J)F'H:F,   ( ' H:.PF9&(0F9!(Cl F (  ()F FZ#;p v6hw{˄oh2!F "!hFfiF F6FiFk ClhF  8(Cl NGаq ?$?Os"F(!FH:P-MFSH:1QI@QJ F 1NIOCMHNK F:1SJH: FGH:%FOEO1CEAHM:x?H:s !=H:l 0HO4矅֠l7)&27:ڞ @BW**"XhF9!FrHF@H9"! Ff  F9F( H9 FLH9 O0럅)7 F81Fh+I8y8% F],F F0hFI8k()F8(8F֠iapFF O4 F p8("(FI8F((F8(D<}+(F8F(88"!F(D(F8B(F84(Fp!hF8&iF(F(Fd dB0`(F畠-M$N$Fm#J#K ,p B6+x3(F8i#(D<)FHe8] D4oH9Wo mXF8 "7  hB9FhG(6'T  T -MHF8 FH8FH8FH8FH8EDP5=DD'4.W0F8>F o IF% `()F8蹐H9oI8k 8`FI8X!F8(!F88\O ;*"TkιYFx F(PqI82FPF ,;*  fIF(@(F88FaI(!F8("FD88FSIk(oNI8/x"9f FQi+n<EL 8FBIDбk"9E FQi+Q<EP<8F8YF+/I8(\#8F#E<6ExY]1!F8'$(1FH9PFeha@F^o"F(F8SU7r7nƠѠؠ㠅= {=֠0I8(#O0o%-MF+F h 9#hF xKhH9O07FFhF83FhIH9 I`h8NF(5Ѹ2хH9r!i>ta(F7hB|H9_|H9\0(yHiAF2F;|(F F@F0F,oI`h8F(Sli[ !F<D?4$?@4 nF G AF(F$?C ZH9!F(F Fxiz0(OH9O4PHF9zAF(F#F Fi]@FZEI`h8(I #iFO4AJ{`AK E&11F(F 0GF`xh$8i5H([i3H(T1F0H(M.H$(E+H9 60B  &I`h8f (F FF"I`h8\((F&i 0Fw/H9s+TjsH]X̡T  T "5Ik\fЅ-AFFT I"XhXChBhCF"F9F0FFA`GO0hip "$KKFKHK9L  1"8 piUhFh "Fil H+F9 0 륅j$FJH9߸9?*8* 8]hI(FxF@)F H9 F Kh+H9O0ZhlH9Od~)Kh6(H9O00F Fqh#H9;hhF[F I9q$0FXChBhCF"F9F0FFA`GO0i&O``F8h FF H8 ` (`0;h HYh8 $h+H0F FUw" $KKFHK8_S   F iRhj"F[hH8E q˨[Dž8 FF!F H80,"F I H8@8'*F!FH!F8@H8ڨ9ߨE5@𵑰" qF(R 0Oi ".K .K i[h*K+Ish)K*Hj)K8h"F'H)i"F&Hi"F$Hi"F#H$!J"H):F%JH):F0F"FFFH&FB FHhht6 3>9HYhw\éϩFJH89?*8* 8]hI(FFP)FH8h F o M(h( H8[O0 +hZhFHjH8Lܩ:sFSFZBhFZAFp, Hj8( F%(Fp!FH8,ѱhH7d "phF8fFhB2iBڌF2i H8FDF(бjH\HpssFSFZBhFZA@Fp-O Hj8(FE$ Fp)FH8FFph8FiBiBH86F(бjHЪ,FhF"FFx.8F Hj8(F$ F)F H8|FFhh8F8FF(HjT"hFh!^F@Hj8R F$ F"hFF`BF@Hj86 F$ Fޫ-MSI h)G*?"F(3eLHj8(FJK(!!HJIHF(Fc"FFEH(Fy"FFBH(F5Fshh"h:Beњh;H$ F8IXh7(6K7J7K7I7H8K8S  Ԁ, F F FqF FF F8F FFjhh$h\%0=Ly][jcX ĵF')FXhx-*%JFh3`>. (Ff+O?+#F9:FIT6(EO5n8 *-AFFW I "Xh@hCF:F1F(FFA`GO0m#0 FFJ 56,H8F F 0 ! H6=H8,FX*FF[hx-*[xa+!<5,'&BK>HhOd)!b)c)O0%r)t)*^"O *X"O )&F*M"F!'(H    RE[xC  YFH8 "F!FH8(FH8"AF F"F @ B?zH0 C0h HX ؉zگKp!F"<,S_.x-.iF F!o.a.f.нp@e"),FH p*[h J# 5@ ]O0-EFF.FQ_+x-+ =!(F7>Fx)F7H8I >?+f+_H1J.h`0kBF(F,I5 0 'Z'770BD F>F!FH ;F &P+:F)PE&pџBKW# 5=8F\+ K)FhH8O0԰n ؉$0*FM/0 M0hh)FȱOa FJ8"!FH(kh x JiF#8" C p#" O0_P-MFhmch*OF3hC;T#)F8Fx?/ @Fbh+I8Io5.5 D@6%O $O Ub7(h7J  WEDco@3B ##0#DDcp3,F@6@FcBȿ" KȿUxJ " m O0Wo*FF"O0pGKhpGn K0#0Or x3iF ]iF  -MFh#FFF 'F^F ;-`h x-)4!8K*F!9>4/OP" !V:H5:7K8Hh8 s)b) c)O0t)+S '+OF#)dF+EO PFMW!84FI8SHo ;AtP"!H5,۸9]* 8`1 H;F"FH؉k$P08 pG"F!4@ I H#'k{H7N;{pG pGOzsXC7r LF!gx0;JEF6!0F6Op:!0F6{F(ZO F0FF(m0FF(gñ0F6oF@F6kPD0F@ Q6N1IY6]ZF)FY6f YDO[DZp(F6+FbhSh`< к Ѹ3O m ,CF# O7@6R&0 F F (.b+`F(.Fia6=!F65Op0F0!XYeF!0[YB0F50XY(;#jJ`**Ȁ@𿀷OXh/@+%F!5F!0S'0B00F;0i7 0S'0 F - F( *kJHp`Xx0+(;#  D# [/(F6 #+T(DBp!(F(F,5Kh{o2J`FGF 6;h C (FDF(I6H;h(F&I6B(F 6> 7h(F I66(F6 0BF6pF;!6`0( HX7gK8  F?=+@}!>-MFF"!O8O %'  3HKlBFF9F HOr"! H!H!B9FH#` FhG?F9 +@ +!  8F5F8F@%?"iwKBvH6? "irKB#hx+( fKbh p*  F"iGF/y)qAYFO /@R (@ۀ ! ++@9 +@5F"+@<>\#л|※;@- ! aC #i FGGh?W (?T FG#!? YF FhGF F#iG,O²\F! i3a#i FGò\FZ_(!o FhGQFg?({(1$!h  i2 a!W$!SQFO!K FhGƵµʵϵԵٵq!, Fi3ahGh FGCF}(# FhGGF'(?ch"AKO ` +Mch=H6#c`# #`J#[  &S FhG!& |G FhG!# FhGFH:)?vch+-"K` +?qj"K`#}/?M E?'?Ϯ!?~EѪK!K##]8M,h\ /K(``KaC`#`` 8 80DZ FG(HT(G! "6F#H F !F"HF(5ЄB3H60[H6H6H,KFF!Hn c QH!H Y QHK F`8E!FH! H߶鶅 ĵ*8AQ @"-AF "Kh8FA"O1yk-)FH6j{F(Hc$4 L,н F5uFdFH&!F H%F6G4FBp5@F5_zl Z} pG pGIK [D0pG<0 o <0pG KF D< R< < o < k dpGL0 ~C#L0pG pG 4d@`d 0IFX<0O\SP0TKF [h p jpll0Zhp l <00< ]H O2 !HLF~`  { pG pG pG pG pG pG pG pG pG pG pG pGyL H:"L L H" l l Rh2"t tL R"L L tp pGL0 ;#L0L0T0pGpGpGpG0!XlJ4Z  #8 _,8 pGOR84 4PD8PDLFc8 < 8L0;#L0^ pGKFh"pM .FU;p@P@GF(2hIH64Մ pG pG pG0 CsC0pGH7 ͷH(1N A! H KFxy LlH!"hHv ` շM@,H 0 淅 X \ XY<Oq~@  I K J[`P$ D$ #!<V $y  pG pG pG pG pG pG pG pG0M#30.FU;@P@GF(2hIH64DoFFF" FF<D$%F;#F8ғBqӤEBqҘaFU+%FQK$FW;!-E F!FFF ,!F0F,)FSF:F%FEE(x,h?`h?AQpD532-M$ FFFCFF&F;O ZF!(FF ]Dȿ6$ȿElEL &FRK$FFFF,(`L#9F0FJ,h#`#-MFFF, !F(F S+ +"9F(F+ODIFDH62O0!1F!F(F, F ;FR (F {+ +"!F !F(F $,LF ,#F#FRK$!]"FG F DO4O E4BF1F)?F Dxm-MFFF,ۺ ;F2F!F(F M,ySF2F!F(F+(F FFFF+CF*F9F0F,F, F,*FFIH6l F67F+P,FH6ZHF$ F05J0#F!(FJ,-,hFH!I/-MBFFF$ F!=J(F+&OFFEAF(F+#[EBAF(F,O8:FCF(F,g ,!F'H6TFAF(F,(?O !F(FJ,8F,FH6F0F5Foo `ix)ИH5U<*x *FHO;)FpFa^F1B!9xzx*T0**? )ЅH5*9BۂH$1x[E3Дa.}H(F%Oz1B&s1# p F D9F" %!"&!;xDr#C&!2&!) )_HADB]Hs\H#sC%ݒWHl %p D9F D"|sD\HxB"T Jp)GHuBEHwpк?CHp pC p F D9FR2F)F F660B5m#hn FA!d##!AA "PFH)*H5aof gBp4( "1F@FH "1F8F1F "(F! #BF FU! #:F FM)?Ʈ #*F FC抽н7]w㾅 -Tr#-Ah`FFF>F0 H4 F1F(F\F(Ѹ(F2d#ih/`#"(FAA H4Bp4@.(FA/!(F+F(ٿ pG pG pGFFF,Y(F-Ch+h;p$9 i m(H4#;p3p(FiFd#0hn#D$##"DA_0d#pA, *%)%hn#D$-DA"#A@pd#0hn#D$##"DA)0pGim8 pFnhC&d#"#FA#AF, 1+#xbxC"HCs_Cc#p cp0Fp-M ?(?NFBF1FF ۸@(F"1Foj F@9F(F''O Ozz (?"1F(F>, 48BF1F(F(۸@&7/O O4oг ""1F, "1F(FF1FH4""1F(F7co"H-MF:},  F&?(`"1F(F(7x1F / '(F:F(׀:F1F #2yx!C#q #r" "! yyZr 3z#ssz*cszsx 9y"zC'1+"!(F#<0`@/n/hѕ1+@##d`/e+hn"A!d##AA(F#A(v(FO(&n, F(CO3c&gz 9BbۓHL0"F4B8F 3d/d0&`azp a 9BN&O 9BNۄJhC#`KhB\#J` ,@4S@s@h#,9i8Fgc1+.܀+hnA!d## "(F #AAq( :}i66"1F@F61F F5! ([H4mo `D`{h `z``a6`T 9 ; g#?LJ BД 3l{iB/1F(F ( 3];iB #ihS``#K F 3F:i B"ihJ`` F`#ah ;"1F(F Е1+"1F(FAF(F"1F(F AF(F2AF(F"1F(F"1F(F{"1F(F>i2*a1FH4o5`o8p3@'9i "a pGFhhnA!Os#"zAA"!#q(#h9%H3 hazhA!nCA@AA H3 hzhA!nCA@AH3 O0IpF "!(F@C h0hn&A!Os ##z2FAA!#H3 hazhA!n MC)Cp hzhA!nC)Ce0F p`-MxPNF\hhB FnO$3kzD4 CD@DD#hn"A!Os0+zAA!#(hI hnA!AA+hI0F zD4 CD@D0+ !F(hFO CECFFOs !FSF(h F(h 9!F*h9 E&(h9;Ѵ E 3ЛF  D:#sa# F%0$0F j h;OzuisBp3=ѣi3H4Mao #{+ 3x++ 8 @Bp#++O0 -MOF FGFO а G&?)F Fk{F+@)F F+ L0+M0+ (Tл +h9(FjGoPk{+< "!0Ff#3p0)F[sp#0F3q0@0k{F)F0Fe+h9ՔB0ùL /.ݔM HL @ !x#x++ ++Ѹ  ݔM HL @ !x4O0H3F:FFo(ۙ+pLF "! F`##p0)F[cp#0#q@0 #0 F+kG`p-MFFFF*_ FF !!+Lz #`4PUE(!Zi#HjC "`*"O "p 0RbpObpOBp* qYF0 H%rGȱ XF" ;ѧ ! 8F  DD-MFFFF*_4 FV^F !+Lz #`4PUE(!Zi#HjC "`.("O "p 0RbpObpOBp* qYF0 H%rGȱ XF" ;ѧ !S Z8F  DDOshn#D$"#DAH-Mx FeI ư WH *F'?&?2 hzhC#n\ CC@CUK3`0  s`Y0`O3s0)FsssOs2F# h-( FlO0FchA03t hfzhF&#n&C0F@F FUA1CA@AOr& ( h9ո?azZ(Ox #:F1F h( h9azB( #:F1F h(:hKB0zh;B;{+&B+ц1Fz:@USBCUSBS7 %0 H4| 0FAhH4r F5j\"K`pG<(H4ZLH!h4U h(̿  @B<-AFFFJ&!1+Cі"1;+>8"AF F'r%`"1#s#1+cs%P+&?J?K!QbF#"c !B ܐ"(Fczzc{ zk!{ +-1H30J0K0H3 +!*ё*a6Lbrr+!*ё*!r.!% 3 1zѱ%0+#%0#h(FhnA!CAAA!bK$9(F ( ?O# I#1TM…PANM-MFF'O |L (?hSrz0 "! F##p0[cp$#0#q1F F3kGFP?kH3`O:0FB0+єL0:+єM0L B`H3Ik{+/sPF@\H3/pXK@Ԙ0"+#ks"E "Z#O O $0U0^0 "!=H~"0 [1Fcp6H3k"pGF(sh ?(?Cs`"@FO ]O ! ")HV%##p0[cp#01F3k!HGx #H3shO4b#s`Os#0 13923!;#A19!!9!?4""O a/sI…@… {…-EF O, !FF(F'8$ @ F)0h'hn _A!Os#$?3zAA#"A1BؿFOȿp;F !J3#Os0I, # F(v#FCrr1F(F(0307EڢF(М<……F BoS @B0-MFF2'F$,!24F0F00FO `F0F,!2oF(=FJ'8F!FPF3@FwPF)0F&8F [xF!F8F( @Fv(G$ 4B0FPF,%JKR(`S(B(pC(@UE0F !F8FV% jBF@F5tt-M'F"FZ 0h[%B AF(FU@Fo4 F2(F F22AD@FF@@Fo  F I2!F0F20F2Z%07FS'@B!F2tt֠ Hl!3( H3o FI o……opFH FJFxm+"F30`,!`2(Cxm+Gs+`pGp"0F3m(`Å!q ZF"1"*!"!F4$HDб!F3FFxhFW0F)F:F7=CF Fo…-AFFFW OBoT >DF1F20(< ,`o-MFFm(}){h+YЃj+VOFh ; '#i FG'FW ?hBѣi+Cbh0H(+%jB,H3biJS  +F-hS GU ]F2(=kh 0H3o m#h[h 3`iGF(%j+hBU FhYF2(=oo Å%-EFFF(7FT oB F88F2 ` Fo V ?VF9F2i(.F kjjb```j3b o-AF, FFFF#`Ba aG`aab](F2`8 F$ F` #bcbFرFU ?hBѠh F S 8F3F6hoii+"#aD pG:B3pF FCa p+Ai1 )Aa !Aa!ɲ)L]ɲH"ЎLA Dɲ+(S,рL β."4J4JQ\TҲ*1J!T9,рG,р(F:۲+ؤF۲+!(F=,O!(Fɲ[!(FxA,1!(Fr>,=$ɲ(FiN,?|O3=<@?t~!H, 2!(FVC,4䲤K#DI ;;:;;8FH3F JIY F!F(l(F F8o"FIH3LoBO4Å#Å+Åp1F+o Fp!1+ѐ"1+ѐ#1+" sB P =F#h;#`+x h + 0D1#h#3#`50 `(xH!#h;#`:9-M0F FFI hO0FJ`J`J`JH`J3+@+pB# `0F#(F31F/GE$OO GF(O ( (;& O.U+x+@% F:hK` Oc! ,2FF#3C (2@Eq o kE[(O( (kD  8(0( (     ?O #1@՝!0[+A++R#jjqiig7jgei~(ѝ"01;+R#eigi7jggei7jOc9F ( C+oTgZm QmmmmmmmmmmmH+@M)K +DRFF)D1 QFF%H2  SF :+ 3c#O 0 3QEM D?Ѯ 3oohцooÅB#: k1ZFF)D1YFFH2~ l i EJH 2g : SEQEjH2Ro : 3?ͮQFJH26 :"Ѽ(ьJh) KX`HKhh`B` Jh+ۀI hBH3h`BĿ#`B{JR#YF(F1(F1F(?x*FF 3QFaJbH2 :E#0F 01XD)F0F(?E [D ^+?:Oc9F/!+?ح:hGK)FS"10;hCJ3+̿3FFh>`Bȿ`?Jh3`p1{F0F} ,FDz /" /nS'lllwlllllllilllilF//*/GCE##H#pA`}#O0+pxH7;!F(FF+x +Ѩ!F(FFÅ#Åhцoooo79@3B+ /#0F#pI ,DvKD#3{3d3#p0 To:"KFpo-MmFF F1#FF(-#oFVDE% " FI0й,! F0FF F1^?F)Fo o B%(F!F<D0({lBиlD!F<80(ltXŅ8F0L! F,F F8L"!F FhKDldD3Cdd `  `olt!-MFFoFmF&FZBѻ3(FI0B6.ѣlblNS``# FcddVDOB "(F1Q%D < XF0QH%5-$ho`t#ÅltK DZddpGlt03 oF(6h,<,3B0$L"!I/KKKKxL"!I/K!K"K$#d ^(F)0 Fah H1jӗ_YUQ#ÅIKMcŅ !! KpF FHFx% /&! FF FS(Fp!F*F#4FsU&*-AF'AF418H0 )F(7BO0<FHe `!HM8 "Ņ H0/ KR H0"!hGFH0~Ņ<ŅM`-E FFF'8F.!/Rx@F/[F#'FO FBѺ*F@F!h/(8 h/BB'F  4'FKJIKZCÿm۶Fih H0#!hH0`i H  ŅŅŅ-M 8+F Fhы3# Э F#!Bb+f.OUFF+hU/hhz``/(  zhhE,+`EѸ%B#;c 8k7FJ# 3>Z%`(ѸCF !2hH05"F1FX%88{ 5;kBX%H0 %ƅƅ7F FF , (O KOs H`0(OKhhOsx#-MF# F/F( k#3`3F?B4B0J`#F$0U,C+*л  F@F)Fi-$4` F;FZFQF FF M`G.!@F/ 8@F/F$5? U,F$ F5BU /PERF@FU/(ѧBJF$ Fo6 -MаhFIh /F P0F/%1FȿH̿F/a(FKxF , ,t5A+FK< , ,0- "PC,-WwKxIxH #AC*FuH'(s([ и sPU /| @F/t"F@1DBRDB{$t0 02U"pDW @``4S x$+и #JK! Os(((H, , AXF/!SFFSYF"-??  : 1E2BF۠ ܱи PU /$, "vPFU7|H/FH/N%F ,X HH0 0F/'{M+ HHX =DHMtm۶!x3ĵ8F F/( D<.+ E /V8`)F3FhZF FGF8h/H8`0@0krƅyƅĵ{ƅ!ƅK F!hH0"FƅpJKFzL#DBahB40FciGch3r Fp4B$T  T  F$ F! (-M{F+LHM¸h )DA''1?11'11C19ZEzAz?H0?Hc{=H!{)f&ceee_eaEZ4H0EZ0H/H0}.H.H.HM0r,Hq,Hn&i.9ei-6 'm uC R U#K9F(F;3vOO[; {F'H0FciRFAF[FH0<HHHH00HgWȅƅDžDžƅDž9DžQDžbDžwDžDžĵDžȅDžDžDžDžAȅpF #J#rKMB FkiGkh#rp5T  T pFF(!zp@H0ںhH#h; +,+!#+%')H2FahH0+i۱ Fp@GHHHHHHHHHHHHpfȅȅȅȅȅȅȅȅ1߅ȅȅȅȅȅȅ#pP0FFFyPh["F1F(FG(opo\o%8% F `iK`Cid`,I/I /PP(F8)Ʌ-M FF.! FF/0F F/s#,U FF F0Fx{"F9FH0(o(F0FF PF0Fx#RF9FHF1F8F QF(#0oYF !(@#{+#h+ F Ʌ2Ʌ-MFF FHKFH0/Fo 8FHPF"F/((FxI/(:!(F/FX(F/"FFcT4BFYFi #xӱ FiI/|8 F0(Fx*C *FbH0o FFoz ,CiSZFXH0o O4,*;ZFRH0to\ BiO 193!;#A19!!9!?4""a1Flc%$2F!FF lB4A,ѽ/H0,Q$2F!FF!F*H0 Eb%Fx"1Fx"0F,F,6 "0F I/ 1FH0FBi193!;#A19!!9!?4""a^ɅiɅ ɅɅɅɅʅɅ)0ʅ-EFFFFбh۱$ hB2F!F8FhG o FQF@F/{(4O4o%O3ҿ-MFFF Fy BF)F[F8F,*F9FH0&#!(F/nF((F/"sTFFBF8F& 6ZF1F1FH0aPF, FʅeʅFhF<,J[hR$ JIa30!|˄ʅʅ81FU+-ѐ1+)#FrI  34, " I6. 8"IR.( O0O0ʅʅCio@3 ?%?+F"!F (FO0F(F(cn+1+fff-MFFFj0?#?@ ?#? TH/O07F[F"@Fy` R(yh FKH/!U(Ѫ*FEH1;c rF |(x@>(y(;лjB813(1Os`j+@FCC D#`ꉫ1FCCc` .I,.+y,ISBSA*x[*Cd:k3FP//+yu0 A(y8(65eEy-(2bEXF(v%%`0Ic`Osd`,.PPRCCSD)FFFʅʅ&˅)K˅F"#F*]-MFCi?#?@F FF FH/7F W$?#F" }(*F=H/ F(!8H1bxsDF{` y(JM+%#y+J{h4Bј0*+Ѹ 0PFAAjYD-ZF F3F{hEѨ(a" BB+LL*D!x(Ѐ)IKj1FHcF/j-6( F*+ѭ)IKʅʅ&˅#[˅a˅U˅FH/C"#F FD˅F@i F ci-MFCiFoFFгwM"+F! F(+x+'2FahpH/O:"nIh.@/3FbhjHi/O 0[0E +F"YF F(+xk"]I^H.F/3FbhYIZH+/2FahWH  H0G"K+I0 FKKJ0KkYFEKz(/3FYFbhHHRFYFSF1 2D*+/2Fah?HU++/2Fah:H:I,.!1F  F+@"! 0 +ЃBш+/?h1Fbh-Ha1 2op(D+/?T1Fbh$HM0+"#O4s0 aiћ0 PF0Oc#Osz˅˅˅̅zZ̅.̅̅̅̅)Cͅͅ#jF!]p#!F0ahH/ p H/% )F#H5/#)F F0tͅͅͅ# Ip" F M0#\.#2$*;#$0HpDi!FF@2D?4$?@4 ?&?#F"!(F A(?.JU#!Brty+S@@(2B 8FO0F0 I H/q F"!hF"iF F.8 [ͅ-EFCxxFB"xAyBBxFBby%C#yCCyUHCcTIBB NPIPH/1O0"AF")F@Fb{#{!FC#{(FCC{Cb|F"@FRESF9I;H/c~"~aB"~BB~Bb#C#CCCcBB.H/)0( -B"*0BB+0Bb,0BC#.CC/CcuH100 5B"20BB30Bb40BC#6CC7Ccu H(FnEFI PARTEFI PARTͅ΅@΅_΅΅΅FQ P0C#R CCS CcT UB"VBBWBbZC YX FB"ZBB[BbBIH/QO0 ΅ υ-MF HFDlImH/: 7FFi@1F2f?6&?@6 ? +? "[F!(F (F\H/#FQF(F (FWHcx"xayB"xTHBBxBb#yC#yCCyCcNIBBQF F*i(in"8F8 Z"9FPF.x#"QFkfhQ P0T`C#R CCS CcU F&V FFW Ff^C2F.I.H/#-H01+nff;QFXF2 @ F(iiXF2I0HFA!J0KAAAaSF2F(F %BH/xPFQF F 1+ *ͅυBυIGNOREMEuhυυυ#F"FF(F(IH/=*i#(Fg:(IH// ,IH/& υ Ѕ4Ѕ-EDiFF!F[ F2rC?3#?@3 # ?E$?{` 8I9H/O0 7F!F0F:(#mSE@FY t< Ff(Д!0 FB""0BB#0Bb*`)(0C#*CC+Cc3k`si`JF ! /}I,.G"I F.P00@ @[H@"dP.@F ͅ_)`Ʉ-MDi!FF[ 1%D?4$?@4 O +? YF0F `(MH/aMH/^LH/[LH/XP0hB F00F87F!0 $`H("0 FHH#05Hh%0F&&0FF'0Fc{`) (0,C#* CC+ Cf- J*. JJ/ Jj7jBF)F{h!H/100 5B"203BB40BbC#6HCC7Cc/" F.H/". H/pYЅwЅЅЅЅЅЅЅ-ADiF F[ !F1D?4$?@4 $ ?(?:AF0F|`J(F )F8.xh F7Fo-Mz`EiQ0FP F@ R0F@@S0)F@`81)F@1S?3#?@3 ??*"? IH/QFqhH/LO0p"!0F;` (F;hqhHH"!p;`JU";h%!"ơ!Q2i)F:! !0FRF (FqhHQ P0UC#R FCCS (FCcT B"VBBWBbZCyh^#Y0Cb{Z0#{XC#{CC{!FCb[(FC# tctCRFQFtt#F0F (FvI0HKA!J0BFAAAa{h0F E`c~!~bA!~ AA#%C#CC Cb:`! @ " @@$ .B "& v B Bv'#B lv"w Bw"Ol! "$0C`w"% #&0;h1 '0005C#2 (FCC3 %tCc4 3B"6H0BB7etBb!BIAK0#L M0CN0O #{b{JC#{!FCC{tCbtu#ctC0t10 tA!20AA30tAaBF0F{h1 Ec~!~~A!~RFAAAa#F0F ((F7FЅхЅ-MF(`)0FF&*01 FF+0 FFf00C#2 O CC3 FCcJ~ ~ 7C#~CC~Cc3I H0C#J CCK CcQ P0C#R CCS CcT UB"VBBWBbAi1E W 1k) (, `#acaf```h hK`!aba`j FGF3k# h"##`ci"iS``##aca F(F<`%o 8`o"o_o hpGpjFhB ,;,BoB `pj0,;#7 F`FhB!F,;,Bo+`0j9,;# F `a0R?B,;#`#h`jj2B,;` pG#F F`BWO,<,Bo)F`h,4`joChFZll hjl*#FS/,:,B0O0ljBF#7`K FFo0(R?,;,BЙlB+`j#s F`op(T?,;,BlB3`j#s F`op(T?,;,BlB3`j-AF#FF;`FlO2N FFXO,<,CEoll#B<`(Fjo8FF!TF%`F8#F`"FF@#F`"FF@׿#F`C"FF@ȿ#F`S"FF@#F`b"FF@#F`FVO,<,Bo ll#]B F,`,`jF##`L"FF@v# ` FF("F@f F #h+o7hF#`t(F%`0F #h+o# ` FI0#h#@FFMh@}j,h`3bc`iFkj[hiKG0#kjS``#b#cFjF[hh; #kjS``b cG(jF[hii G(j[hj F@GFiF+#j[h[iSFj[h[j+ИG( F@Gj[hiGFpGpGSXBXApG-EF FFO LhfhBѽh+Уh8FG# FS``p4FvhFFF0+`@``0P<Bc"KIH, F@MvhCԅpQ<BF Fm" K I H,clP4L#E<BPF#hB FF8ahH-Fk4F<^ԅhFj;!! FU#j[h[kC F! FLi{hRkj[hkC F! F8cl F#Scd@FF(PClK F!ZF!/ho:l;#qR7+8(F/FP{ic(FGF@jhIH-O F#iShj;(FG jhIH->;l _KF0(Fzkl#kd$ooto|ԅԅ-EFFF'ozT4P!0F@ F+77!(F8GE'0hFk[i#I#(F (F(FGo F 0(FIFx# "Fm IF(Fz(F"(F' 0@Gمׅ!p" FF Il1$h``O2Il(C(`o Fp ؅u-FlF+ F@׿ -MhFh O F *` * 鲛@䲿_պD_0#@]۲_I"FH+oTB F*'d(#@]۲_I"FH+om4؅_؅8hDhC[_"%@U_"U@!(ox8h"C[Ah@S\۲__STOQj(ڽ@IH+)؅pFhEh s1FD.(J%ٰpo$!˲2#` FB۲x[_"@QU_" @PU_"XUp#1#opG-MF@F4IF@FEF(_!$4(F! F(FF F@.C`O .ҿ &6!(F!(F2 *!(F  2 *VE *>F!(F! F(FF F +F XF*&(SF2FIH+o@FI8F'ׅ؅!-MhCBh[FF*O O hnhEix_#2xҲ_GOG ыҲ_2p_"!@U(FOQd; ]Ҳ_B _U(FB O&B8_U$ F#3z۲_Կ_#2 3r*#(F F((FyCF:FIH+fUп_"khTd *(F({jhIH+Ko؅؅-M FFChO2)xFhFC"O3v@5/O !U , SE"3 \۲_C_STU FJAɲFH F2 F/XFU ,U<Uh/o3OOAfh;F _ @_ _O O   O ]_vF1FE FSF?5}@! FP Bѣ F_!p xɲ_U6xɲ_A_pBxɲ_A F]xF(b6FE۴8 F"FiF(F F8-AFF Flpl` FLCIlchCc`:IlchCcc`7IlchCcc`3IlchCcc`0IlchCcc`,IlchCSc`)IlchCCc`%Il `#J#IXchCc`r!IlwchC3c`Iln(chCCch#Sc`݅ޅ݅݅&ޅ8ޅEޅRޅ_ޅmޅzޅޅޅޅޅޅޅޅ߅\مgمޅ߅Cl+hF-A@ F#h FkF;j+2F)F FAGhXip@ F FF#hkh+2F)F Fp@Go%ppFFF(FzFBДi0+ F1FFh Fp$o{FF 0!FH)X ߅ 0 p]7; EH %h,<,3B0 Fb00Q j,<F; 2$ H) FFD1FH) .Hh4jhLK4"(F+h(Fh9FBh H)!F H)$ĵa!0߅)5߅<߅hFk FF##OslJI#FO3cc#'``cCs;~r #`1(Fo%B߅-MFFF@F+F(O5(FAF z(o0F)F,8FF)F,X лjB+D@)F-H;:@)i%Bbh**0;E(F!i:Do KC* "#"O FOO! O$ F(H9o F F(&#0# FF(Ozq FED(UFJ߅߅-MFFFXFPFF8QF z( FoعFO #h F[iSE(SFDFiB F1Fi#H)-:'8F-3-""!i oSC # F FH)- #0#  F HOzq Fk(ѣo Ѿم߅څ-A>'&KFF"FpFK(FpFO(O(FpFP(F pFFb燐BA۲"!^B8Cܲ#F"!FRi@8 F"!I FFh(P<$/sjscB -(A8(sjscB om8hk˹kn[Ozthkj<  8l08@Ozp(] 𵅰FEF(Fl`lC}O2 `ecb>Il(( #9F9J c0F 9#9F7J e0F 2#9F4J`e0F +9Fe#0F1J $ f0Il#c-IlF#c"*IlF##d#(F&Icd&0F#c!I(Fl# dI(Fx!`fwFP5+hjhhH)iJIKB#cdo݅߅߅߅ ߅ޅ>ۅ5PY\مgم@wFhF  F@^-MF[F F3jFhkhB8FjFBI1 %+ ""O Ch O ,E=IYF%,E-YD@0=#C0jOj -oE %Cb( dcj(((cj0CC0(40˱0#C0j#bk+ѣjCb OJ 50CC+ѣjC-MFFFF FO3Fh#ccjcjcj-CjhhO @D+(O D0#C D0+h0hhCC0,0#p#C`#,0khիhhYC?@F,nPFQDJhK)FjhCzhPHC#HCwC3: *ObC@|RB"ch`l8 "BCod`;+[+ O O (.F#kP#k`/UoEjCsbj-@; +@SH)(hh@0(O c$0HH)om0Fx0+ x(D0#C CKVC@3CBCO 0F(zom{h;{hFiiaiB"#i` B":aB"zaa;+3+ " "!I#k B2kh hh.hYC?(F+i0F1D&O3#cLP6cjd (> H)_#i` "jCcbj[X # }ppG-EFF0FkF0FF0Fhdll 0-h`xshVF1h hsH)o@FpJqI-Ȁ ,0Cs,0((F,0*0CC0kl+0C0`K40@ cHC#[IHC@!`O@ B`WH(O8 PF(d(RH(om.3hrhhNH(OCc`)kQ)OSc`)k)#Sc`DCc`lCAKb``jh@KB"a#aOsca#`0l((+0jm#C*m##CCCsC0!F0FF(d a$b,hjCsb(Fjs'0dfklS K"0"f0PFCS0I?ck#0cc #bj#p#C`#b.oyJI|0F(bzom K(\مgم;irI x x pG7FhO00j-#O2kG( c hCS(k-O2#kG-EGkF/h'#c+dkizd+ OSOsi*Cs@O4 FOsk,O2#kGFjj@b(j,#O2kG$~cCBHC@qHC2HCsHCcqHCcHC@pHC BX(h(k,O2#kG(h(j,#O2kG<(h(j, #O2kGFj(@z0HJzHJz(h(?xk,?tO2 #kGmE  H4O0O5 h(j-#O2kGOzp'7pCkF FF#GC '2F)F Fp@7F FhSBjh!h[hkH1(`0L !FO1F@FF 9F(F"FH({ChiGFpGĿpF$N(FV' 4,O4 Fpۄ-MFFR(0+Ni/h&Ill%,FF2RE D(@!@F3rGF FqhO2Q:8F@qhOD?Jyщy*C  # y9Bݑ@)C$+ @(Co^G-A!MChFi+h%#` x"AF0FF5- H ȱ#F'00hbb8k-O2 #kG0F$0F F OSHCS4ʄTpF4F hjv#O2kGAaOzsca(Fp#O0d# #7ChFi#0bbh8j-#O2kG @ h8k-O2#kG h@k5#O2 #kG F F 0O0-ACjF;+ !H (7(FAzJFh2pJ!2tjL#"GNs@CjL#"!(FGFFM#"wj(FGNs@H!FM#"(FjGF( F(F$T-A'$MFĕ<")F0FF@7/ ((P-OSFF0F#GF#FF;F0F(PGF0 H 00F; F0FAo^XʄTsoAAoQAFhF8k. #O2kG hHk> #O2kGpO0F ڿ7Fh8k- #O2kG hPjE #O2Fk0@`GO00F߿-EFhFF(pP0 #O2kG hP0#O2kG hE8k. #O2kG hXkM#O2F kE`GO0FF0OC-AFhFFP0 #O2kG hP0#O2kG h=C8k. #O2kG hPjE#O2FkA`GO0FFOCO2kh]HxHuHr ֆֆpֆ_"h`_O2hZ`Bh* K I* F C_h0pGKK$$dF Y 8F%h+DXh5NѠhH i8@C8 ACs CCCjC3_ #d'Fch_տ_O c` (F'(H'O08(8j_OAs CCCb`C3_ #d'Fch_ տ_Oc` l_ (F'(H'pO08> F@ 8FF(FF_ #h_#h_#h _#h$QyyC#yCCyCc_!h0SzzcC3_"h088FF FPF(j#ybyCyCyC#zCczC8 8 8bhF0_C_Ouh0#h[h_ 'Z=#h[j_#_"hSb#`ca8sFF(F2F(FO30` ``l#Jl`h3/I0(F4#"(FI4("Ildz dH'##d"IlVz`d H'#cd poS\gwFj F`j!`j k!h FF@SjBF)F3H'QO0?&?)D8F!?u_2#2P_2_`2[_SC C_!S%i@9F(FMk__Or#hZaA3"hRi_ ;oci[ caA69F(FW2[_> Fڽ@ H'߽ J K D H# JD[ R;:[C#_cd?KLk_k;U-EFFh0FT%@"!@F&OR#i@F]#i@ZeaFhOb+D!@F@FaOBh+DZh#5O Bh!h a F_chcjj_rJ#h _"#hD!_O#h _#hiM$j(@/,d(@/&^(@/ Xp /Qp /J(@!/ s@wBqѿ_Ob#hP!_Ob#h!"i_#h!h_#h0F!qF_"hOE #F`h_E_R3ѣh_O A_!hq#h[j_Cs_"hSb#hD1_Cs_"hD1#h[j_C_"hSbjj`hHYh' _CXi#h]j_#h% _z!sE _!hJb_"h0_Or#hHa&d(As 9-MFFOaxF@ d 0`@YIZH'lo (F#h__#hO (FT(FYFMH'P% #h0_C_"h0_#h0_(F/#h0_#_"h(F0c*?@y0_"%h* !h;hB7@3_Or#hah3ZB??XSB`7780_+_78P_!?=?1)D8F!?0*F9F0hh?+ O GOG_w_"33(VtpFF/F(H'$ FpKIbKbcK2F?F0'z F%0 H' F(FQ-EFF0F@!FF_ a(o (FOq@ R`Or!'Oa@ EF:FoIoH'Mh+DXh=Ѡh iOb!hOB+DhPF+D%Zh a#7P7V@/O Bh! k`ea(EckOzw4!(F lxC&}!(F`lxC&t#h[j_C_"h Sb&A7F#h[j_# Fl h!b.F(k`b )dK"1"4Hb`'"!F(qh/H'\(F&B,H'% FO &*+##c`#F!IlFIl(%b2F)Fl`jjba%##8*FIbDFo8F18Foo ;JUu-Fl`( e(F FI+ FIFC F_F#F(F I( F( FCoNӅhk#opGFpGpFl F(" F1I4(F'Fx*< !+J'l\F(/%B pV%jFJ h#FFPFX<#hbhhH'5JIjRhRhK*h!Fk[kG!K {8hkkSo%!K O(!FG؅\مgمhkhGo%pG8FhFk[h;G)FF F'T 8o%hklF`Go%pG-MFFEhl [F*2"ٲ 222X2;h OO9FlJsh h{H'6o8F"O uJuIAFPF*BIsh$ hnHkJkIOBQF FF(z9Fl`J3F$9FpT#hbhh`H'1F FYJYIh AF);FB1F FhV#^ O>O@1DIh3 Cо?J;$#hbhhCH>J?I_(h@Rhh(eп_hh@ * ۪h h\@CL2_*hPPo X?qF3  V#O*JH ((h P JH((hNP _O  8Ҳ(C_(h'0\مgمX-AF FLFeD#hbhh)H'$o 'J'IEh 1F F B(`o }`AFJ3Flt`AFlJ$O(lAFJ3F$L@$#hbhhH J Il J$,Ch`(\مgمu-% F7F F@&#` -MFF'F,8F F#F   U Uj(FF(F}F(F!F0GF9jq V,dBH D)j%x(FFoo%-AFFqF`iS8F@Fѐ$05j8FFiAF8FGF3j{u 8F0(1jKD).%; Fo%o F8(j F@Go%pF F)0j#)F Fp@Go%p#sF F `S DFo tXj0F%^0*F!Fp<F FFS -AFFFhsh/+!Ihh%;FhiK[( ` 1P(+hiF(+Ihh%Fhi#h* "A["1W+#h"hiol!]!]F` I`h%Pj!i(  ! F(+ rpFh0F:hF+ jpi[hi(#i@iS h+ hi(#ih@h0oF F IFph%Fj!i#j!iB@;h;+Iph%nPm!0FF F- % %ForlpFFh(Fh+ iy#"iBQ#BQB op3h(ۡh0)F"ihip@wFF(F( 0((9ohL9F h%$4ohL9F h%@$4ohL9F h%4`(FwchF+`Ihh%8"K s``$4 " K#F+"Koۆن ؆l׆׆l׆F FlIFbI(l ''ZG+F"1F FP" Il`" IlF(a Il(a hF  pG hF FFo% F(F|F02FyhH& F.(i%$h8 FF*FF F8@ҿFF F@F0iiBooF0ihBoo8FF F@#`)F F8@JRo8ׅph )F Fk !)F FhG 0p8Fhk FkhG  p8hkh !G pGl׿8lL8(Flڿlw!hE8 @BphkFg3hF0L"!aah "%# K)F K K K  FG(p2222 FxpG8 *PD8(FirpGwpG R hkh"GpGl`.M0F3I#|F0F1I|F!FZ D`  Br :!%Q*F9F0F9F*F0FF(0FP8F%DF, #X!F *(!Z (!Z (Z F+H%F *8FF<2 8&0FBа_аOаO аaO а?ЫFH& !F H&LP0%O@?LP0%G- (H&3UpG Fh_ Fh _Rտ_ do h _h_o hy_" _ __@B _@r _OB _+" _ __@rpFF+y,h+@#Os_0_#q0(__D'0_#0 p8FRF(F,C `lJl#i8 q 8o Fv#Khj_ o eCchCc``h_d %U-MFNF@X(F 3F +h_jhCa_B_j`jh_Ozroh_:O0 #{C"Pi_LB#_ai_H%Ozsi_;i_C_ai_Od Bp%j_ +к Ozs2k_P;ѵ3k__3ch__`#@_`_j_*,#C,#63Bkh_C_k`kh_3i_$S(R*KN*3F3#{J3˲zOBxH# %OuJ:F_sK;ForI9FopI9F9FmH8FlN>F/jOF/F?FOFOF_F_IQH$%8F [H%,3C'#B RKRH%o3db#_H`j_+FH%9FEH% OP`AHeo Ob!(Fc0cP0_DDCsdsl_e P0_3`3h_0_`h_i_C_ai_$K2j_;ѭ7_Kai_s vhȅ#U &,@-059?DIO!J&__OB _N`_j`jh__"3)`;_`h_+h_$3h_(3$3D3vmMb @x-MOFF 80_8_𱃲ӹ$ò 444 4 , OH%u(F$$"5(i./j.j2FO q h ^?I3C ,F08rEC C  O E+BE0 "*!PFP%#PO  iOa` _880_,FBu80_ЬBH%O5FF1F8FEEOzp$\4Ba< 8F65Fb?7-M G$?FFF"! FFx6H'# ##pcC@q3 qk%s"FYFCF8F(̿(F -EFFFF(3FOr8F$ Fu6*F8FB-M G$?FFF"! FFxH'# %#5#p#rcr3#r3 q@#qk"FYFCF8F(̿(F -MFFFFO{(?+FOr8FXE&0FDu<5"F8FB-MFFFFQF(Fsk# G sFRF[F1F$?goF"! FsQH'##p#"F9F(F&0F+@w@F"AF Fs1H'##pCF-AF FFFF@F{K#*F!F3F`*F3F!F-MOF<}F"! ')"AF '?3"AF8FH';#pOs $?:F(F#FOq FF# " FE"E Z #" F "XF )#" F )" PF FOs0asa @CO21 CSD#s 3#03 C 36I@OѴ մ@OѴDCs 3+KOB Aq @OєB 3Cc 3"!8F:K;`33К*+"ٲ 22FFX3>3;s#:F(F H%3iRF[FH% <}"'FZpFF1F FKF(F pO1Os FJ#IS(b0Fpв@@COѲ0C@0AAPc!x0z C@F8 FYB#F F3J F$L DBF "p8:- \0[\- *pGo%pGo%pGhkhGo%pG#-EFF `FFh,=,3B, oo(F.hFBChCE(FȿDj,= KS pG0ԄFF$OWA(F$ <%(F4,KS$p{ (h,<,3B FChFB ѠiB Fr(j0Ԅӄ$F%F)F0Fq P;z;4 R8Fx5, WF({+e FosF$!F(F@ P3{+!FH%00Fa4p7 F%F0)FH%L F07F FH% F)F FЃ H%o F0((F'+{+ohkhGo%pGFpGopF FF(ho FphB(F(FpFh h(FsF0(h0hB Fpo-AFF FFh,<,3Bo FhBChB@(FjF h@i(] ]F0!F@r-EoF;hF<F0F#CiF FP8FCF*F1FGBF=F(Fci2FFo%sFF @3F*F!Fp@p-AoF;h F<F0k3F*F!F8FFA`Go%sFF@3F*F!Fp@ѿp-Ao F3hFkhS*F!F0FhAGo% F&X>( #`oosF FPoh,<,3B0Fp FhBChBFj,<(0 -M ?FFFFF,/RFAFFX4F% sh,<,3B FhFB BhE8Ft`\Fjڣ F193!;#A19!!9!?Ea4%%a`argD``-AFJFF!ChT$#/FرF F1F ;FiF0(FU F o ZׅF FPhT,i,>,3B(F F hBj4F,! F- Fm(F MdFB ЦhB#hB ѦiB&iBvDvEӤE A``!!`)hL`,`< J Sh3S`$h!iPi3 Jh3`tކ`ކ-MF )OhFBF/:ijh B""JThJ``""`b`hi9`aiACBi"ai0FWap FM LF(2F #aeaJhL``h2``ކtކ-AFFD@%hDEѽhBhB#S``#i#`c`Y FVJh;`,F-htކ`ކ-ELFhFB#iB#`&a#`c`#S``i-(F*PEE#`O `ކtކ"Ik#J`S``ކh__Or`H$o48F F#h_8(F#FJ)F F`.3H$kozO8@/<,. m8@/g8@/ f!(h+h_Or `Z-ACwe+FOFFF@0M(@/K/V (O F)O)K9DI !.&J~ :>AO> o BB O% w s ;A|C"a#h# CCC&`(@/(@/Ѧ?6ɚ;KCpF%$N0@/0@a/0@/0@/'0@/!0@/,`p0@/0@/0@/, =%D$,$=%D$pF F N0@/- 4 x0@/r0@/ Fp-ANFFF# FFȹ8FAFF8FdtS$0_1F+`Ao𵅰FFF1"O8@/ * (IH$O08@/8@/O##2F)F{F2F)F_!(F)c^+l_9F#`@?o|OF FF# FFK#*F!F_ ! F&b. #%9F F@o4-ANFFF# FF8FAFF8FF_1Fdt@$PAoKhkhGo%pGhk[hGo%pG8i FFCjh\C:i*AB 8#[o%-A FFFFFh+ @BjTCiDm%nB!!Kh+=-%F jj>F%kREҲBj1)DO`o o%;8FtFip#e##feC  ce8iFFF]Dji|C#s J@kG B!FOp`c( o  FAhQh"h+OR[B@`#`70FjhF0`(F BihH$o0#`  F0@hF o %@"h  !F%8 FFu!8 F9PL)Fb FGb8%!hFkC F0 FB h+ИG(iiD?1!?dFFhi)i DB F@!Ͽj jpFcF(FhFaCj3h@H3Cbb!SC(Fa(F!khJ$J!0F$#Fh!i(F)1Fwpo #o t]Cl!nw)$@CmBؿ1mBؿ2nKCemZCn#dpG8F Fi f8 " F$4 `8FCnFmCfl{ ! J$?##`K%d#cK Fcc8@I##YXXXŅhk$hF`Go%pGhkdhF`Go%pGhkhGo%pGFFi!n"mn DFd"e&gmB{"!(Famj(F9#m"n#e!!gi@h+ "QC KXZXChIhA!AFpG)oAd̈́F FaCoF+0FYoF/8-[-7-nm&nglmH0&~#cg oGg {gK'D[]P#K-cg@-٥A +R#VVVVVVkUVkUVVf-Xm-ѰiFo7'D4B FD)))ѕ8A(F8`b #!n m&nFlmH0&A-F-E=-"C-D r&q F{D-DiF09*:+\i!i##endOiF{+C!n m&jF0F8%) )o809#Cɲ{(9)?c90#Cɲ9 iwU9(F8b(FbH --`+]R#kUWWWXXV-Iуg#0Fv3hkh+?0FGEnl)F&RUndBخ0F^0F3hFkiclmn#Bd !i30FG&0##gm;SC*nd+mH#+e0F+FmlF0F 0F"+F0F"ml(lnDd%gBl FSi@!*Fq mdh<!i7O0 8FL F(F&(8l Fi@! FFFxFit+nm ;BF dfC;BԿ+e*e*sFq FFhh#b!FFh#]1FF Fp$O4 hS `hY`xppG hS `h\`xp hS `hY`xp-MH0FF/;xB+{xM+9FH#o O||}D$;}{DD{}hDd}C#:~CCz~Cc:{B"{C#3f)ؓK@AFH#[BE*%Ѹи @Ak p< .cN2C!;B*xѸrѠ}۱Gr+Bzs[#skGrBrs[#s#DBFzkBFzC#9{CCy{Cc;D kjOciDк?к@EkkC# CC! Cc+@̀0CH#o\$ AFKhBFmK??OE2؀O[X*(BO ?.p X   BO+IB*IB*IB! F"KX*r!H*آ\bBآr2BЎKB𠀍H= 0B"pDJBp  BBQBB@BB(@b F!F|xKBأ#cBo4o4LcCdC@CC@#CsjKBa##BCcC@CCSC`JB$آob:B݀ tB_rBWKWJBpB/@ @TNKBԀMKBǀc#sBdC`L SCOC@C#G*FFvhx!F F(T`hcCeehh!hhGF``(zOQ@ 0`chh*p=J=Oakh`OS`;he+hh!(FG h;h FiGY;h"Yh@7khG0$0&0F@#)Jw4x+8(ѐRx-c?C;BO#<F(Px-?Cx-?C RoҸPo (Fo xpFiLmh0F!h (Fchp@G4D -MyyyDkG'KyxehF&xB"{F#sK+aOSk`Ch` x` @݂Hx8(؂D+@͂ <ƂzKu! F#hQ[h:F@G00+ODsOsB0 #B0G0/("(hSBj`""{)FbAs"hiG#+b0+ch!h #qp3pB0B  ppD0 F3qE0sqF0q#h[hqx# /:F0r "sr0+#h[i+KBKA K [EO O _"jT F*NhBoD Bл1Aм`ch "h@q#F +`p0 "q2~bqr~q~bq~*8""rhRFa1DV(/@ @B!*pp-FF RFSD@    B @xxR" [xph3FS(/@ @B6j >@ 0(0@B(:F$0վ#O 0" XF0`Khhȹ#FSTO < B?`h"FR(?@;@3B$j[F2FQF(ݷ[F2FQF(ݯXhl[F2FQF(ݡ0+@9ch"h #O p2q3ppppchOh!O 1qO OZrrr#h[i+4xN.ch3y  D3q p#p # 0#0  #hhiG00000 0xxB":Os0+@h# FJ#FSTo > Bod!*1~B6j+ hhSx+ ѓxC#lCd\/*уjG Fd!0iPFG*_1)@~ I!+5h*h /:F("+'h+a._Xk(ZЃj +V1FGF+h+M.KXk(Fj"1FG!+hph*9+(+ Si{F)xF%3CT(@8@BЅHPB l@800+@k(Ck+MGo^"F`0 [(?x0+>i NpjF F+: k+7Haj@(bdJd` jKG(cl"lS``##dcdca10ԢhC1010hC1010Z"iC10pFoF0(QcBo0 pG-A F ~F)Eh+BFRT? ; B''am e("bab ` Fh(,0pGcj"jS``'bgba+h[i+ (h,b0F~Bj!j@;@Ei *hQal@;ooF`0+3ز`opGChisL#h[h K` `H##`oxL#hBH##`xFOr!H8!F@"H]uF pGFh(o(F.M.N(ps F(m(rsh0F'H8 F((t0tt!@ qF( FTo t"!K)F+`@#+#vK F`F(#hHj3(@! oI 8F3s#ss;h[i+!8FGuՖo^pG"KppGtK`F4F FIH# FrH?Fh"h!iiGh` j8h2hLiуh[jG#cac`#h28 j8h2hLiуh[jG#a#c`h28$F%FOh2+/D c5B;h+$!!H;h4+ #3 ,;`F%Khy H H H#;` hoo  8FK!"Jp$4?(O6i^`i`{Cs`h(?+inPha`2`2iZh*`2+. FA(qvh\#FFT# 3@ F0FD{G{D$B5ՖzyB/ќzDyB)_{yB#y(-`@ T{HyBՔ{yB ќ{yBX|xXBXA  FUO,<,Bclj'FW4P<BClk0F<0 hkjGo%pGFJ[ xppGF0 hkh]$`6F F!FGpo%-M0yF:hF8j,B(єh,<,B:;hCh,<,BH#5#pcl FCy Fljcl FCy F_j4pFF(FiFi(F,Y,0 i F#`p@Ob F a,Yp`pGhn_#C_fpGCh[h_Bh1 pGO3 `pGLP0-AFFFF4h_ c<@DE=O0 -!$ Fhh_# _h `hKOA0CFH FB,##-1ѽ@˿ -AhF FNh hJ[SCHi@F@0o'n6@@ Cf+h!hXh?X``(m!?D(m竪FF#00Ch F;+  0 ~SChC` F?!DF!? FF"F N#F@OT4@BAa 2+D*)FHEO0 h_#_"@;OAK 0H'om 砆-h_C_OB@;FK0H omOzpt 砆`pChF^h_hh_(%0_hO@A`h"K0 Hp@޹B%1_ORhF`hOS0(phZh_B_h0 DZ`砆}@ -MF, FF1FF@FBڐIH$ F +ѵO F(`#VSC@ Fg`(f``;D aF@ X`a(T!h!`i on2@"HB?FiC?1!?FDmh?1!?De`iD`$1+=F#i `hCE? iL(FqGh(`ih| Fys`!QC8B O   `@ciL!0@F1F !) O@T9 L .@ 0.KpaA@@CF0S9)FYF@F&!pP Y`)AqpCA`I P@a P@Xa @P@a @@ aP2D;O hC(?Rj$13$1@FFF-EFFhFx$1;$1ozpO4 h'BAF3i@FhA;h$1+ ݨhFME H'O4pih0F FF-A FFF"!F(F`F@ #,A3Ozs1F(F%F$B HomE 1F, ( FO0o' FF, l-MF , #? FF+H+!! ^H0;#CF@ F8HO0 `"!PF !(Fo n9F3@C0 0XF+$$d {KO8"CO(CphCCc,!CC CCB *WPBBBAC30OC$0QFXFHD+D2@#@H H[  {s 0 BoBFF!PKA @FC CAqAHaDH "CK"(FH,`l``0?H(FWGF+P F 6C@ 4D@+H{"jP)IZ`'J F4`0J3d3F FPF (F+DFh[h_?_hS`hh_&C _h`OBhF K0X0 HKc +A8Ozxd< PF (Fh _@EӀ' @3ddhh_C@_h` "hBsF0?F4Hh[h_տ_ "hZ`#c+ ?D!?X#H0F( #&@+2 + +/K@"# #P+# !@n"@ Cf9D (F5 OO0 @##FF,F$սO0pG-MF , F+(h#B@Ɓ#0, sx7xFG'B3z"BУ/ F<1 1GF0O0JoW%HBE@#BYB3Bطoo#9#9@#3B)h_!*xxB"*ڀ**@B!~q!  B@CS_o+`oEУ/RР/#'0 xxC# *"*)*ѡL OzpiyyE%]E]FB=F4-*F!F Y L' 4D|۲+؍JR#@JVx)+~L'xxxC#`'Ѩi!F F *F1FF@F#t\FPF.F#HiͱHg)FOzs J{ HP HM%FO4B6:ԅĵpF+F"hhhMF Kh.Ahh FpHO4$約Ѕ*F hXh'Hh8 O0 *FhXh8h hH O0_*F hXhP!ih8 O0 pH&$ M> H H p+hC, :!,!jhH4D5lĵfHpG8JhrBЈBpG7%L#!hqh( Hy !hq 0)F+F*F!hq iFb@ ]Z F`h JO0 KFh(h0"[ O0礅 "!Fh F@-M'F h! K[li h i  D@ [BBOAccC /+ sO0 [BBr;B22*;@+6%O F "O3% B3[FRFM(#` Z`l 9F'9F"F  ZB8>F*/ BB O*8FZ)BF DA2DCD3 C #F>F9F[FRF(?@ FF#D3 [FRF(?("!BF|O480F Hhh HhP EE0O0-E FFFF(QF HO0X2F F+FphFFF+ChBуhB F)F@ F `@*F!0FI Fo pf`` 炊jpGFhXpG`X1pGF@*@pGF@)OhjFpGF@)O@hSjFpGF@)OhjFpG8F FDCB08-MFFFFF@li ?#?@3  ( & CC'K@h Fб+F;`cCvE>hAH#HH 7F < ?&?"!F3FZFQF3F"!Fhl"SF!F"!F3FZFQF0F笅FL($hi 4@ ,  @\IJB#CT C#:D xB C p@BXCBDZ#@۲O0礅FL($hi 4@ , @\B#TC#:D xBC p@BXCBDZ#@۲礅KhjF(O ;D# x CO0 ppGD#@BXBB:@۲KhjF(O;D# xBC ppGD#@BXBB:@۲礅sFAjFKnУj"h1O0U]" W")FR *؀p : F-MKh ThF)F@ *F!F]h@ )F*F!S.+𱀣+ƀ#k3#cQF kFoEiB𚀣j!Fw8F/(@𪀻o 5%c3E?O3#c  iByңj!FU(F((FFjhS'JhjR'  * "jS'QF#O xF*мo3@O B phzC#c3@*ѪC!;@* `jhX!;A5*D`X! i3Fh(AF0F({0FO0y!F)?n  DQFFe{8FFjZFS%h # jYX*F k F%k-0B i3Fhx(AF0F(P@*C;@* #`jhX:C5)D`X0F k-MKhjhF)F@ z*F!Fh@ )Fp*F!F/.cj[n@0++k0cjFU!F(FFУh2F + k1FhS( kBFS(kF(0CE i;F h(̀8Fih(@ŀ@*C;ꁡ@) bji;a8Fx0Fuk(2BCO3ciE𓀢j@* UC+!F(Fl Уh+  2Fwk1FhS*kS*>K"[FFЃhFBx^FO @ Z 3c@03@0@*C;끢@* k@*jC;@* kbji!;a i;FhCh08F/(?S8F0FO0PO    FO FH礅-M F$  B@F,𑀆h@ 1FF2F!-<ѵHFyF,?FwѮH&0FvfF,F3@HhSD`AќHME0FXFZFQCSDD@#F(Шi p 0 9F>F(AF FmjF0FFQF.QFD0F FOC4i 0"9F a8 K FFho@B-ML#hFiF 3FBli*j^Ն\ #h$O i(5 3@+FO 23 B.O2mF2B XE*! 1Ih"F@F@PFuhBhEF!D@F" HI@FoE ڭh@F (D2  U+$@F,OkN ZE]ۺ)!F@ F"F!`HO0O2]K`]K`pm0@B0SF"F!0VHL0BPFUO1#NJ@ `!F3`0#F"FFIFH@m@03h K S+w 1YE ̀%!F@ F"FQF1HO2+K`+K`m0@B."F!3h4 'H0BPFO1#J@ `!F3`0b#F"FF@m@0LP-D!F@ FF"F!P͹ HD礅 6lO2K`K`AFLF[ @0B0+F"F! H 0B(F~O1#J@ `!F00#F"FFqP-@3hS(0@00S"H3%!F@ F"FQFFтHO2K`K`(n0@B."F!3h^ zHܱ0BPFO1#rJ@ `!F3`0#F"FF@+n@0fM-!F@ pF"FQF]HlO2SK`SK`3hO#O3 FFA[/)";'B8FVBF@ DF!HK,h8FD9FF F 7IF7H:Zʱ!" F!FF{(LEF FV((FqhOB]0[HV(?#V(@FAFFPFfcOV(X0F[ FX(FU%FPEo k-MOBK h iRh 3"E"AF O78F hF)F@ F*F!,S8i#F!hCh:HO7 F{%.FF+٢YBtyFB!MعY/Hh F4(Ѻк0D0 Fq(hDBٲHHo PL hH#J#``O2K`L hH#J#``O2 K` L hH# J#``O2 K`8 M L(h8!h)qY#+` h]##`8@-M{`0FF`+@h(x +rЭ   (FCF (+ی!@ F"AF +h#`i {+H+FZHNh+D%(h"L F G#0pHOCи OrШCH7H70Ki(h"%(#0&и-H"-H O +FOh+{h+1FXF {hh` 7F.H/ZFhH* FлDhSETO"##(FRFCF@E@+>1F H6.O3-M FF``# #0F4B1F(Fx(FF;/+лO /!(FF0FF 3/*6+ !F0Fh` UF)F0F 7F;i+@@Jh3+`!F@F0+A @ 2Fz`rF!zh-=%!F@F-+x/+0F!F*Khv1F(FqF(F!F0FК0+{ih`;ih`( ;* (F,0+"#@F(2C(F瀅7F#% K` 0(,(  ,(#N F1h O;`q#03 h0<` h"(1h Fq5O0礅p'OaF@ FOb!/ FqNNSs"B!l#` #X0`#nմ0!#r F|Ax!T4`pH F#3` p FFKEd"h`Kh`chECli  @% CC@EpFF FFgI+F"F h@l𽨅pFElO`iiNObi#Fp@BؿcOcBjF!O`'i=B&i5B(Ӡh#jiCCj9#J`J`)F FhF(F!F0FwhjR% a)F FP!FphkR% q؈Ԉp3hiMUKB@F(F&)F b@ F*F!1bֱ!j%ihiJChC3F!WFj-bO0p.(Ho &phF1F@ |F2F!5KjFh!D"hFFF i+F!hpC#ah*F(F%`j bjO`n!#fbjOc`jjebk{j#b@0c#c pP%jC%`5ijB#b.FP%kC%`5ikB#c%.F礅-EqNw3hFi# 2@Bl`iOa@a@ FOb!ueb-Ā(Fȱ_F3hZiXhjhao##a0VHCO5;i@ 9FF:F)FCb..FiB,'iB>ض1F@ F2F!.c/&iBB&iBU&7FiBf`j#BB:F`j(F@ AF,FBF!J&pjS&0+69F F!Fj&i!pCS'0h(7@ AF8TFBF!J&pkS&0+?|61F F!Fk'i!xCS&0h(?f61F F!F6Do 礅?-M@M} +hF #?FOrF! ++ @@ !FF"F/L!|'`/-P+HO3 }$0[nX$HJ" 0FF3 !h'(@#hjS H F3% +'F  X$0hSEHr+hjjhF1F@ 2F +2F(hF(h(F C X0 X  O<- # `&GћKh hFF@ GF1F/@׀HLKhjhF1F@ 02F!+@H4KhjhF1F@ 2F!+@zHyO B@tFpFF Fs!FFF:PFF)FZ)FDPF hh@ FF!]- i+F!xCh(V9F(FF(Oh D9F(F(DѣkBFS(u@*OC3󁢊@* bji3ah!F0F0'i!xChE!F0F#Fap`RpF(.H(FO4XBAFPFhFoFj2FS&PF1F(F@*dC3@* jjh3`0B)FF(i;F!h0AF8F`8F椅r-+𸀯h@ 9F :F!+?ٮO-(i!pCh hP@FoFF1F(F\Fj2F@FS&G 0@*, C3 0@* ,0jjh3`0B)FPFKF(i!xChj09F`&#{(oFF1F(F Fj2FS&Z @*C3@* jjh3`}KhB8F)FF(i!xCh(9F=(qK``..0h@ 1FK2F!+?3.(i!pCh#E.8FRoFFj2FS&8F1F(F@*<C3@* jjh3`0B})FF(i!xCh(o9F(i`f0+QF@ FRF!e.X/i3F!xChO hW0FKX8FhFoFj2FS&8F#1F(F,@*C3@* jjh3`KhBw)F+F!h(i!xChE(9Fe(]&0FkV*0+Fo BjFQ"(F@*C3@* jjh3`KhB)FF(i!xCh(9F (ѨK`  TK`3"=U:hFoEj*FS%0Fs)F F|@*C3@* bjh3`;hB!F|F i!pCh1Fȹ=`3(FTQ#4000@0<0,?%,F%Lo <+F ' AF @ AFFBF!),c` +@΀J#/@ O#*FQF Fc X*h0@ SC[ ap9FvF:FAF-JO0F;h>jFXFYF Fj0FF  0Fv 0pCAF+F (F(O!F  (F\(ACli;hi 3 CE(CF h XD FO3 B?3  @C' A  3@ Hc F Lg hd(Fa##`(9H#3 " F*  5J Z(EјF D DhD3CF  @C' A FJCDGF3  @C' A )O89KhjFXFYFF8@FjvF  D@Fn B >! (F!+FpC 1F(F (= 1F(FI(/& F4`0`@`<`(F`RFJh;`ԈpCV HO0p#*F8H"##V!Gp FF)FF# Fp@/$F OWkqhK ЫhO|2h 4fd,M$.FV;Zh2N$7FW;Zh2$V 4U d,# J` J`" K`h4d,h4d,簅@؈ԈЈ-MF&FlO "j3B ;hhX#0F@ CF!6;hX#0hh)Fh hD;hZ:`X#0Z`o @؈-MF FFFIH$oJd#FRIhHСB#;+Mh+hF@ X#F!z+hX#0hXh1F+hZX#0*`\` o Oc@؈-MFFBFEIHoL`#hX#0sh@ F#FF5#hX#0hXh)Fz#h ZX#0"`_`o cԈ-EFF'HE!@ ~F"! H&&`f`@ QFmFRF1F%`9F (F8 Jh+ K Ih ```T``܈8 M,hD(hX" K(``K`8 hdhDh F܈p KhO0phhBh"B[hX6B2 -MxhF1F@ 2F!F@ AFBF!FvE(Fl0Fi".%K!h"C'i+F!xChO phB  XF30;h "'i3F!hxC]h2FXը礅( HH𜹭-MFCjF_ngoцh@ 1FwF2F9Fu@ QFkFRF9F>(Fo "iK!h+:F9F9F'i+FxChcjnY<ո]HQiKO Fkjoi\Cskb;"F!h0F i3FGC!h8Frhih^ыB?@F (F0F @HOsai3a`jbj!nO`CfbjOc`j"FPh*FF #aE@h2X FSO љBaѺXFO mo љBѸ0F3^B?\uO0*-M#\Jp`\JF`[Jd%`"GFZLh#`ZK`!@ iF"!HO0!@ VF"!"X<`O3XK` `Z+S`_LQF@ 2FRF)Fвh#hF@ W#!F)F#hW#0h+CF)Fh(FObqj#hhW#0AFh#h@FZW#0"`]`x k( f8 @B#hQF@ W#FRF)Fe#hW#0h(?uObqj#hZ"`"W#0Z`@܈Ԉ؈Ј-MȰ'CjFmXiO!y9h"K;` hF!F@ F"F!=!(]"(F4ih+F!`C7OsgK@ iAFpFBF!D(Fd$^MU+9hRhK2^9h"K;`FhF9F@ NF:F!,[PHTHO " FHK S+Rh2Os`"XFK`d  :K8S(0"[h `OcK`h"F(F F";`f0U,ah<ьK!h("(FL7ih#F!xCOsK@ iAFFBF!O FEz "8Fh:Fr F38FЈ;9@ L DB;C@۲40 X@LDx B\B;0 hiehS -"DCC3#Ca#3a0 h[j` h[j` h[jC`#8FJFh FO08Jh"F)DB Fd숇pF JFh FX Jh1 LJ$h&DB HCO0p*F--(d숇與{F۱iZ%kChYBhD:F)F0F(O0j+#s h:F)F0D()-EF FCh ++]бo!F5H +ч FJGCF+hS$+h3)KB# FYCF FiB'h B(FDBRF9F@FG(akh+ + +*hDYS[xP\ H OsBد FGGCGF( -MFFFŠi;?2F?"?F2F ?(?B F 7F BF!XF{`(FO0AF(F DdB F*FFFXF@EѲDBCDF!?2"?F2F ?&?2FXF(F"F1F(FF*KFhFFO4 FYi@ ?1!?F(F! (O4(Fc@")F F㊻ #@!F"3`8F3h4 +O!F H$dB#$4 H #$3`"!FH(#dJ S \ -E F FF(o8F`h>I (`bsKhb 304P6 C#`b+Н00.+Pb ,0hE%-0B)F'Hn%Hi?O2!H (OC $Ѩ acbO3a#O?1@ !?6 `(4`cjs``cj`#sa201)F @ b @D#a숇e   -M?FFFF/F?#?F3F F ? *? BF 7F)FPFsRF!0F{`({hFO0 FDBF>*FFF0FPEѸ0DCCDF !?#?F3F ?(?@F0"F)F@F{BF!0FX(FFF8hhŊTiiCrDh , kCi!Dy Ho8jdB(,FicC)D 8iF "!(F#+pi# F8@ɿ 8`aK>@ p`E PaS`F`F#a#b F "IF(FB8(O0+\.+oOT)F0F0FOq F,!F( -AFF%NO., ,!F Hx# Ԥa+@5B(F_$R-EFFFO O#FEFx&K;`(/*\*FFxF/)F\)FSF F8 DEхB L#<`DF;#x%F +.+kx[.+ѫx;(F"8(DB5`x +.+)-MChF+FFS + +\н#@FYCF FiBOh B(F8 D0ШZFAFPD(a#skh+< +6 +(hD/00OAG/Y/+pC 0+h 3C# 焊@FDDCDF焊@FDCF+hC$`+h#`  0(h00C3 0(hZ!R)hZCRx۲ 0(h00C# 0(hZ"!R)h 0(h00C 0X-AF FOxO,kh ++ CFOcB!F(FF (FA!F"(F)4F;FpFFL!F(F4(F"F1F Fp-MFe ÊHah )!  !  AC%ѻ лch ++@OsEOs[E~YF Fch +OS pSCF:FO MMMN 2B ahr8 )0Op@|)`FE-AF F9chF +!Or@q+ FBEٸ@9 ++OsOcCE@.FG(F*F3F )NOp@u)(FE$[b2$FABA5AF FBF,ch +!Or@q+ FZE ٻ ++OsOc[E@׀FEHJK 2B A  a c BA>  cC_УN3h+SC i3W@Bu(u-@8F @ˀ SC 2FYC SCBYDeD=C~M*h㊘BF:F1F(h*h㊘B9D1B1  CBubh *}Os@q* FE$'=FUO1@ 0`(nWHO0c BAMM*h l㊘B(h2F8D*hv㊘B cWDDDLP6K1Fhx3KhT㊘BeDD3 BL#'KAF FbhF *Os@q* FB)F Fch + + +opE*FAF FK@uOucu7%)F FKX5䈇 ch ++ ]-:㊦ifB3DaKhB+_H(AF Fbh *Os@q* FB?AF FGFFAF FcFPK&iFFFBvi F(2[A2ch +Z+[ +opKZFXAF FBBEF0i;F F(î!F!c;D=ch +,+OsOc[E1]F(*bh *Os* FObZEFCFJ@{O{ K KE 3o@s與3 Ci?3#?@3 N ?x"0`$?H "F! (#O53`(FF"IpF(" I6("IR(d숇O ʅʅiFF%(Fhh֊AisC9Qh )$ijDB(Fu*F1F(#hsC;`hci h`{Ch + 1`ÊjKCB##aiD(`#h[h ++OsOcBKiFa [ ;aax+;ai 0-M#F<1(FFbih+bijbbx)z.*IF"x '@,?a#x++#*D,0a BS/RB۲њE,,<1x"!F@F!#41CFF+#{@F#z.#>F;"0F#{!0F#;q7F;x6":p,1+@х,!<1+@ }iF&kF  6. Ui6 .! 1) & &  ?RAF2FiF@F(F%F(?AZFb+#,1<-MF FFz+x.FF5/+\+0F8o EF;/+\+ci *$I0Fȹ#hZj"[jc`#3#a+x+* I+x+o F(<XE8XF<FF0FP<1SEBFQF0F(iz!F F#7 pF Fv F@(F< ix p<1B1F(F(-MFO F }Q 2OC[PB_&lF5FO "! F#`F3yBFApp2+Ђ3F+" F3i"DssZC*: #F 2 * 20"w{" F"DwPw3 C*#6w0[ "5r%p  +E@#pu(F232!F "iqi= <[8Fi+o }8F(7%`aFxH(Fsa[ ;a0o-MFFF)o F  " !8F.!0F3x.+A"8F:0F +_#0CI;FRF-1F(x%*F- A" F1F+# -ݵ?M+O<_< W 0  EE0-MF0"! FFsHko $ F@F(FiF[hI(F%XgI F(eHHo@ bI1F((@ ]K)F` F"VF8F)FXH)o F)F )FSHizD 8 0"9FXF@ HIFo wPFt-u-+)FCH]F!FehŖ#L@ YC?1!?(O3=FPF,(5%hijhY *(F?9D(F0%HoQajhBѣj"jaaz* F( FF< F(xk%@= F( F(o!o p # @與&   W -MFڰ0"!0F F( "FQF^ 8FRFP9FF@9FHJ$o %F @ I1F(1FF(@j}K@`!F"(FRFF!FwH%DF0h(F FXFZ(FF8kH\F o kic (BF9F(F o aI(_I(o QF(F!F(Ѻ(i/h "! FP{h +OѣO0 ca "AF F @ WC?!?FPo BF9F(Fl(г:F!" " W -MFFFj8MH 7F?!?^@1> F DB@I@H>C ?"?fD{`CF"1D(2I4H{hbiB*Fj:`j:h6DbciZB*@F?3#?@3 ? +? [F"1D Fa*FYFj|F " ZF Fj1DQEIHaiKB C0XFDCF1" F:(I Hj*FAF N 2 Q g   pG0FuK Fk##P IGFN 0(4x+H (Ƅ#𵅰 FF0F"Oik@ hsi(FGFKB3BЌ(FF(ki@ri+F h(FGL Fi(FhG 𵅰FF"Oik@ hki0FGFKB3BД0FnFikjip0F3F hGFL F  FFNk Fp*F+F!GFTk"F!F(F[mGF F -AFF FFw&(FX&F6B F#Oki@(FkF hGFkY!wkkGFXHhjki@(F+Fri hGFF\Fh!$3h(FF   pG-A"N#OB%sh"+8kh[1hH,M1hH'(F! XFKC`K0@ (! F(7"FIdhi@Fh:F #IF((VXF(8FFh{hF1F(Fsh$o   𵙰FFKI"""II0 B2$, "B2$, B2$,C3$< 8I"0mF(aF yFH1H(Fr F 9F)I#F hF, $H "#IHgF9Fй H8`p:h0hFL8`L0h#F. HL^pƄ' D F^  l #"-E FF(H(IF0&KB%H{+#IFHF+ BF9F FhH_IHFHHUL FH&OS VE(FBF9F5F(6Ƅ    JhBHpGBh pGKhB`KKh@ pGptKh8`Kh@ pGp-AMO &0`B H/,"9FPF6-, #S``#`C` 4`FE,"9F0FEk6hR BH-EF$FFF0U',`@:F0FxKFBBF Fh0:FQF0FdF+` FL-MF FF4(L F)h(F!F" F,ѠF'FBظ'+hCD+`IS'FȹhFEF҃EF(hC@аFS'007L(ƄsFFFj*F F3FFxFppFFT?hB p(Fhh(3F6hHFh#S``##`c` F@-AFFF'0F`(F8 FF8IWB&FhB hB #$S```D`!F@FIF FO=hB@q 2[O3B jCR!0F@+FSB-hF\/bE hhBhh(FhhF FF$L F#0F `#`BF(FW?B!h9$1!`h*F ]FhBЙh*hQh4-EFFFF(H"8F%KB! Fp `aCahx`5`C``PEEO1FH 0FF ! P#S`` ``` F H`kj hb#`h`M H60F F (DŽDŽ-MFFFF*A".#FF `[?[Eѱ*82HhBDiB.H|C|h@ C +iE5`! (?kihaC``0hz3``., (*#,iE+п"i* "hhkF)#$hhBhREiBhh0H -AF FFF,JF,,,,(FKBJ ,0,@F(8F(EE:FCF1F8F-MF9@FFF(1FF(𪀏 F(F9Fټ `\` F hL FL8FF*F FFhhB#S`` ``` F(F8-A F&L FApG% h F"I2  FFgIx+Lur!FCF"0F@FQ,5=FSRh\0h?(Ƅs4HM %hI FZh'5hB F# FS``!`a`%(Fp@pG-=FRhSF"02KhF F(+IF0i*j+%I#$I<F)aaSab|FhKhK` KM`#a)F[jGFk"Fo#FGFxDŽp 0Fy(FF##I(FFf!#i++IuF0k{m(FkGFO) FY!IDŽ#O>Kh]-MF#F#F+/@F( 0+-@  H3F.{8FF0L F F(d@{  E BR!(V PF0 GF\   E BR0 0PFG,8F H >F(@;F2FYFhFe@r#C XF!BRNKB@MK`FFJL IHFx+z BHFi)m=K;KxF FV.Z ( @ PFG.KFB$@r !FO;K[ZF0F (G PF@ GF#$ ZFQJ2#h,0 SLFOL -?dh#8F`~DŽ  DŽƄ-A FF!#F(F+FIGFBF9F0F3hGFLBF9F0FshGF*F#(FI FXƄ-MFF@F=FF(y" ;I}Ft37LFZEH+x+1J>'F3S/O '7FO E%p/+"xFR*hB !B*h*F@Fl7  !EP*)*F@F[7  F[_E;i C1F#*FhF"!F F?hJXƄFFF"F(FFF:F1F(FFH"F#!F(FR F-AFFF##F F&IUF%#i++ M F(FKhBѧii`&!1F i(i2FAFhci%j`# + Fg(F!jHw#aDŽxE7OqJ [F K MD; KFSb KcbScjHg(Fd F0dp#"IH|p !0J 02F I F pF2F(F!FƄF\˅ F(, l!h!H5Ku5 \-AFO FF~h  #sC JIhBXBa Hjh +pB@+x+1+R#9Ռ+++++++++++ьььь+Ì+(H(:0(q1+?lR#njnjnjnjnj͌͌͌͌+++++++ьььь+Ì+~(6 l j&8g'8@84(2( ܠ0+?8~( P8 J F B# >Ch#hSBSAhahB3siHG6h1# 8F F M+x F$" IvK,ph<@ F8LL@pF Fs-3,1Mx+xcIKFZ*H Hh z@ ҲB@3`3K$ K,ph<@W FpLL)5@;lH(6 "iI (0gH`lP8DmmO-bK1,"!Za_J`h*ZhBhB/Zi*iBhB'"b"aaTK`"Z`* (OH6@+/F(DP%$&GH.F(vBJCIEF(n@Nb3cyF(d-M F xF) Y9bx) ty)bx**@!(FF}cy"y!|B"yf}BBc|yA!|BbAA|Aa#}C#}CC}Cccz!zf{A!zAAzAa#{C#{{CCCcI(FA"Ixx.C#*0FIDEF0F/I=-BD0FI*bz#z`yC#zzCC"yCcB"yIBByBb (FD#(F+p !tS+ۀ)]a3~yyhIC#cy"y(Fayyy"yC#B"`Icz"za{B"zf|BB#{zC#{BbCC{&|(FCcTI^|D*QI(FV(FOIQcy"yMI$0LI+4' 'C./D0F/=I:BD0F$ BI15szyayy"yfzC#$zB"(F:I_yy"y`y!zdzC#A!B"2I"(F.I.%-J-O40F?,I5-:FDxx'IG'{D(F#J#9DI I H#y*FIF!S+6Qr֠U`ԅ}_ # _)0߅!"y"s)0+g+!y`yyy*gA!AAAb(0LI"AFPcy"yB"yyBBAIBb(FQA!AAAbCFg9Icy"y!|B"yf}BBc|yA!|BbAA|Aa#}C#}CC}Cccz!zf{A!zAAzAa#{C#{{CCCcI"Ixx.C#*?!0FIDEF0F/I=-BD xxIB":R(Or#!f(H֠U`pFmhF/%,&s bB#x+cx+ hF-F F mpkxxC#D!F[?F} lJ(ZXFF lAF(P/?XFY(W&e%F(F F%=FXF[n0F (1FB(F x.+0F 1FB(F .FCEF)/*0F 1FB8F   XF l( Ff"#XF#C&#XFI#e {ń#0 FF"#F##(F ` 0𵅰 F e Fڱ&;+CеO.,6;C el( `H H𵅰FFFtű # F# #1F#:FF (hl`Au FL FFFP 2F)F FFX FpF8T@FOEFH @<RE-=5B  0F^F"h< `-EFFF3+'H\@<SEH"AF RFXc|"|B"3B2 Hh8F[(F`pF%iBp#S```E`pF%hBp#S``hh`E`S````F& ,jB F# FS``&`f`-MFJ| |C#|CC|CcB$x + [; + & + FcD|L F! JF(р"!F0ia#` FD'cz%zE%zEEzEe%DE8! "F(x9F ha(XД,0- .C#+ `(JO /aczJ*zJJzJjDE3FS/U`#h5aB`+xK+hc@75EF0++)ji FXB+jiR+   FA @ O 2Lhhi (F\*L*L ;P+&L FHO`@```by#y C#Esj ubI B* (kF8(F(FL RFYF0h J`;`x``PhS````#  `pF F )FFF0F 8(];((  p FFF F3 H;h# HT_BH0Fh(-h -AFFF F HT_B@Fh+iBjiC;R#P-(Fd3h0@O@4`H"F)Ff4` -h-EFFF u0F $HhBظzHFZ_UE8FhOxhB+iB٧9FhiF_H*ihi?!8Dna@F F(kiD -h -E FFF F H+h#HF&XE+hB .`H 6D%i;&8HhB7Hh)E-EU$ AE~ =65OCA FpF(B$O4 F<4@% @7+ C@ FhF?([(*(8(F 0FhF](FhF-( hFBۄBhF](c]B]A(](-BEhFB8F F)F FF F8FFFF#(F"F;F1FF#h#`(FFFFF{,#"F1F;F(FF FLpF FF^2F)F FFn Fp FFFFM^ L F,8TL;F2F)F FfFI#%1J 0p 000+J+F+I,H PF(F $J+F$I%HF(9ѝ 0NC 2F+F"IHF  0C IC 2F+F"HzFh 2F+FI HnF Fp H 眉Ƅ$:Nb|T-AMFF$FO20F)h_X"8Fih _( #h4,  Pل-AOFFBFFFKB(hFh+FBF9F0F( F#+`$ FDF8M\,h4+hiDBch[  3+*"h2D# F8@V0"! F M!FOB(`"+ha!#FE@ JF@F!J HF F0UbEfiVa ЃI`L#h+ H  H#z ! Jch h<"(H礉{#-M`OA F(qFDF'K EJ٫:F 0F"F 1F)JFB0@(FF0F "F(ch2#F#`3SD#FFK"#d# #AF# @`#CKUbEfiVa 𵋰"kF >F LH Hv"#)Fv H!(#BB(F F -E2CFF+H *H)I)KBB*i!F :nioB+iDB  @FFF!h!###@F FbhAFH  QF@F@"PF I {ch#h3D&UbEfiVa@ɄOA F(H HOB#!F#H"#aF(#*s H F iBBH F[(& &-MFD0FFF ?L F*)*"FPF@F$@ѻиv QF8F}F]+Jih)))L&& !# 2K,++hBFQF8FF[FLAE0.(F, Kh+.ih1CЁ|8FFCr##Cr## 8JKFcKScKcKd  e0@mH #FFFt@DFKh)K#!̼"##7M!JH@F(H y F0!#(hF(H^вՃ\F FFF?*F$! F0$":`(h C FL-M, L @ FiB;؄iB6ؼ7'#XE2"C h  `24 B73DP@P@@@ @+HH 0#F Fcm++i+% %#i FbiFF F0%LL-MFFFLT **  *@݁.ҁ#' .ɁV&RF[F@FAF(w F &&E@𥁭:B B  B w X B #%F\3FB0/DDM@n:Bi Bb  BZO w X`cEP %F<CS0CN;B  /DDM@*:B% B  BO w X`cE  K%F<O[C#0C.;B  /DD&@P:B܀ YBՀ BЀYDBˀ.ƀs# XBKC #& && ."J + C   37BD3+D.R0#@C#@#@c#B0OK o#o#@;!-6Ъkѭ :Bc B] BY)U O X wSELGC! !!%F )ђVxxFpp20E  DD) h 6SO0O  _LLLJ$F.R&׃ڃ؃ ڃ.R&؃ڃكڃ-Mo (_(\h FF3+FKp! F8(H o(KF F%I("H ]!J$ba J!eaJ$!aH"b". Wdae``bѺ KO @3sO@C#dhed#"cOxC"Oa ## Ƅ=փ-׃׃?  -MFF !F+F(1F(F/~VIFXF}F(@#F#FF(@AFPF g@F;hg{h;;lCK OFfg#9K"o:IF`.?+z+< "!@F1KPcb0Kb0Kb0K#ccck{D0#E0#djid"e.9@#b`V%Kh:l*h`jhrZ` "g g+iF;71F(F(t(1F"o(FoIFg F(F0 FXF HńDŽ(Ƅ܃ރa߃܃DŽ -MFFF(HЀhhB@Cy+?i:Bh3BC4B B "BA)h@F@!Fqn$oo2` /"FFFF(9F0FfhhBh#hh #o"FF FMoF1 C2F FFh(!F0F(si?c F!F0FB8F $/`s FIFFYO3F*F FUpȹ-AF FF8#x/+6BF/! F (FF!F8FF88F(DFFBBРF04/+/!@F (F4F)FBF8FL(F%o8FF F !FF(F8@-MFFFFۻoF$%F&F{TE;2F=I]/):BۚBȿ"DB!F@FF(Ы[Ex|/"6]TTE B"-ȿ5zU!F@Fkao#"Fo -AF FFF=,O8@F!o BoBFB3`B8F3J Fo "(]o pF F)F Fp@#:pK3pFF"O1(F(F Fp!F(FB"!FosiFF%B(Fp F1 40DB5o-EFKF8F%FDEO5 F 0 EذBTF52F9F F ((FoFF0 +`$ FDB-O3 F1C#DB-o-(`F?-A#)F Fo F|F(shB0F('F%F0FAF+C' (o 8(<S Oo{E-o 5"-AF0F`x++睱= kFAF0FX(Fo o  )@*B*F D#Fpo-AFFFFX B(F"F9F*F0FF Fo#F CF FF(  K@BS K(FpGHpGHpGHpGlф9.i'+لhD$Bh"DB jBh XB   8FQ(ei++ bj! FH_OSca8o o Fhj$ D*FD۱B؆BӘ DB oh?=DB ؤ oopFFF`hh  ``ppFFFPkjDjbhD`p-A FiF (D(FO S#ah2F )D6?`fbh*j )D`+j#b-M(FFF [@Fh6!j&DBFF 0FF&-Jۡh QD!D#" F 3FPV@F#j;#bFkh%j -)D F!D8F("jD"bpFAFu&O@q0-`0?`0_`RF*F-MF FFFع(F.i"F6#(F#FXQ#?O` F-AFFiF(FhB 6#F(F)DA"O4 F-AFFFF`BF9F0F8F-CЈ0F#" ($l` 3 `BF#F9F0FF3FF(&2F)F FpsF FF_)F2F FF9"# F 2p-MF FFFC(;CFRF)F F (6C1)F F, FYF%8(٥h-]Df'"1F FtOscQ4F:F F(BFQF FsOsXF>Ds`opFFFF"FF1F(Fp@pFF1F F( ۣh F!Dp@#4p-MF FF#/0Fpsi +O tj$"FYF0F:F)F0FFOSka?kbo` #0F (, F3j ( DDE  B ҘDE BoF#FZFAF0FRFAF(FK?+`OSkaOSo`ai$a 8F_F FcjB!F Fh"jDc`(F888+ h+o F]o JC o JC 𵅰FFFF+hbo :F1F(F$FFopFFJF FC+3F!F(FJC+!F(F(F p2F!F(F(!F(F -MFFFF(F F[(FP!)F F o Fo  F1F Fh HF Z(0"   :D F# 1FF FF( CE)F F")F F1FF FzCF(;F*F FF()F F-AFF$FFAF8FJ*`+ohZЫkFAF8FJFXF0F( 3o0Fu-,`-AFFFFFF.(F AF(F(F !F(FFA1(9F0Fe(!F(F"!F(F9FFF0FBF9F0FC(F#F*F0F(!F(Flo -MF F3(F,0F F(DF (F(@(FI ++g2(FI#F`1!(F(Fր!(FJ!0FJCF!0FJaF/РXCo9Ӱ6( p h3 `0o@ c?#p h?Z` `Xp?@2 b"p h?Tc `Spe%p h?eb `bpO07 F$x F0(C4=?4FO0h*(Г `\CoӠXCoT,2 `@1\B :B3  hXBoӰڰ? h 3 `pG0BXB h @\@ `XO0pG7FFh% #h0x+0C!F? =O07 F F`0(=7 F$ F0m(C4=(ݰo4?447FFh% #hp0+DC!F? =O0(ܠA+ 0pGBXpG3*pGK(ܠa+ 8pGBpG3Z*pGKpF$B 5`104.pFx"Zx@pG3pFHEm(F]F4F Fp*F!F'?%: F4;?\FoҧXA#Q f3p?6?fcaFppp0'!F F[+;o F f??kcCpFXAoӣ\Ao?# ap?afApp0Fh* #1@Bр3`3+?#`o F0M\B0K$5@`@F FF @" F VF +h$ FphF F"!0F#3p#p$spp+h 3+`phFF F "! F ##p #p%cppD#``;a3h 33`-AK xF*FF'h1F F,a0F0#Z`8F1F F,a F0D7FhF F@¿"hFF"!F Fx##p#pcp&p``#(FI+a q (F I q#cqcrrr#shh3bx;hD;`hFF"!F F@"#bpp'#pp I``+a(FlI q(F`q@*i (FI]o|rC t!#"r#u!# r!sbsss"tbtauuuhh Dbx3hD3`(FI7`q():hFF"!F F##p#pcp'p``#(FI+aN q (FI q(FIB`q (FI`q"(FI(Iq(F0#cr # rcshh3bx3hD3`%:5-AF0HFF4h"!F F##p#pcp'p``#(F$I+a q (F!I q(F I`q (FI`q"(FIqAF(F"qAF~(FII`v(Fvhh3bx3hD3`(F Iq%:?CӗhFF2"F F!##p0#pcp'p``#+a#cq#(FqIAIq(F<##v#cvO3vv#wcwwwy t(0#)0hh3bx3hD3`-MO6d #/IlHF%FF"4$! F.3#0F,)F[;GoEF/D."I F#cq#F"I(Fa#[B۲cu#F]2[*۲#q=FJXQVsF p%.F Fn(.x.+@%#x46.( FsFNM| FK#x4Bp Fp#F!MDB D #@ @Cp4k3D  @ -AFFFFnF F*F!F8FG( 4`#h&F+,F4`5`.F-h-M hFB FF#% T"!PFch`#hӹFB>%FVTl.Q+`FF@FG+h]`-h+h+,`e`hF"F`[+B.%.FH1FT<9F@F"FK,65FZ& "9F@FF6F1F@FG(.`u`-h6h+`]`-hh+3Fn-MJ hDhhDhc@c@DJhscJN"Dh"Dh@e@Dh5UJ"Dh"D,@Dh4D"@vDZ@2Di"N>DD@k@3DNiscN>D.D@e@5Di5UN>D&D,@T@4DN4VDD"@Z@2Dj"N8>DD@k@3DNjsc N>D.D@e@5Dj5U$GO?'D,@T@MbeD%Db\@,D:MT5D DdQ@)D7MqA=DDac@+D3M#5DDcJ@ *D/Mb5D%Db\@,D+MT5D DdQ@ )D'MqA5D+Dae@DhD#C`h`Dh`D` D꾤K`Kp~('09|eVD")*C#9Y[e ]O~o,CN~S5:*ӆ-EFia(CiF$3CaCiTsFCa@ TE"FE RF 9F(Fs@8"!(F#i)F#eci Fce1!F"0F Fp@X"!!7K3)Cc3F# FFhF3hiF F#Eg-MJx xC#xCCxCcJy yC#yCCyCcJz zC#zCCzCcJ{ {C#{CC{CcJ| |C#|CC|CcJ} }C#}CC}Cc ~J~C#~CC~CcJ C#CCCc! 0C#" CC# Cc% $0C#& CC' Cc) (0C#* CC+ Cc- ,0C#. CC/ Cc1 00C#2 CC3 Cc 405 C#6 CC7 Cc9 80C#: CC; Cc= <0C#> CC? CchhiCii@Q@KDbDD@tDB@ DDDbO @D`DD@ep@O D,@D`>D4D@ dOW@7D &@DgD9@A@fDO5@DD a @D`OU@=D@DD e'D,@DgO L@D:@DD2Dd!@DbOi@1D@D(DaD@D`@(D}@fO}@7@u%D/D l@`l@t@ M@%D gT@OT@Or|:@D bD  e|Oq)@sA@bDc s@s LKO~DV@vDf H@q H@ ~ O zOww/D pD` xOuu D j@Dr krOu D  /D ni@gqq q DO8e~~OttD~@&D fD@ttyZnOp p 0DO $ lp,p pD D kA@ qqp O pppOq q)D Dgq qqOux}@ED jvvOvvfD  Dev,hvv| n@$fDLO|||O~L{DD(f{{n{Otwt@$C&D tttOwB sJ,DOs$ss (K x Dgq jqqxy@AD OxxxOp|D `Da| ||OrrM@D`rOrerv>DB@2Dbv vvwn@>DOzzz~DW@wDf~~~tq@!Dt gtOt{Dx@ XDau`uu{ M@]D Orrr r2D D errr r DhwOw wr D D kv lv vq  DO p ppzD  QDbuuw~U@uD<(a~tOt~DN@vDT~~~e~h@D fp,OpppDr@Dnr `rr#DsDc`D`aVaDab-EhF?`(ChF(3F(C`@ ERF@?BBBbhhiRiiijRjO"qbID DA@@A@ DZDOq0P!C!@,@!CDDJ@J@I!DD DO!xa DC,@ Op1@,CQ!DD b@L,D,D"DO$|d"D@Oq45@5CT,DDJ 2D2DDO"~bDAVOt2 @G R:DO*D5@WD GD/DO%ve/DDOr0 H P@D8DOWDgDO,ulGDgDB Op1   L QaD9D O gD  O' xgDD Oq7@ @D W$'DxLgDTD  4DO& ~fdD4D Ow6A @B V(DgJ&D RD*D"DO$|d"DOv5G  @D U%DDD,VJ @RDBD"DO$pd"DFOu4 H TDDDD0EJRDDO" qbDDEOt2 H RBDwDrD4DDO,wlDDDOr< H \DvDD8DDO v`DDB O|0 H P@DuDpDm1'Y GQcDDO' rgfD>DOx>A @G ^D3DDOF ^D>D OG迢KfpK£Ql$օ5pj|G'>DDNfD@5DO&g@sf=D5DO~C\D(DDOG WD/D OEvE%/DM=D@%DO$V@pd5D%DN O|4F T4D,D)DDOF  .D .DOEzE%.DM 5D  DO" qbUDDL Ot2  J RRD*DDOEUD8UDOJwJ*UDM ]D  DO# xcUDDD Or3  J SSD+DDOEUD& !p@@BWxqEtF>Dx242O7@&d@gDGE@  aE0ҀIa!O1U`]`BR2B`@B)s&43a8<@ >eEADqD6ٞFED AEcD'aE< QDADeEqDUDED FQEcDB mDϋBqFF-;F =Ox-_p x3pBB{eEADqDٞFED AEѭKx={pxp??ё=13/h$`OqVh`VP 4@1D4@l6$@l,F!41)$F'F<D@7/4,8.@5$O 'h$ PR@5  D(@$B ڱ*Ā"JJ 5P] p E5 % @4"B@R 8@B"!F' &EFpH 8B(h`$ `/O@O _O0رiʱ#!aAcOACa`aQaaF`S``bbbcccfedpGopG8F F*<x1*9<+7o8#ajJbFbbj Jbb!B0RjGF-a#mB`+ #MbKc F8@+3/-`cj"jG#aooaMiMFirCjcQk"jGj"cjiG ao-M*FFOD xDOsBE=,DB٤DY!d ЗB#iQFiaD\ 0p0jccK#h+o0BiPhk(@I"ij 0(Ghc(@<##`o/;?@D5#/;?@D5./;?@D5C"i ,`daE"j*?DaA"ja##d##`#iS7/" 0!j2a$#ljB>Y!d ЗB#iQFi-aDo##`#i- "BвK%"j*Sb/?[+?@D5%.F"j*@#b"#jc"FFa4 #/?=;?@D5-6a4`& #5F#`hk 0p0#cc#a40 ##`+?ch{@%#/?;?@D5-c`A+++zKd #ceyK#e#e##`=vK0## #@%- 3 CB kK/?ʮ;?@D5%#.F"d#`"l*?xE(FE(F?QFZF  D[D#l #d7/?;?@D5 -D!31"fcfeO6+AK9#f##`m/?n+?@D5-Zf7J=2083$ nB 0JC+cfd#ceXFQh(8+-Ѹ*hFC h"PDAF0G(#hBF YFh#(#hSDhc#h@FSD"`#hSDh+#hSD3`{8F#hS 0+Q+ѢhchB-=F'oC#hXFQ#hp`#h@F` h8DCh+Ѓh+Уh03` h8D0 hh8D~"AF0GH!h*F9D F1FGF#hYFBFh#O!h9D1 *F F1H `4؉-EO  F FFF@"oK` F  ;F"AFG("KO4`"+h0!F#"hF("Ko`2F(F؉-M`BhF2" Fk`+j(h%Oh}a;`shCE")FSK8izi2,UДBT!FNH #O0LJ`7F#2h X+6 {`k;lh 9k+@;h#0x.+!k{`;i C% }iD 8?C[E \+ 5D}h{a5#Fhh"F!0F!O= O\;iB # F3p!F hF`(яChh:sцP/Rh:oFFF1F^E\.уCFxk5k)؉-MF;mFO # FF` "K` :PjF "K1F"F#+U;m.#RFymhl:m`C0s@0(OpAFP(F@F0+<(F (7Fl+J.F+{`3x +I +G#+H4F; [E{hB#x+:(F^h+ѻhh:mBTPAFl`!h(KHh3` )уB ғ 23Bx)Ѥ `+F"(Dt&FF0TF=+  c[EbxEZE=+##pTFO#p;m3AF0Fl40Fh9m!(#RFQF#pF; [E# p3xs"K`Y\+Px(F"F;2;mӹlj#({i+_RF1F HOX0Fh9m(?QHk؉YFF$'khB *hX+40G(FFKJKF(F)F0FJFGB);F J0DBؿ$p)J0D0FN;#{~ׅF F!ǿ"iF iFH 3]_-E FF&<#   :C$ C$ C   ,J]^*FF+HE ;C$ CO2 N"N@ $P.$:!!$ O H  "$B@E(O2RE  *F!F ( #*F00$ F "poBdp FFF 2F)FH Fp#FF F "czh DB hD2 F !bQF)F"+hZ*`x)+K2! FQF/+`9F F+KYx** " "?)3+`21F F" H(+h FZ*`xR;i|7% RRRRR x!^SBSA 2)FFxx+! Fw F!!@ 0 F-MF! BFFFFBFF F!F+FBF8FF6B,&F pMC+B ,\D\DҲBѱBFpFO2ؿB;?+pG DDB;?+FxF2,;+/*0F%x#F4-9DOKB"p0C/ @*pGC DB O @,FɲxFBpG*FpGFFx3)pGFFFzFFB5*F9F0F#lsU F8F F+F)BНB 8FDBFx2,8F80F,F F8!FUF 0\+8RBO-cC=6 ))O  !  @N 1  # BB @R qI+'=)H=R0#!0 B FFTDE8'p4DE80#8#p*GјECX<k &0&*F#F:4%s=DF#F0&4 '5RO  }  XF CE83:%s=D*F#FO FCE8p3CE8p3:B@ DF F; )@*FF !:-@BE8]8lCE8p39-AF$K*FFF s FOE "B(Bp;2B+Bȿ#D#F !!^DB(? kBp<3F%KF*FFF0F.F(*FQB)+ &*F(B*B (DB82BۣB1ȿ"ȿ$%DT*FO (B88B8p2-M FF(CF(O:(3xkBWE8;p{E<# <%+WE;p|$L-+G0+gУ0 *M FO F;0 .[ x.+kKxN0 *_1F# F+0 O#s1xz)]g)^L)W62xx*b*j%*ԁX*ׁWE<%#;p3x|+ぢE{pDFsxq++Э +#+*+UDDDD@D30O8"0*+U;FO3#Z)O1HhҲ l)pxl(L!6Fc:*P"m????????Õ??ۓ???镄BF;F !SE8p3:*ܸ3ؿODؿ#DWE8U;8;p !#FGD* ܸ3ؿ#D'F6SE8p3l)U+QF48FCF"Fl)FQ+qxFU)I)M)QD) и? OD D! i)wm)?a)O hDa#QF8F#B4QFCF8FFF(FQFCF8FF(F_LIsx\3FRFD@"@ O)F    I* O:2p2*"$@ p4QFCF8F D@x$@4)t; F F <9)E"*T  FO.xL* l* ТBJBJAR@ "" I :o  F+h t)ѫF[+5%Fih[+8F FQF]FFF![+F[[*E1 FzB ` F S+k]pGF FoA`R]pGmF FhF@AFhF F mQ ]pG#F M Oku5 F !#F$01 +.FO0F" Kt J]Fs] s :K\D C9(Կ08W8pGOppGpx0+CxL\D۲x+"0F%&F0xB `(Fp*"* ""ѿ "ο#`FFFjFo:F FBx*3B *(` x-,н@0@B h FxI\A۲k+m+g+рS#`Qxi)#`xB*3#`xF0+CxI\A۲x+"0$F!F/F8xNB 7` F*"* "C1A8 F"hMx\E۲k+ m+g+щAQAQS#`Uxi-#`xAQB*3O #`8F! J<\[KBFO0x;Q\0@)!ݿ-EFo9K5b2$d!@FF)Oq@F!Կ''@mD K :S*0!DhD a'O0QT؄#J`J`J`J`KJ#?`pGHPLD58-M KFhFF0F@I"42TO &F! apppqqRFIfq 2F RFAF 2FKhM8M:p N MI2h+h hS@ B L Kh H3h#`"h(hp@I"`PLS:KhP A1JhB  L#h3+#` H#"#`K``P@<-M*F FF")FOHM xJxC#(ыxxC#+"ёOy/ 0 :FQF+ B ѣyyC#г6@0F#q#qFBFF4:F!FPFBFF&I:FYF FF51F*F)F8FMO;h+"KhSEN0h"AFJ#MFFRF FLG"AF(h!h(h#;`#`3`PLHHчDKh8 pGP-AFc q9!$(ppq5 !lp(qS$ )rir@!phqr*h [2!!p!ppap#qbq4=H(b"!9H(\^##p#'cp#5Hpp'qF(Z(Ra#cq#qq:F0F)4)H)K'F(FF@Fp<#;FFAF`p8F27"U"p"p"q "Zq"!q"qZp#P?(ݽ6 r js s (ss)t ]##p#cppp41FH54;;[.F-AFFB!x)ѽ)ex1)^С3ڲ*UHU+R#矄ϞϞϞϞϞϞϞϞϞ)S!yϞϞϞϞϞϞϞϞϞϞϞ"+H5,D"(H"'H- #*F$I%H':F#Hf#!JU/F?-@#*FIH?':FHR#J/F"HxKp"HKO*F8F5O5eoh\TX"sF1F KB#MEq+p +x1Fl+xl,p@pcScT-MD)F8C+Ѹx+Cx+уx+ F"Kh#JBR[Bk3:FzKBx*5*Kћx+ F")F#")FnH"mKmHhDlKx l4 F@hKx+Ob!FfH=eI xdHQF"cHj#3`aKh^IF_H!FM 3Zx2DWHM"TI%F( "QF9+?yLN7h/?}/?q/ FAFO FA0BI@)F@R F=IOb F#D#wcw#0JwFwhX5J R$ "% 4BF#&IF8"IBF BFQF!J9Fhp3D# FC"O1)DcScT}쐇 `HчaM:MbX K`K`"K`K`쐇萇-M$cOcH<`(!F+_K`_K`Hh%1`@@R! FYIOb FO #VJDwwFhQJ R$ "% ("1",*"0#"4#FAF8":I+F*FQFpl 0FC# (FCC CcI*K-h*1 "@F$Kh;H#P " C" FD#O1KIhN#H;`7)DF`PIH"P2``dHч/M:쐇Mb萇aKhKhBH@~ J Ih@oOcFF`@쐇dC萇a$ (] 8FF#h FkiG"!( 8 !F@hc(ahHooiFCl hki㱀l FyByCyCyCzCBzC#h FkiG&ah@H;(ah@H3FF(FX#3`3qEIF"lF(MAI"lF(E+hki+T;OjFl;Hn #y C C C C C>byCyCyC"zCbzC"iF0F`ih(H9F2F&HiF%H"iF0F(Fc /"0F#ybyCyCyC"zCbzCO(FGbyCyCyC"zCbzC2Fl H ih Ho깅久Dži "7AsF0!FF$ Fp- 50F p"!F0hF+!F@$ v#h+8FphYF$ M(` !F$ ^(`$h F8F $`ClK`(FhB #FH IFF0FX%O7$ x$ F0FB5DiF(FyFh,<,3B Fj1F`h(B٣lBi ~0w0Cl1#`khlO0!HF H`Iw@< FFhoJF0Ho F5FoOkl+h(FkhG (F#`#$qO Fp $oos$ G,#H Fp!HJF(4F(/$[lHHZhl.BHQ[lD+H o%H oXxFFH IFhFl!FhF)FFH IFhFV!FhF.@øKIhFF;hF8 ]@hH4HFH(F8TI(<F@H$F F(^e8FHy08 I( M(`+hB"K`epNF0hM+hBHF,`0`p H@@(p@  ^oKJ`J`"K`pG\чXчTч"K`pGpGFK` FK` FK` FK` #@"FH1 o?L#hKJ#?`Ja`@aQ`QS``##`@οчHч`ч8+H*MF` +hB"om%K` F8$I F#I( F!I(" FFj +h3+`Kh@ QKFh `KhsKJ`BrK`K`KJ`"K"KDч 9TчPчLч\чK(FFK`pG\чKhpGXч KF` `KJ`Ozs\CKC `TчPчLчMbKhK8Hч-MK`K )F F`@+KhMGOv@qK\B FFKB[n{+{C#@V[B&l}+}:C#[@v@w BоB B@o-@B@!F(FMO:*@ր@s Bπ{{l|F&+|vC#[ :*@򻀦xxF&vB#x@*@+! FS("[Jh"B3@" yyB"R *jxx F&Crv EO lEJ:EI"y`yB"BOr?I?K Za">I F"!Fi9H EDܶ H O E:ݛ+K +KE;؊EqۖQ^)&:F@F2αKLsc6cz+|#}+qc}+ HMRR* ASCEۢ@TF/.DV *>F/&FDqJ~K{&z2F!F(FM˻+"~c~B"R*٣xxC#[Ba}#}}C#}:A!J[IhGl\чKOsB @s@ B   pG pGpKFOsBdO @tFZ"IU@s rBӲ" +sjspo~)s!ds$ iss+tjt8F"F."I)b{#{C#Yj+Ӳ" #tbt8@PB  #sbs#ubuE"p"F[p#p0ICr hBpX[#q#cq@#q#`#riFqrr "" ! FXr rFFB"w"JFh!4{rd+uu#",v$kuulvvv-MFpFFF/:J2 MOb)F8FO6 F*, ZF1F8SFI"(F\ 4$K`K`K`K`K` FZ O0oHчM:S:PHD<@$$) x"+219:*K? "+#ppG;:!HB8 ((((+ #@O_ ( KhcH. Kh#HKh H"IH(XCF(H  H H    +z = \  H" K` (H"K @༚  ("^K-M`#"l[O0;`hZKF`SQTN#3`02(FWp(K`S";Ko` 8Hj#3`"3K`"/K`"hbl&Jh(JhB"h#`G0+0+++0Ln"hbFH&!hHjKHhe -$hMTo?Dч@чTчPчP Lч $M9-ANF0x FF:!0FF0F*Fy Fu# ,D<*F1FFCF#IҲ] hx0; +!.@@pOpFK FK "K`)$MF$HrBp"I"L*h"K"I` hOb'$hJD)hF# Fh%!J!ueu[v#vuu%vevK6`uK u(F`W K`@C 鹄HчPS:D<@-M }F FF#+" 1 %KhB"#K`0+Ob% QFrrqqF""YFPF! F"r r%uuuu u4FFD9F2F1F(FM~KKKNh2h:*S]jSSwOrRAI F4?H0D F=I+=I'H7>K `Q2RHUNJNy}C7/r1CM &qLFܻՇ stp9DKP/;U'&LHt7&x/iHB.׫VjbZHڣyk!A ,irﲡF'm2A`Bti#L˘wP2*˲:=Egeo@>@mJl$m0VL?ir;1?ir;~b3>O -;6P4ubwF%wt8i9ir;wt8i9ir;QǤ#>LIdcI'hUh=OtUR1h2%-'?M(-'?Mf~*@.!Ê"[NYd9ir;(s*K>;Gہ5'?Ms愣J(b CoPoPoPpPlPBlP4B`P0`P8`P3Dh& CoPPbP@<E@AEDE8D4D0AD,D(C$C ACCBBAB B@@@??@??>Ԁ>=p@=p>@>P]`FC=݋#1--'?M(s*K>;e0Be 9e 9Be0$+29AIQYaiqxiԅ$ԅׄ ׄքքׄ ׄքd)dd)d)d)dd&")&4m)44.44444444444'4,4444445(RGBPBGR3BGR4ʅ)ʅʅʅʅʅʅ$o-o6U矅@ )@(-XYXWWV$@$$$$(", *$.)#-!+%/`@@RGB31&?<<(< RGB3}??#<0 `RGB3?"< a(X! LVD6?+<X<(< h߄h߄h߄h߄h߄ńńc?>cc)c%oS7硃ǡ]A寃ѯٰUA͵E崃Ỹq̓̃9̃˃˃8(H@ @ '@BIZiy -?PcvN!6T@TNT]T:lT~TTTguq1-2211@x}uu@x}e #$ֆ3 ֆEֆVֆgֆxֆ؅ԅԅׅׅׅ4ׅ)ӁӁӁҁҁ 0Y7;A"ws#[ 矅)PI%-B>0׆O0׆a0׆s@׆0׆0׆P׆@׆ $,Yj,--/---A#$2-3Is!u,-!-?.,}--,,-a.'.---.-..-M-----a!!e"! " """" o" (" /"7".B"P"W"c"m"v"    ܄ l܄l݄l݄ m݄ mxބ Fm ߄qm ܄m-`ppp@@@@@@@@@;Zx0N ׅuممqށ9ہO655k5ƄƄƄƄƄƄNƄbƄ܅܅ ݅"݅9݅K݅]݅o݅݅݅݅݅݅iahaiOla ]a da Ua ua Yana"y]UaiOYala]aaadahakanarauaya*70//.q/..A #)/5?#_E߅EIq Rq bq mq xq qJq?Hnmm m m n ,n HnSno3p Op kp p p ppHnpqnqq%q3qo ?o ?ppnHn n Hn o o ooFoooonn n Hn o o o+oFoVopo~o qn {n n n n,nnHnMBB @ @`00MZhu#^^M Ls\ f!  IP U0^0g0(p08y@ @(@0@8Udzdz*@VnUU "1@Um<e.Vq -Gp!<Zx.%*2*8*>*H*B*L*Q* V*[*`*k*v*{*********** * ** *****+ ++++(+0+8+>+**J+F+Q+X+_+e+##3$8$$E$$V$!$f$&$v$*$$.$$##.V)a)v)")))))))))E()))))* *B*## $$=I$m)*$$$$"%%"% A%J% ^%g%&%%%%%.%%% %%&&)&1&mF?&F&S&#r&&&& &&&&&''$'2'?'R'Z'n's''''''''' ((5(:(E(I( m(z(!(("(($(('))(1)<)###I1<Å…S-R#ӗB> = #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@ !1Aa  0@`@@A@!  @a`10  @ !"# $$%(&*,'0(48)<@*H+P,X `-h p./ 0123 @4567@89:;<=>?    #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      BootCurrentBoot00000123456789ABCDEFBootNextBootOrderPlatformLangCodesPlatformLangOsIndicationsSupportedSecureBootSetupModeAuditModeDeployedModeVendorKeysPKKEKdbdbxdbtdbr<NULL>u-boot*EHCI Host Controller   *+,;=[]s愣J(b__of_translate_addressfdt_fixup_memory_banksv7_outer_cache_inval_rangedo_bootvx_fdtdo_gptusb_setup_descriptorusb_kbd_removedev_get_parent_privdevm_kfreedevice_removei2c_idle_busphy_device_createfec_alloc_descsfuse_overridedc_ch_offsetci_ep_queueg_dnl_register_ehci_create_int_queuealloc_double_indirect_blockext4fs_put_metadatafs_devreadefi_free_poolefi_runtime_relocategpt_verify_headersdev_get_uclass_privdevres_addfecmxc_recvfuse_progcomposite_unbindext4fs_log_journalefi_free_pages__fsg_is_setgpt_restoredev_get_privdevres_freei2c_init_transferfuse_senseset_protective_mbrdev_get_uclass_platwait_for_sr_statefuse_readpart_get_info_efidev_get_parent_plati2c_imx_stopfdt_find_or_add_subnodedev_get_platis_pte_validdevice_probealloc_read_gpt_entriesis_gpt_validfind_valid_gpt(((((AAAAAABBBBBB(fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s bootargsFDT creation failed!FDT and ATAGS support not compiled in /memory## WARNING: fixup memory failed! zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] ERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x arch_numberTLB addrirq_spsp start Early malloc usage: %lx / %x Resetting CPU ... (T)(%0*x) %0*x reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... CACHE: Misaligned operation at range [%08lx, %08lx] 8MP[8]8MP Lite[4]8MP[6]8MNano Quad8MNano Dual8MNano Solo8MNano QuadLite8MNano DualLite8MNano SoloLite8MNano UltraLite Quad8MNano UltraLite Dual8MNano UltraLite Solo8MMQ8MMQL8MMD8MMDL8MMS8MMSL8MQ8MQLite8MD7S7D6QP6DP6Q6D6DL6SOLO6SL6SLL6SX6UL6ULL6ULZ538MP Dual[3]PORCSUIPP USERWDOGJTAG HIGH-ZJTAG SWWDOG3TEMPSENSEWARM BOOTunknown resetCPU: Freescale i.MX%s rev%d.%d at %dMHz %d MHz (running at %d MHz) CPU: Automotive temperature grade Industrial temperature grade Extended Commercial temperature grade (%dC to %dC) at %dCReset cause: %s auto-detected panel %s No panel detected: default to %s Display: %s (%ux%u) HDMILCD %s cannot be configured: %d unsupported panel %s [noreset] bmode - getprisecnoresetbmodehdmidetdetect HDMI monitornormalsataecspi1:0ecspi1:1ecspi1:2ecspi1:3esdhc1esdhc2esdhc3esdhc4imx_thermalPLL_SYS %8d MHz PLL_BUS %8d MHz PLL_OTG %8d MHz PLL_NET %8d MHz ARM %8d kHz IPG %8d kHz UART %8d kHz AHB %8d kHz AXI %8d kHz DDR %8d kHz USDHC1 %8d kHz USDHC2 %8d kHz USDHC3 %8d kHz USDHC4 %8d kHz EMI SLOW %8d kHz IPG PERCLK %8d kHz Unsupported MXC CLK: %d display clockscore %d => %d BKL1_PWMBKL1_PWM_ENBKL1_ON%.4xboard_revfdt_fileimx6q-apalis-eval.dtbimx6q-apalis_v1_0-eval.dtbpatching fdt_file to imx6q-apalis_v1_0-eval.dtb Serial Downloader recovery mode, using sdp command bootdelaysdp 0Model: Toradex Apalis iMX6 %s %s%s serial_mxcwvga-rgbwsvga-lvdsFusing... Fuse 0, 5: %8x Fuse 0, 6: %8x Fuse 4, 3: %8x Fuse 4, 2: %8x BT_FUSE_SEL already fused, will do nothing failed. done. -y-nFast boot mode already fused, no need to fuse Fusing fast boot mode... Warning: Programming fuses is an irreversible operation! Updating to fast boot mode prevents easy downgrading to previous BSP versions. Really perform this fuse programming? updt_fuseOTP fusing during module updateupdt_fuse [-n] [-y] - boot cfg fast boot mode fusingmfgr_fuseOTP fusing during module productionPMIC: failed to get device for PMIC at address 0x%x i2c pmic INTSTAT3 register read failed @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ WARNING: ecc errors found in pmic fuse banks i2c pmic ECC_SE1 register read failed WARNING: ecc has made bit corrections in banks 1 to 5 i2c pmic ECC_SE2 register read failed WARNING: ecc has made bit corrections in banks 6 to 10 i2c pmic ECC_DE register read failed ERROR: banks 1 to 5 have uncorrectable bits ERROR: banks 6 to 10 have uncorrectable bits i2c pmic devid read failed i2c pmic revid read failed device id: 0x%.2x, revision id: 0x%.2x, i2c write failed i2c fuse_por read failed not programmed undefined programming state Programming PMIC OTP...PMIC already programmed, exiting i2c write failed, reg 0x%2x, value 0x%2x pf0100_otp_progProgram the OTP fuses on the PMIC PF0100No MMC card found MMC init failed MMC partition switch failed Argument too short, barcode is 16 chars long Not enough malloc space available! A valid Toradex config block is present, still recreate? [y/N] Is the module an IT version? [y/N] socimx7dimx7stegra20tegra124vf500vf610Module type not detectable due to unknown SoC Enter the module version (e.g. V1.1B): VEnter module serial number: Failed to write Toradex config block: %d Toradex config block successfully written createreloadFailed to reload Toradex config block: %d cfgblockToradex config block handling commandscreate [-y] [barcode] - (Re-)create Toradex config block create carrier [-y] [barcode] - (Re-)create Toradex Carrier config block cfgblock reload - Reload Toradex config block from flashUNKNOWN DISPLAY ADAPTERVerdin DSI to HDMI AdapterVerdin DSI to LVDS AdapterUNKNOWN CARRIER BOARDDahliaVerdin Development BoardUNKNOWN MODULEColibri PXA270 312MHzColibri PXA270 520MHzColibri PXA320 806MHzColibri PXA300 208MHzColibri PXA310 624MHzColibri PXA320 806MHz ITColibri PXA300 208MHz XTColibri VF50 128MBColibri VF61 256MBColibri VF61 256MB ITColibri VF50 128MB ITColibri iMX6 Solo 256MBColibri iMX6 DualLite 512MBColibri iMX6 Solo 256MB ITColibri iMX6 DualLite 512MB ITColibri T20 256MBColibri T20 512MBColibri T20 512MB ITColibri T30 1GBColibri T20 256MB ITApalis T30 2GBApalis T30 1GBApalis iMX6 Quad 1GBApalis iMX6 Quad 2GB ITApalis iMX6 Dual 512MBColibri T30 1GB ITApalis T30 1GB ITColibri iMX7 Solo 256MBColibri iMX7 Dual 512MBApalis TK1 2GBApalis iMX6 Dual 1GB ITColibri iMX6ULL 256MBApalis iMX8 QuadMax 4GB Wi-Fi / BT ITColibri iMX8 QuadXPlus 2GB Wi-Fi / BT ITColibri iMX7 Dual 1GB (eMMC)Colibri iMX6ULL 512MB Wi-Fi / BT ITColibri iMX7 Dual 512MB EPDCApalis TK1 4GBColibri T20 512MB IT SETEKColibri iMX6ULL 512MB ITColibri iMX6ULL 512MB Wi-Fi / BluetoothApalis iMX8 QuadXPlus 2GB Wi-Fi / BT ITApalis iMX8 QuadMax 4GB ITApalis iMX8 QuadPlus 2GB Wi-Fi / BTApalis iMX8 QuadPlus 2GBColibri iMX8 QuadXPlus 2GB ITColibri iMX8 DualX 1GB Wi-Fi / BluetoothColibri iMX8 DualX 1GBApalis iMX8 QuadXPlus 2GB ECC ITApalis iMX8 DualXPlus 1GBVerdin iMX8M Mini Quad 2GB Wi-Fi / BT ITVerdin iMX8M Nano Quad 1GB Wi-Fi / BTVerdin iMX8M Mini DualLite 1GBVerdin iMX8M Plus Quad 4GB Wi-Fi / BT ITVerdin iMX8M Mini Quad 2GB ITVerdin iMX8M Mini DualLite 1GB WB ITVerdin iMX8M Plus Quad 2GBColibri iMX6ULL 1GB IT (eMMC)Verdin iMX8M Plus Quad 4GB ITVerdin iMX8M Plus Quad 2GB Wi-Fi / BT ITVerdin iMX8M Plus QuadLite 1GB ITVerdin iMX8M Plus Quad 8GB Wi-Fi / BTMISSING TORADEX CONFIG BLOCK %08uV%1d.%1d%cserial#Model: Toradex %s %s, Serial# %s ethaddrserial-number%04utoradex,product-idtoradex,board-revRamdisk image is corrupt or invalid ERROR: RD image overlaps OS image (OS=0x%lx..0x%lx) Could not find a valid device tree ERROR: FDT image overlaps OS image (OS=0x%lx..0x%lx) Loadable(s) is corrupt or invalid verify## Booting kernel from Legacy Image at %08lx ... Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! Can't get image type! Can't get image compression! Can't get image OS! Can't get image ARCH! Can't get image load address! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Can't get entry point property! Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand not supported ## Failed to initialize UEFI sub-system: r = %lu ## Failed to install device tree: r = %lu ## Transferring control to EFI (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... autostartfilesize Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated %s: %s Base path too long (%s%s) Retrieving file: %s %lxExpected string literal: %.*s Expected string: %.*s outbuf is too small (%zd < 21) eth01-%02x-%02x-%02x-%02x-%02x-%02x./bootmlocalcmdNo kernel given, skipping %s ramdisk_addr_rSkipping %s for failure retrieving initrd kernel_addr_rSkipping %s for failure retrieving kernel ipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s malloc fail (FIT address) fdt_addr_rfdtfilemalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT fdtoverlay_addr_rInvalid fdtoverlay_addr_r for loading overlays Failed loading overlay %s Invalid overlay %s, skipping Failed to apply overlay %s, skipping fdt_addrExpected include path: %.*s Couldn't retrieve %s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s pxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%sMissing default: %s Error parsing config file menutitledefaultpromptlabelkernellinuxlocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysontimeoutipappendbackgroundUnknown OSUnknown ArchitectureUnknown ImageXIPLoading %s %s Uncompressing %s Unimplemented compression type %d Unknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x architecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution Environmentu-bootU-BootvxworksVxWorksopensbiRISC-V OpenSBIEFI FirmwareInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vbootm_lowbootm_sizebootm_mapsize## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... loadablesThe given image format is not supported (corrupt?) %d Bytes = loadaddrERROR: - must RESET the board to recover. ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryregno-mapimage is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed skip_board_fixupskip board fdt fixup ERROR: board-specific fdt fixup failed: %s - must RESET the board to recover. Unsupported %s address size description/imagesdata-offsetdata-positiondata-sizealgo%s %s algo: invalid/unsupported key-name-hintrequired (required)padding%s %s padding: %s %s %s value: unavailable hashHashsignatureSign%s Description: %s Type: %s %s Compression: %s %s Data Start: %s Data Size: %s Architecture: %s %s OS: %s %s Load Address: %s Load Address: 0x%08lx %s Entry Point: %sFIT description: Can't find images parent node '%s' (%s) %s Image %u (%s) /configurations%s Default Configuration: '%s' %s Configuration %u (%s) %s Kernel: %s Init Ramdisk: %s %s Firmware: %s %s FDT: %s %s FPGA: %s %s Loadables: Corrupted or truncated treeCan't get hash value propertyUnsupported hash algorithmBad hash value lenBad hash valueCan't get hash algo propertyuboot-ignore-skipped + error! %s for '%s' hash node in '%s' image node Can't get image data/sizeerror! %s in '%s' image node unknown## Loading %s from FIT Image at %08lx ... Bad FIT %s image format! (err=%d) Could not find configuration node Using '%s' configuration Could not find subimage node type '%s' Trying '%s' %s subimage Verifying Hash Integrity ... Bad Data Hash No %s %s %s Image Could not find %s subimage data! Can't get %s subimage load address! Error: %s overwritten Loading %s from 0x%08lx to 0x%08lx Error decompressing %s WARNING: 'compression' nodes for ramdisks are deprecated, please fix your .its file! Subimage data is not a FDTOverlayed FDT requires relocation load of %s failed failed to duplicate DTO before application failed on fdt_open_into for DTO failed on fdt_open_into ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX Perform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsTrying to execute a command out of order yesAutomatic boot of image at addr 0x%08lX ... bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]arm-openwrt-linux-muslgnueabi-gcc (OpenWrt GCC 14.3.0 r32912-6639b15f62) 14.3.0 GNU ld (GNU Binutils) 2.44 print monitor, compiler and linker versionERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available read %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s Bad magic number Bad header crc Bad data crc Bad image type Empty Script No FIT subimage unit name Can't find '%s' FIT subimage Not a image image Could not find script subimage data Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory%-12s= 0x%0*lx %-12s= 0x%.*llx (not set)boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit current eth = %s %-12s= %s IP addr = %s fdt_blobnew_fdtfdt_sizeVideo%-12s= %s %sactive FB baseFB copyFB size%-12s= %dx%dx%d bdinfoprint Board Info structurechanged to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u blkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigureThere is no valid bmp file at the given address Image size : %d x %d Bits per pixel: %d Compression : %d bmpmanipulate BMP image datainfo - display image info bmp display [x y] - display image at x,ybootcountprint## Application failed, r = %lu ## %ls fdtcontroladdrERROR: need device tree ERROR: invalid $fdt_addr or $fdtcontroladdr ERROR: invalid device tree ERROR: Failed to reserve space for FDT ERROR: out of memory ERROR: failed to process device tree ERROR: failed to install device tree Booting %pD Loading image failed Error: Cannot initialize UEFI sub-system, r = %lu bootmgrEFI boot manager: Cannot load any image No UEFI binary known at %s bootefiBoots an EFI payload from memorybootzboot Linux zImage image from memoryflushInstruction Cache is %s Data (writethrough) Cache is %s dcacheenable or disable data cache[on, off, flush] - enable, disable, or flush data (writethrough) cacheicacheenable or disable instruction cache[on, off, flush] - enable, disable, or flush instruction cacheList of available devices: %-8s %08x %c%c coninfoprint console devices and informationdmDriver model low level accesstree Dump driver model tree ('*' = activated) dm uclass Dump list of instances for each uclass dm devres Dump list of device resources for each device dm drivers Dump list of drivers with uclass and instances dm compat Dump list of drivers with compatibility strings dm static Dump list of drivers with static platform datadevresdriverscompatstaticechoecho args to console[-n] [args..] - echo args to console; -n suppresses newlineexitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext4writecreate a file in the root directory [sizebytes] [file offset] - create a file in / directoryext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** fatmkdircreate a directory [] - create a directory in 'dev' on 'interface'fatrmdelete a file [] - delete a file from 'dev' on 'interface'fatwritewrite file into a dos filesystem [ []] - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizefdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%sfdtaddrControlWorking/* NULL pointer error */-c%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s boaFailed to update board information in FDT: %s flattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structfstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start.Reading bank %u: Word 0x%.8x: %.8xsenseSensing bank %u: Programming bank %u word 0x%.8x to 0x%.8x... Warning: Programming fuses is an irreversible operation! This may brick your system. Use this command only if you are sure of what you are doing! Really perform this fuse programming? Fuse programming aborted overrideOverriding bank %u word 0x%.8x with 0x%.8x... Fuse sub-systemread [] - read 1 or 'cnt' fuse words, starting at 'word' fuse sense [] - sense 1 or 'cnt' fuse words, starting at 'word' fuse prog [-y] [...] - program 1 or several fuse words, starting at 'word' (PERMANENT) fuse override [...] - override 1 or several fuse words, starting at 'word'Bank %s: -aGPIO: '%s' not found cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %u) value is unknown (ret=%d) Warning: no access to GPIO output value Warning: value of pin is still %d query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsNo I2C bus selected Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Error: Not supported by the driver Valid chip addresses: %02XCurrent bus is %d Setting bus to %d Failure changing bus number (%d) Bus %d: %s (active %d) %02x: %s, offset len %x, flags %x Invalid bus %d: err=%d readingError %s the chip: %d %04x: %02xwriting-sCRC32 for %08lx ... %08lx ==> %08lx: %02lx %04lx ? I2C sub-systemcrc32loopmmmwnmprobeolenUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=Base Address: 0x%08lx Refusing to do empty test Testing %08lx ... %08lx: Iteration: %6d FAILURE (data line): expected %08lx, actual %08lx FAILURE (data line): Is %08lx, should be %08lx FAILURE: Address bit stuck high @ 0x%.8lx: expected 0x%.8lx, actual 0x%.8lx FAILURE: Address bit stuck low or shorted @ 0x%.8lx: expected 0x%.8lx, actual 0x%.8lx FAILURE (read/write) @ 0x%.8lx: expected 0x%.8lx, actual 0x%.8lx) FAILURE (read/write): @ 0x%.8lx: expected 0x%.8lx, actual 0x%.8lx) FAILURE: 0x%08lx != 0x%08lx (delta=0x%08lx -> bit %ld) at offset 0x%08lx Tested %d iteration(s) with %lu errors. The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same %08x %0lx %04xZero length ??? halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data mtestsimple RAM read/write test[start [end [pattern [iterations]]]]infinite loop on address range[.b, .w, .l, .q] address number_of_objectsprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr] -v address count crc - verify crc of memory areacmpmemory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmemory write (fill)[.b, .w, .l, .q] address value [count]memory modify (constant address)[.b, .w, .l, .q] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]%2u %2u-%2u = %5u %sFDXHDXfullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %sMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x mdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)No MMC device available OK, force rescanno mmc device at slot %x set dsr %s YesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Bus Speed: %d Mode: %s card capabilitieshost capabilitiesRd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: HC WP Group Size: User Capacity: WRREL Boot Capacity: RPMB Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state Invalid RST_n_ENABLE value RST_n_FUNCTION only exists on eMMC PARTITION_CONFIG only exists on eMMC No part_config info for ver. 0x%x EXT_CSD[179], PARTITION_CONFIG: BOOT_ACK: 0x%x BOOT_PARTITION_ENABLE: 0x%x PARTITION_ACCESS: 0x%x It is not an eMMC device EMMC boot partition Size change Failed. EMMC boot partition Size %d MB EMMC RPMB partition Size %d MB BOOT_BUS_WIDTH only exists on eMMC reset_boot_bus_width %d is invalid BOOT_BUS_WIDTH is failed to change. Set to BOOT_BUS_WIDTH = 0x%x, RESET = 0x%x, BOOT_MODE = 0x%x SD doesn't support partitioning userenhwrrelgpPartition configuration: User Enhanced Start: User Enhanced Size: No enhanced user data area User partition write reliability: %s GP%i Capacity: No GP%i partition GP%i write reliability: %s Partitioning successful, power-cycle to make effective Failed! #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device get mmc type error! MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s boot areas protected MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp - power on write protect boot partitions mmc hwpartition - does hardware partitioning arguments (sizes in 512-byte blocks): USER - <{on|off}> : sets user data area attributes GP - <{gp1|gp2|gp3|gp4}> <{on|off}> : general purpose partition MODE - <{check|set|complete}> : mode, complete set partitioning completed WARNING: Partitioning is a write-once setting once it is set to complete. Power cycling is required to initialize partitions after set to complete. mmc bootbus - Set the BOOT_BUS_WIDTH field of the specified device mmc bootpart-resize - Change sizes of boot and RPMB partitions of specified device mmc partconf [[varname] | [ ]] - Show or change the bits of the PARTITION_CONFIG field of the specified device If showing the bits, optionally store the boot_partition field into varname mmc rst-function - Change the RST_n_FUNCTION field of the specified device WARNING: This is a write-once field and 0 / 1 / 2 are the only valid values. mmc setdsr - set DSR register value wperasehwpartitionbootbusbootpart-resizepartconfrst-functionsetdsrCore num: %lu is not valid disablecpuMultiprocessor CPU boot manipulation and releasebootfilehostnamerootpathdnsipdomainactiveeth%d : %s %pM %s ping failed; host %s is not alive host %s is alive NET sub-systemlist - list available devices pingsend ICMP ECHO_REQUEST to network hostpingAddressdhcpboot image via network using DHCP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpbootboot image via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocol-bootableUnknown option %s %s%x0x%xSupported partition tables%c %s: disk partition related commandsuuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition table part list [flags] - set environment variable to the list of partitions flags can be -bootable (list only bootable partitions) part start - set environment variable to the start of the partition (in blocks) part can be either partition number or partition name part size - set environment variable to the size of the partition (in blocks) part can be either partition number or partition name part number - set environment variable to the partition number using the partition name part must be specified as partition name part types - list supported partition table types| %-*.*s| %-*.*s| %s ParentDriverOps get_pins_count not supported by %s Ops get_pin_name error (%d) by %s Ops get_pin_muxing error (%d) by %s in %s %-*s: %-*s pin-controller device not selected %s not found Can't get the pin-controller: %s! Pin-controller device is not set! dev: %s pinmuxshow pin-controller muxinglist - list UCLASS_PINCTRL devices pinmux dev [pincontroller-name] - select pin-controller device pinmux status [-a | pin-name] - print pin-controller muxing [for all | for pin-name] tftppxefile_addr_rInvalid pxefile address: %s pxeuuidConfig file '%s' found Config file not found pxecommands to get and boot from pxe filesget - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] - boot from the pxe file at pxefile_addr_r default-arm-mx6-apalis_imx6default-arm-mx6default-armCannot find SATA device %d (err=%d) Cannot remove SATA device '%s' (err=%d) Cannot probe SATA device %d (err=%d) No SATA device found! Cannot scan SATA device %d (err=%d) stopinitSATA sub systeminit - init SATA sub system sata stop [dev] - disable SATA sub system or device sata info - show available SATA devices sata device [dev] - show or set current device sata part [dev] - print partition table sata read addr blk# cnt sata write addr blk# cnt## error: substitution buffer overflow Error compiling regex: %s %s: No match ## error: pattern buffer overflow: have %d, need %d ## Error: variable "%s" not defined ## error: subst buffer overflow: have %d, need %d %s=%s fmtgsubCould not set var invalid op setexprset environment variable as the result of eval expression[.b, .w, .l, .s] name [*]value1 [*]value2 - set environment variable 'name' to the result of the evaluated expression specified by . can be &, |, ^, +, -, *, /, % (for strings only + is supported) size argument is only meaningful if value1 and/or value2 are memory addresses (*) setexpr[.b, .w, .l] name [*]value - load a value into a variable setexpr name gsub r s [t] - For each substring matching the regular expression in the string , substitute the string . The result is assigned to . If is not supplied, use the old value of setexpr name sub r s [t] - Just like gsub(), but replace only the first matching substring-pext2fatanyInvalid filesystem: %s Error reading config file sysbootcommand to get and boot from syslinux files[-p] [addr] [filename] - load and parse syslinux menu file 'filename' from ext2, fat or any filesystem on 'dev' on 'interface' to address 'addr' time: %lu minutes, %lu.%03lu seconds run commands and summarize execution timecommand [args...] truedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-z-eSee InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudioHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d 12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dmsstarting USB... resetting USB... serialstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr' Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** Fit image detected... ** Unknown image type ** Bad FIT image format UMS disk %dUMS: LUN %d, dev %s %d, hwpart %d, sector %#x, count %#x Couldn't init USB controller. fsg_init failed usb_dnl_umsg_dnl_register failed Please connect USB cable. CTRL+C - Operation aborted. USB cable not detected. Command exit. Auto exit in: %.2d s. Check USB cable connection CTRL+C - Operation aborted Use the UMS [USB Mass Storage] [] e.g. ums 0 mmc 0 devtype defaults to mmcusb_dnl_sdpSDP dnl register failed: %d SDP init failed: %d SDP ended Serial Downloader Protocol - serial downloader protocol via ${Error insufficient memory gpt_partition_listuuid_disk=name=,start=MiB,size=MiB,uuid=;uuid_diskError: is the partitions string NULL-terminated? Wrong uuid format for partition %d '%s' is not a number %s: %s dev %d NOT available Writing GPT: No partition list provided Partition list incomplete No partition list provided - only basic check Verify GPT: setenvgpt_partition_addrgpt_partition_sizegpt_partition_entrygpt_partition_nameenumerateguidsuccess! gptGUID Partition Table - GUID partition table restoration and validity check Restore or verify GPT information on a device connected to interface Example usage: gpt write mmc 0 $partitions - write the GPT to device gpt verify mmc 0 $partitions - verify the GPT on device against $partitions gpt setenv mmc 0 $name - setup environment variables for partition $name: gpt_partition_addr, gpt_partition_size, gpt_partition_name, gpt_partition_entry gpt enumerate mmc 0 - store list of partitions to gpt_partition_list environment variable read - read GPT into a data structure for manipulation gpt guid - print disk GUID gpt guid - set environment variable to disk GUID Example usage: gpt guid mmc 0 gpt guid mmc 0 varname | %-*.*s| %-*.*s| %s @ %s seqParent uclassParent name| %-*.*s| %-*.*s| %s @ %d Error: %d (%s) Can't get PMIC: %s! PMIC device is not set! dev: %d @ %s First, set the PMIC device! Dump pmic: %s registers %%%d.%dx Can't read register: %d 0x%02x: --PMIC max reg: %d Can't read PMIC register: %d! 0x%%02x: 0x%%%d.%dx Can't write PMIC register: %d! PMIC sub-systemlist - list pmic devices pmic dev [name] - show or [set] operating PMIC device pmic dump - dump registers pmic read address - read byte of register at address pmic write address - write byte to register at address First, set the regulator device! Regulator: %s - missing platform data! Operation not allowed for fixed regulator! regulator-name%-*s %s (err: %d) * regulator-name:Regulator info:%s %-*s %s %-*s %s %-*s %s %-*s %s %-*s * constraints:* parent uclass:* parent name:* device name: - min uV: - max uV: - min uA: - max uA: - always on: - boot on:* op modes: - mode id:Can't get the regulator: %s! Regulator device is not set! %s: no regulator platform data! dev: %s @ %s Regulator: %s - can't get the Voltage! -fValue exceeds regulator constraint limits %d..%d uV Regulator: %s - can't set the Voltage! Regulator: %s - can't get the Current! %d uA Current exceeds regulator constraint limits Regulator: %s - can't set the Current! Regulator: %s - can't get the operation mode! mode id: %d Regulator: %s - can't set the operation mode! Regulator: %s - can't enable! Regulator: %s - can't disable! enableddisabledRegulator %s status: * enable: * value uV: * current uA: * mode id:uVEnabled%-20s %-10s %10s %10s %-10s ModemA%-20s %-10s %10d %10s %-10suclass operationslist - list UCLASS regulator devices regulator dev [regulator-name] - show/[set] operating regulator device regulator info - print constraints info regulator status [-a] - print operating status [for all] regulator value [val] [-f] - print/[set] voltage value [uV] (force) regulator current [val] - print/[set] current value [uA] regulator mode [id] - print/[set] operating mode id regulator enable - enable the regulator output regulator disable - disable the regulator output current## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Resetting to default environment ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d edit: Please enter '%s': ## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'askenvget environment variables from stdinname [message] [size] - get environment variable 'name' from stdin (max 'size' chars)set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportexistssaveenvsave environment variables to persistent storageNo CLI availablesyntax error ERROR : xmalloc failed ERROR : xrealloc failed ** Abort Apalis iMX6 # *?[\%s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS\$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodonebootlimitWarning: Bootlimit (%lu) exceeded. Using altbootcmd.altbootcmdkernel-offsetkernaddrrootdisk-offsetrootaddrHit any key to stop autoboot: %2d  0%2d DRAM: baudrateinitcall sequence %p failed at call %p (err=%d) Net: load-environmentMMC: #size-cells%s: Bad cell count for %s %s: %s: %s fdt_root: %s WARNING: could not set serial-number %s. fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not set bootargs %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. /aliasesetherneteth%daddrlocal-mac-addressranges/__symbols__failed on fdt_overlay_apply(): %s base fdt does did not have a /__symbols__ node make sure you've compiled with -@ The address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dNULL device name! mdio_register: non unique device name '%s' %x - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY extended status read failed, assuming no 1000BASE-X PHY 1000BT statusPHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T 1000BASE-X PHY AN duplexPHY duplexPHY AN adv duplex read failed, assuming half duplex unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) %s: invalid max packet size unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dusb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) Error: Cannot find high speed parent of usb-1 device cannot reset port %i!? usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times usb_hubusb-hub Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry lun%dusb_storage_blkusb_mass_storageusb-mass-storagesplashimageError: bad 'splashimage' address splashposEnter choice: usbkbdnulldev%s: warning, ret=%dUSB KBD: Error allocating private data Failed to get keyboard state from device %04x:%04x usb_kbdusb-keyboard%.*s%*sstdoutstderry Y yes YES In: No input devices available! Out: No output devices available! Err: No error devices available! pre-reloc realloc() is not supportedalloc space exhausted %s for %08lx ... %08lx ==> Unknown hash algorithm '%s' HASH_MAX_DIGEST_SIZE exceeded Expected %d hex digits in env var ERROR: %s does not contain a valid %s sum != ** ERROR ** md5sha1sha256crc16-ccittvidconsoleFailed to probe keyboard '%s' bootsecure## Error: Secure boot command not specified ## Error: "%s" returned (code %d) %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Supports 48-bit addressing Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available ## Unknown partition table type %x Partition Map for IDESATAATAPIUSBDOCHOSTNVMePV BLOCKVirtIOEFIUNKNOWN device %d -- Partition Type: %s Whole Disk** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") Could not find "%s" partition Couldn't find partition %s %s xx%s%c%dhdusbddocdmmcsdFATFAT32** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %08x-%02x Extd Boot%3d %-10lu %-10lu %08x-%02x %02x%s%s Part Start Sector Num Sectors UUID Type DOS** First descriptor is NOT a primary desc on %d:%d ** CD001** Wrong ISO Ident: %s on %d:%d ** EL TORITO SPECIFICATION** No valid boot catalog found on %d:%d ** ** Wrong El Torito ident: %s on %d:%d ** ** Can't read Boot Entry at %lX on %d:%d ** ** Checksum Error in booting catalog validation entry on %d:%d ** ** Key 0x55 0xAA error on %d:%d ** ** Partition %d not found on device %d ** ** Partition %d is not bootable on device %d ** ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s ISO%s: Invalid Argument(s) GUID Partition Table Header%s signature is wrong: 0x%llX != 0x%llX %s CRC is wrong: 0x%x != 0x%x GPT: my_lba incorrect: %llX != %lx GPT: first_usable_lba incorrect: %llX > %lx GPT: last_usable_lba incorrect: %llX > %lx GUID Partition Table Entry Array CRC is wrong%s: 0x%x != 0x%x *** ERROR: Can't read MBR header *** *** ERROR: Can't read GPT header *** %s: ERROR: Can't allocate %#lX bytes for GPT Entries *** ERROR: Can't read GPT Entries *** GPT: Failed to allocate memory for PTE %s: *** ERROR: Invalid GPT *** %s: *** ERROR: Invalid Backup GPT *** %s: *** Using Backup GPT *** Part Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %s guid: %s %s: calloc failed! ** Can't read from device %d ** ** Can't write to device %d ** Partition overlap Partitions layout exceds disk size Partition no. %d: invalid guid: %s u-boot,efi-partition-entries-offset%s: *** ERROR: Misplaced Backup GPT *** More partitions than allowed! Partition name: %s does not match %s! Partition %s size: %llu does not match %llu! Partition %s start: %llu does not match %llu! upgrade_availableunbind() method failed on dev '%s' on error path Failed to unbind dev '%s' on error path %s: null device %s: Device '%s' failed to remove on error path No match for driver '%s' compatibleDevice tree error at node '%s' Error binding driver '%s': %d Some drivers failed to bind Virtual root driver does not exist! Virtual root driver already exists! Some drivers were not found /clocks/firmwarerootroot_drivernoplist_empty(&dr->entry)!rcdevice '%s' failed to unbind %s: Device '%s' failed to remove, but children are gone %s: Device '%s' failed child_post_remove()simple_bussimple-bussimple-mfd %-10.10s %3d [ %c ] %-20.20s | `-- |-- Class Index Probed Driver Name ----------------------------------------------------------- uclass %d: %s %-3i %c %s @ %08lx, seq %dDriver Compatible %-20.20s%-20.20s %s Driver uid uclass Devices %-25.25s %-3.3d %-20.20s %-51.51s%-25.25s Driver Address %-25.25s @%08lx u-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tpl/config%s: %s: error: gpio %s%d not reserved get_valueset_valueset_dir_flags%s.%s%d%s.%s#gpio-cells%s%d: %s: %d [%c]%s%sinputoutputunusedfuncGPIO%d_gpio_mxcfsl,imx35-gpiou-boot,i2c-transaction-bytesgeneric_%xi2c_generic_chip_drvclock-frequencyu-boot,i2c-offset-leni2c-chipi2c_generic%s: Arbitration lost sr=%x cr=%x state=%x %s: failed sr=%x cr=%x state=%x %s:trigger stop failed %s: failed to clear bus, sda=%d scl=%d %s: failed for chip 0x%x retry=%d %s: give up i2c_regs=0x%lx pinctrl-namesscl-gpiossda-gpios%s %s: i2c bus %d at 0x%2lx, fail to request scl/sda gpio udevice *)(NULLi2c_mxcfsl,imx21-i2cfsl,vf610-i2cError enabling VMMC supply : %d Unknown modeStatus Error: 0x%08x Timeout waiting card ready MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd eMMC >= 4.4 required for enhanced user data area Card does not support partitioning Card does not define HC WP group size User data enhanced area not HC WP group size aligned GP%i partition not HC WP group size aligned Card does not support enhanced attribute Total enhanced size exceeds maximum (%u > %u) Card does not support host controlled partition write reliability settings Card already partitioned vmmc-supplyvqmmc-supplyCard did not respond to voltage select! : %d MMC: no card present unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d Man %06x Snr %04x%04x%c%c%c%c%c%c%s - probe failed: %d MMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)bus-widthmax-frequencycap-sd-highspeed%s %s: Invalid "bus-width" value %u! cap-mmc-highspeedsd-uhs-sdr12sd-uhs-sdr25sd-uhs-sdr50sd-uhs-sdr104sd-uhs-ddr50mmc-ddr-1_8vmmc-ddr-1_2vmmc-hs200-1_8vmmc-hs200-1_2vmmc-hs400-1_8vmmc-hs400-1_2vmmc-hs400-enhanced-strobenon-removablecd-invertedbroken-cdno-1-8-vMMC Device %d not found eMMC%s: %d (%s)mmc_blk Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed fsl,tuning-stepfsl,tuning-start-tapfsl,strobe-dll-delay-targetfsl,signal-voltage-switch-extra-delay-mscd-gpiosfsl,wp-controllerwp-gpios%s %s: fail to enable vqmmc-supply The SD card is locked. Can not write to a locked card. CMD11 to switch to 1.8V mode failed, card requires power cycle. Timeout waiting for DAT0 to go high! fsl,esdhc%s %s: Unable to get clk for %s MMC/SD: Reset never completed. FSL_SDHCvoltage not supported by controller %s %s: fsl_esdhc_init failure fsl_esdhcfsl,imx51-esdhcfsl,imx53-esdhcfsl,imx6ul-usdhcfsl,imx6sx-usdhcfsl,imx6sl-usdhcfsl,imx6q-usdhcfsl,imx7d-usdhcfsl,imx7ulp-usdhcfsl,imx8qm-usdhcfsl,imx8mm-usdhcfsl,imx8mn-usdhcfsl,imx8mq-usdhcfsl,imxrt-usdhc%s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done (null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYsgmii-2500qsgmiirmiirgmiirgmii-idrgmii-rxidrgmii-txidrtbi1000base-x2500base-xrxauisfiinternal25g-auixlaui4caui2caui4NC-SI10gbase-rusxgmiiethernet-phydisable_gigaMicrel ksz9131Micrel ksz9031Micrel ksz9021rxc-skew-pstxc-skew-pstxen-skew-psrxdv-skew-pstxd0-skew-pstxd1-skew-pstxd2-skew-pstxd3-skew-psrxd0-skew-psrxd1-skew-psrxd2-skew-psrxd3-skew-psWrite MDIO failed... Read MDIO failed... phy-modephy-supplyphy-reset-gpiosphy-reset-durationFEC MXC: phy reset duration should be <= 1000ms phy-reset-post-delayFEC MXC: phy reset post delay should be <= 1000ms Payload (%d) too large Can't find FEC0 clk rate: %d Could not initialize PHY %s %s: error allocating packetp some error: 0x%08lx FECFEC%imdio_alloc failed mdio_register failed %s: error allocating rxbuf %d %s: Error enabling phy supply FEC MXC: Timeout reseting chip Unsupported interface type %d defaulting to %d phy-handlefixed-linkfecmxcfsl,imx28-fecfsl,imx6q-fecfsl,imx6sl-fecfsl,imx6sx-fecfsl,imx6ul-fecfsl,imx53-fecfsl,imx7d-fecfsl,mvf600-fecgpio-controllerpinconfigpinctrl-%d%s %s: could not find pctldev pinctrlfsl,pins%s %s: No fsl,pins property in node %s %s %s: Invalid fsl,pins property in node %s %s %s: Error reading pin data. %s %s: Error mux_reg or conf_reg %s %s: wrong pinctrl info fsl,mux_maskfsl,input-sel%s %s: iomuxc fsl,input-sel property not found fsl_imx6q_iomuxcfsl,imx6q-iomuxcfsl,imx6dl-iomuxcfsl,imx6sl-iomuxcfsl,imx6sll-iomuxc-snvsfsl,imx6sll-iomuxcfsl,imx6sx-iomuxcfsl,imx6ul-iomuxcfsl,imx6ull-iomuxc-snvswrite error to device: %p register: %#x! regulatorspfuze100 pmicfsl,pfuze100fsl,pfuze200fsl,pfuze3000pfuze100_regulatorregulator-min-microvoltregulator-max-microvoltregulator-init-microvoltregulator-min-microampregulator-max-microampregulator-always-onregulator-boot-onregulator-ramp-delayregulator-force-boot-offregulator-state-memregulator-off-in-suspendregulator-suspend-microvoltswbstvrefddrLDO_MODE_OFFLDO_MODE_ONSWBST_MODE_OFFSWBST_MODE_PFMSWBST_MODE_AUTOSWBST_MODE_APSOFF_OFFPWM_OFFPFM_OFFAPS_OFFPWM_PWMPWM_APSAPS_APSAPS_PFMPWM_PFMsw1asw1bsw2sw3vsnvsvldo1vldo2vccsdv33vldo3vldo4sw1absw3asw3bvgen1vgen2vgen3vgen4vgen5vgen6sw1csw4enable-active-highstartup-delay-usu-boot,off-on-delay-usCan't set regulator : %s gpio to: %d regulator_fixedregulator-fixedstdout-pathNo serial driver found## Baudrate %d bps not supported ## Switch baudrate to %d bps and press ENTER ... ## Baudrate may not be deleted fsl,dte-modefsl,imx21-uartfsl,imx53-uartfsl,imx6sx-uartfsl,imx6ul-uartfsl,imx7d-uartfsl,imx6q-uart1.564bit ncq ilck stag pm clo nz only pmp pio slum part AHCI %02x%02x.%02x%02x %u slots %u ports %s Gbps 0x%x impl %s mode flags: %s%s%s%s%s%s%s%s%s%s%s%s%s No port device detected! No Link on this port! No mem for table! Can not start port %d Can't find empty command slot! timeout exit! SATA Device Info: S/N: %s Product model number: %s Firmware version: %s Capacity: %lu sectors dwc_ahsata_blkdwc_ahsata_ahcifsl,imx6q-ahci IDE device %d: Device %d: unknown device scsiatapidocnvmeefiloaderpvblockvirtiomxc_ocotp %s(): Access protect error mxc_ocotp %s(): Invalid argument mxc_ocotp %s(): fuse sense is disabled backlightvidconsole0Video device '%s' cannot allocate frame buffer memory -ensure the device is set up before relocation %s.vidconsole%dvideolcdputsprint string on video framebuffer setcursset cursor position within screen in characterError: no valid bmp image at %lx Error: %d bit/pixel mode, but BMP has %d bit/pixel Error: only support 16 bpixpower-supplyenable-gpiossimple_panelsimple-panelauo,b133xtn01auo,b116xw03auo,b133htn01boe,nv140fhmn49lg,lb070wv8sharp,lq123p1jx31boe,nv101wxmn51Unable to allocate framebuffer memory pixclock set for 60Hz refresh = %u ps mxcfb: Error initializing panel. ipu_init_channel_buffer error %d fsl_imx6q_ipufsl,imx6q-ipuipu software reset timeout Warning: channel already initialized %d Missing channel initialization Channel %d is not disabled, disable first Warning: channel already enabled %d Stride not 32-bit aligned, stride = %d mxc ipu: unimplemented pixel format The value of U offset exceeds IPU limitation The value of V offset exceeds IPU limitation pixel_clkldb_clkipu_clk%s: invalid channel %d DI%d counters out of range. DMFC high resolution has set, will not change WARNING: v_end_width (lower_margin) must be >= 2, adjusted CPU Temperature (%dC) too close to max (%dC) waiting... dr_modephy_typeutmiutmi_wideulpihsiclow-speedfull-speedhigh-speedwirelesssuper-speedsuper-speed-plusperipheralotg%s: ep0 transaction already in progress EP%d/%s FAIL info=%x pg0=%x ci_udcep0ep1in-bulkep2out-bulkep3in-intep-!cdev->configcompositeusb_dnload%s: failed!, error: %d serialno | / - \invalid number of LUNs: %u Linux %-8s%-16s%04xFile-Store GadgetMass Storage Function, H%c=%unwritten:%zd amount:%u Unknown x%02xStatus: %d Wrong State: %d Unexpected report %d Invalid state: %d Reading %d registers at 0x%08x... Downloading file of size %d to 0x%08x... Unknown command: %04x SDP: initialize... SDP: handle requests... Jumping to header at 0x%08x Header Tag is not an IMX image script@1Jumping to 0x%08x error in submission: %s usb,device-classusb,interface-classgeneric_bus_%x_dev_%xusb_dev_generic_drvscanning bus %s for devices... No USB Device found %d USB Device(s) found Bus %s: Port not available. probe failed, error %d No working controllers found usb_dev_genericEHCI fail timeout STS_ASS reset out of buffer pointers (%zu bytes left) EHCI failed: timeout when disabling periodic list EHCI failed: timeout when enabling periodic list EHCI failed to shut down host controller. %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue Timeout poll on interrupt endpoint unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error EHCI fail to reset USB EHCI %x.%02x fsl,usbphyfsl,usbmiscfsl,anatopvbus-supplyError enabling VBUS supply (ret=%i) ehci_mx6fsl,imx27-usbfsl,imx7d-usbfsl,imxrt-usbenv_buf [%u bytes] too small for value of "%s" %pMmissing environment variable: %s *** Warning - %s, using default environment bad CRCCannot import environment: errno = %d import failed${...}Loading Environment from %s... not initialized Failed (%d) Saving Environment to %s... not possible ^%s$eth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,.callbacksu-boot,mmc-env-partitionu-boot,mmc-env-offsetNo MMC card foundNo block deviceMMC partition switch failedWriting to %sMMC(%d)... !read failed** Unable to write file %s ** %s/ %s %8lld %s %d file(s), %d dir(s) ** Unable to create link %s -> %s ** Can't set block device ** No boot file defined ** ** Reading file would overwrite reserved memory ** Failed to load '%s' %llu bytes read in %lu ms (fileaddr%llu bytes written in %lu ms** Unable to create a directory "%s" ** Supported filesystemsext4unsupported** Can not find directory. ** ** File not found %s ** part_offset is %lu total_sector is %llu error: overflow occurs no block left to assign No Memory %s: Device read error! no block left assign no block left invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** Block full, trying previous All blocks full: Allocate new Directory uses extents Directory exceeds limit no inode left to assign Badly aligned ext2_dirent Please supply Absolute path Invalid path It is a Directory file found, deleting Failed to iterate over directory %s < ? > %10u %s Failed to mount ext2 filesystem... Error in ext4fs_log_gdt Error in getting the block group descriptor table error in File System init Unsupported feature metadata_csum found, not writing. hash tree directory No memory Not enough space on partition !!! Error in copying content ** Cannot support non-zero offset ** ** Error ext4fs_write() ** Invalid input arguments %s buffer ptr is NULL _get_node: malloc failed Journal Recovery Completed Journal Scan Completed Recovery required File System is consistent update journal finished Error: Invalid FAT entry: 0x%08x FAT32 FAT12 FAT16 Error: FAT sector size mismatch (fs=%hu, dev=%lu) Error: FAT cluster size not set Error: FAT cluster size too big (cs=%u, max=%u) Error: writing directory entry <>:"/\|?*Error get-and-setting cluster Error: no space left: %llu U%.*s.%.3s~%dNo current device Interface: %s No valid FAT fs found Filesystem: %s "%s" Invalid FAT entry Error reading cluster ** Unable to read file %s ** %02X%02X-%02X%02XFAT: illegal filename (%s) %s: doesn't exist (%d) Error: writing contents Error: flush fat buffer Error: allocating memory Error: cannot remove root %s: doesn't exist Error: directory is not empty: %d %s: already exists . .. ** Invalid Block Device Descriptor (NULL) %s read outside partition %lu ** %s read error ** ** %s read error - block * %s read error - last part Cannot free EFI memory pool EFI protocol GUID missing for driver '%s' Failed to add EFI driver %s efiblk#%defi_blkEFI block driverInvalid load option for %ls Loading %ls '%ls' failed Booting: %ls Unloading image failed BootNext must be 16-bit integer Loading from BootNext failed, falling back to BootOrder Deleting BootNext failed BootOrder not defined ERROR: Failure to install protocols for loaded image EFI application exited[?25%c[%d;%dH[%u;%u;%um78ERROR: Failed to register WaitForKey event ERROR: Failed to register console event ERROR: Failed to set console timer ERROR: Out of memory NetUartUNKNOWN(%04x,%04x)MemoryMapped(0x%x,0x%llx,0x%llx)VenHw(%pUlAcpi(PNP%04X,%d)Ata(%d,%d,%d)Scsi(%u,%u)Uart(%lld,%d,%d,1.5)USB(0x%x,0x%x)MAC(UsbClass(0x%x,0x%x,0x%x,0x%x,0x%x)Sata(0x%x,0x%x,0x%x)NVMe(0x%x,%s%02xUri(%s(%u)HD(%d,MBR,0x%08x,0x%llx,0x%llx)HD(%d,GPT,%pUl,0x%llx,0x%llx)HD(%d,0x%02x,0,0x%llx,0x%llx)CDROM(%u,0x%llx,0x%llx)VenMedia(%pUl%-.*lsReserved memory mapping failed addr %llx size %llx ///./..bad file path! invalid image type: %u UEFI image [0x%p:0x%p] pc=0x%zx '%pD'Not a PE-COFF file Invalid number of sections: %d Invalid optional header magic %x Unknown Relocation off %x type %x Machine type 0x%04x is not supported %s: illegal free 0x%llx, 0x%zx %s: illegal free 0x%p en-USEFI: cannot initialize platform language settings %04XERROR: Secure state transition failed No EFI system partition %x:%xCannot read EFI system partition ubootefi.varFailed to persist EFI variables Invalid EFI variables file Failed to set EFI variable %ls Failed to load EFI variables EFI: Watchdog timeout ERROR: Failed to register watchdog event ERROR: Failed to set watchdog timer ERROR: Failure adding GOP protocol %s:%xAdding partition %s failed Scanning disk %s... Disk %s not ready ERROR: failure to add disk device %s, r = %lu Found %d disks ERROR: Failed to register network event ERROR: Failed to set network timer ERROR: Failure to add protocol Cannot create SMBIOS table Can't find initrd specified in Boot#### linux,phandleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGS#address-cellstarget-path/__local_fixups__/__fixups__/__overlay__//__overlay__Unknownmanufacturer2022.01-OpenWrt-r32912-6639b15f6201/01/2022productUnknown Productasset-tagskufamilysmbios_SM__DMI_baseboardchassislist passed to list_sort() too long for efficiency invalid distance too far backinvalid distance codeinvalid literal/length codeunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkError: Bad gzipped data Error: gunzip out of data in header 1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d okayNo valid device tree binary found at %p ## ERROR: unsupported match method: 0x%02x Env export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! , Build: %s%llu Hz%s%lu.%ld %cHz%s%u Bytes%s %ciB%s %0*lx### ERROR ### Please RESET the board ### %s.cnt = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x lmb_dump_all: ERROR: Failed to allocate 0x%lx bytes below 0x%lx. RE is too long (code overflow)RE is too long (data overflow)unknown cmd (%d) at %d Jump offset is too bigNo closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\%s:%u: %s: Assertion `%s' failed.## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d U-Boot.armv7bootp_archInvalid pxeuuid: %s bootp_vciHost Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again Error: eth device name "%s" has a space! Error: %s address %pM illegal value Warning: %s failed to set MAC address Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s address not set. ethactethrotateethprimeeth%d: %s [PRIME]%s%daddr%saddreth%dmacskipethmacskipnetretryonce ICMP Host Redirect to %pI4 *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set autoloadCannot autoload with TFTPGET Abort Bytes transferred = %d (%x hex) %d.%d.%d.%dnvlanUsing %s device octetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedblksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... done TFTP error: '%s' (%d) Not retrying... Retry count exceeded %s; starting again T tftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' fromTFTP %s server %pI4; our IP address is %pI4; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *  bootcmd=run distro_bootcmdbootdelay=1baudrate=115200ipaddr=192.168.10.2serverip=192.168.10.1netmask=255.255.255.0loadaddr=0x12000000arch=armcpu=armv7board=apalis_imx6board_name=apalis_imx6vendor=toradexsoc=mx6mmc_boot=if mmc dev ${devnum}; then devtype=mmc; run scan_dev_for_boot_part; fiboot_net_usb_start=usb startusb_boot=usb start; if usb dev ${devnum}; then devtype=usb; run scan_dev_for_boot_part; fisata_boot=if sata dev ${devnum}; then devtype=sata; run scan_dev_for_boot_part; fiboot_efi_bootmgr=if fdt addr ${fdt_addr_r}; then bootefi bootmgr ${fdt_addr_r};else bootefi bootmgr;fiboot_efi_binary=load ${devtype} ${devnum}:${distro_bootpart} ${kernel_addr_r} efi/boot/bootarm.efi; if fdt addr ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r};else bootefi ${kernel_addr_r} ${fdtcontroladdr};fiload_efi_dtb=load ${devtype} ${devnum}:${distro_bootpart} ${fdt_addr_r} ${prefix}${efi_fdtfile}efi_dtb_prefixes=/ /dtb/ /dtb/current/scan_dev_for_efi=setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; for prefix in ${efi_dtb_prefixes}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${efi_fdtfile}; then run load_efi_dtb; fi;done;run boot_efi_bootmgr;if test -e ${devtype} ${devnum}:${distro_bootpart} efi/boot/bootarm.efi; then echo Found EFI removable media binary efi/boot/bootarm.efi; run boot_efi_binary; echo EFI LOAD FAILED: continuing...; fi; setenv efi_fdtfileboot_prefixes=/ /boot/boot_scripts=boot.scr.uimg boot.scrboot_script_dhcp=boot.scr.uimgboot_targets=mmc1 mmc2 mmc0 usb0 dhcp boot_syslinux_conf=extlinux/extlinux.confboot_extlinux=sysboot ${devtype} ${devnum}:${distro_bootpart} any ${scriptaddr} ${prefix}${boot_syslinux_conf}scan_dev_for_extlinux=if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${boot_syslinux_conf}; then echo Found ${prefix}${boot_syslinux_conf}; run boot_extlinux; echo SCRIPT FAILED: continuing...; fiboot_a_script=load ${devtype} ${devnum}:${distro_bootpart} ${scriptaddr} ${prefix}${script}; source ${scriptaddr}scan_dev_for_scripts=for script in ${boot_scripts}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${script}; then echo Found U-Boot script ${prefix}${script}; run boot_a_script; echo SCRIPT FAILED: continuing...; fi; donescan_dev_for_boot=echo Scanning ${devtype} ${devnum}:${distro_bootpart}...; for prefix in ${boot_prefixes}; do run scan_dev_for_extlinux; run scan_dev_for_scripts; done;run scan_dev_for_efi;scan_dev_for_boot_part=part list ${devtype} ${devnum} -bootable devplist; env exists devplist || setenv devplist 1; for distro_bootpart in ${devplist}; do if fstype ${devtype} ${devnum}:${distro_bootpart} bootfstype; then run scan_dev_for_boot; fi; done; setenv devplistbootcmd_mmc1=devnum=1; run mmc_bootbootcmd_mmc2=devnum=2; run mmc_bootbootcmd_mmc0=devnum=0; run mmc_bootbootcmd_usb0=devnum=0; run usb_bootbootcmd_dhcp=devtype=dhcp; if dhcp ${scriptaddr} ${boot_script_dhcp}; then source ${scriptaddr}; fi;setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; setenv efi_old_vci ${bootp_vci};setenv efi_old_arch ${bootp_arch};setenv bootp_vci PXEClient:Arch:00010:UNDI:003000;setenv bootp_arch 0xa;if dhcp ${kernel_addr_r}; then tftpboot ${fdt_addr_r} dtb/${efi_fdtfile};if fdt addr ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r}; else bootefi ${kernel_addr_r} ${fdtcontroladdr};fi;fi;setenv bootp_vci ${efi_old_vci};setenv bootp_arch ${efi_old_arch};setenv efi_fdtfile;setenv efi_old_arch;setenv efi_old_vci;distro_bootcmd=for target in ${boot_targets}; do run bootcmd_${target}; donebootcmd=run distro_bootcmd ; usb start ; setenv stdout serial,vidconsole; setenv stdin serial,usbkbdboot_file=zImageconsole=ttymxc0defargs=enable_wait_mode=off vmalloc=400Mfdt_file=imx6q-apalis-eval.dtbfdtfile=imx6q-apalis-eval.dtbfdt_fixup=;bootm_size=0x20000000fdt_addr_r=0x12100000kernel_addr_r=0x11000000pxefile_addr_r=0x17100000ramdisk_addr_r=0x12200000scriptaddr=0x17000000nfsargs=ip=:::::eth0:on root=/dev/nfs ronfsboot=run setup; setenv bootargs ${defargs} ${nfsargs} ${setupargs} ${vidargs}; echo Booting via DHCP/TFTP/NFS...; run nfsdtbload; dhcp ${kernel_addr_r} && run fdt_fixup && bootz ${kernel_addr_r} ${dtbparam}nfsdtbload=setenv dtbparam; tftp ${fdt_addr_r} ${fdt_file} && setenv dtbparam " - ${fdt_addr_r}" && trueuboot_hwpart=1uboot_blk=8auboot_spl_blk=2set_blkcnt=setexpr blkcnt ${filesize} + 0x1ff && setexpr blkcnt ${blkcnt} / 0x200update_uboot=run set_blkcnt && mmc dev 0 ${uboot_hwpart} && mmc write ${loadaddr} ${uboot_blk} ${blkcnt}update_spl=run set_blkcnt && mmc dev 0 ${uboot_hwpart} && mmc write ${loadaddr} ${uboot_spl_blk} ${blkcnt}setethupdate=if env exists ethaddr; then; else setenv ethaddr 00:14:2d:00:00:00; fi; tftpboot ${loadaddr} flash_eth.img && source ${loadaddr}setsdupdate=setenv interface mmc; setenv drive 1; mmc rescan; load ${interface} ${drive}:1 ${loadaddr} flash_blk.img || setenv drive 2; mmc rescan; load ${interface} ${drive}:1 ${loadaddr} flash_blk.img && source ${loadaddr}setup=setenv setupargs fec_mac=${ethaddr} consoleblank=0 no_console_suspend=1 console=tty1 console=${console},${baudrate}n8 setupdate=run setsdupdate || run setusbupdate || run setethupdatesetusbupdate=usb start && setenv interface usb; setenv drive 0; load ${interface} ${drive}:1 ${loadaddr} flash_blk.img && source ${loadaddr}splashpos=m,msplashimage=0x12000000vidargs=mxc_hdmi.only_cea=1 fbmem=32M0123456789ABCDEFuoin'hUh=OtUR1harocsdxbim Mass Storage0123456789abcdef+,<=>:;"/\|?*[]Toradex #(-27?2H53F6CDBALinux U-Boot 2022.01-OpenWrt-r32912-6639b15f62 (May 04 2026 - 22:30:45 +0000)~~~~l|88||8<<<<~~<<<><~~<fffffffff{|`8ll8 |<~~<~<~~< 0``0(ll(88||||88<<<fff$lllllll||| 0`Ɔ8ll8vv000` 000000 0 0f<l8l||||`0||0xv`0v~ x|||||8ld`````ff<~~~p0`x |v 08<0`||0`vvffffffv~8ll8|0000`|`bfl0`܆ >`bfl0fΚ?<<<6ll6l6lDDDDDDDDUUUUUUUUwwwwwwww66666666666666666666666666666666666666666666666666666666666666666666666666666667666666666666670??07666666666666666666666666667076666666666666666666666666666666666666666666??66666666666666666666666vvxllllll`00`~pffffff|``v~ffff<~~~~`0``|```0|~~0  0~ 0`0 ~p~vv8ll8 ll<l66666 - direct component image specification addr# - configuration specification Use iminfo command to get the list of existing component images and configurations. Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OS{=ፁ##9ፁ##)&ፁ##.ፁ ##9ፁ@##9ፁ##9ፁ##9ፁ##=1ፁ##[addr] - run script starting at addr - A valid image header must be present For FIT format uImage addr must include subimage unit name in the form of addr:?I##? ##{##g##print - print current bootcounter reset - reset the bootcounter@ፁu##ፁi## [fdt address] - boot EFI payload stored at address . If specified, the device tree located at gets exposed as EFI configuration table. bootefi bootmgr [fdt address] - load and boot EFI payload based on BootOrder/BootXXXX variables. If specified, the device tree located at gets exposed as EFI configuration table. [addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead 3ፁ##ፁ##EፁE##Eፁ##Eፁ##Fፁ## /addr [-c] [] - Set the [control] fdt location to fdt apply - Apply overlay to the DT fdt boardsetup - Do board-specific set up fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value - Get and store in fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start/end addr NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.bus [muxtype:muxaddr:muxchannel] - show I2C bus info i2c crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length [-s] - write memory to I2C; the -s option selects bulk write in a single transaction i2c flags chip [flags] - set or get chip flags i2c olen chip [offset_length] - set or get chip offset length i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedԅፁ##`ፁ##'Åፁݬ##`ፁ##ፁ##`ፁᴀ##`ፁ##`ፁ紀##`ፁm##;ፁu##sH##ፁ}##`ፁ ##ፁ!##ፁ##@{ـ##;ፁ؀##ڂ؀##sH ؀##݂y׀##tፁЀ##gፁA׀##'ÅIր##ፁ̀##ゅҀ##р##yр##Ѐ##1Ѐ## ̀## reset - Reset cpu cpu status - Status of all cpus cpu status - Status of cpu cpu disable - Disable cpu cpu release [args] - Release cpu at with [args]܀##'Åፁ##ፁ]##軅ፁ##Qፁe##)ፁ##x!'Åፁ=##ፁ##OOፁ##;ፁe##sHፁ##'Åፁ ##ፁ##{ፁ##軅ፁ ##nፁq ##ፁ) ##ፁ ##fqፁ) ##@ፁa ##ask name [message] [size] - ask for environment variable env default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] 0ፁ##!##0I##Q##-####@0ፁu##ֱ0ፁE##V##0####(8¶ BǶ˶ Ѷ  ׶ ڶ U/Y/]0%0o00M/{0s0/Aƃ0w040g0k0//Q/-s)sN D/Bu/m/ooBMa6(LH`]      (8*!!!***333J8fL"|]DDDSSSfffkkkvvv+w3f047Ȗ!-$)-(!-)!%-!!-!-!--!- -! !)-) -&-&!- %)-( %)-(--%-------!-!-!!(%-)(-)% !))+)-%(!(-)% %-&(!--$)-)% )-&-!-!-!!-%-)&-(- (-$-!!--!%-&-!-- -& %-)-- -- !-)$%-)$%---%-!!!!! -!-!-!!-)%%-!%-%&$-$))+!-%%))!%-%& ()!))!----%!%) %-$&--!-!-!!-)%%-!-)!))-()-!!--! ))!)-!---$&&-&&-!-&)&)%--!-!-!!-!%--!-!---%!-!-!--!-(-%--!-!-!!-!%-----$-!!--!--!)) -( -(!!-&-&-%--!-!-!!--%- -&---!%- &)-! ))%- --!-!-!!--!-%--!-!!--!&)-!)--$&-$(!- !-$ !-$%--!-!-!!- -$)&$- !-$- -!)&)&-!-)& -$-!-!-!!- -$!-!--!-!!--!)%-!-%!- - -- !-)-$ )-$ %--!-!-!!)-%-------!%-!-%--!-------!-%-!$--%-%-!-!-!!)-%!-!--!-!!--!-%-!)-(&-%&-!--&-&%--!-!-!!- -$)(-!$-$-$--!)(-!)&-!&- )& -%-!-!-!!--$!-!--!-!!--!)&-!-)-!)))!!-)()(%-----!-$-$-!!--$)--&---!$)-%)-!(-%- --$-$-!!--!-!--!-!!- -!&)-! %-&-%)-%(!-)&)&%-!!!!-)---!-$$----!---$$-!---!-!&- -$--)---!-$$-!-!--!-!!---!-!-$ !--- -!--%$-%$%--)(&-%(&-!-)%%-%%-!)&$-$))-$-%%)-!%-!)& ()$)-!$-%-$%-!-)(&-%(&-!))%%-$!-!--&-!!))$(- ()!))!))()-(-!-(-((-(%--)))(!-%-) )-% !))!-)-%-! )-% %-&-!- (-(-)))(!(%-) !-!-!----%-!!(&-(%-&)!-)%-!-!--!-! )) -!%-%-!-!--!-!-) -!)-%$(!-%-!!!!!-!--!-!--%!%-!-!$)-&!-%-----(!-!--!-!#)-)% -! !!!!  !######" !######" %%%%%$)---------'"%%%% &---------*% %%%%%$)---------(  &---------*%#%%%%%#%%%%%# -----&--------------* (----#)--------------' -----&---------------$)--------------'------"------  ----- ------------------)'----"&------------------$*----------------------)&------------------$ ------------ ----- %-------------------*-'----"*--------------------)+----%---------------------)-------------------+'"------)-----"  -----&-------($%+-------'----"+-------& ")------------%-------)$%*------- +-------& ")*-----+)&-----)&-----& -----$------'  +------'----"*------$&----------$------' *------*------$%------' )*----%!-----)-----------!(-----)'----"&-----)---------------!&------'-----)------$+-----!------ -----*-----'-----#'----"-----)--------*-----$-----&-----)&&&&&&------+----- -----"-----#)-----'----" )----+------- -----#'----- )----------+ (-----$ -----*----( -----#'----"-----%------ *----( +----&-----%++---(%-----' ----------&----) '----"&----) -----------$+----&----) )-----%-----*   ")(%!')%-----%----) -----'----"+---- &-----#----) +----+----*-----------  *+---- )-----$-----(----#+----'----"----------)----$)---+$----- ------)-----  )-------&------------+----'----$'----"----*-----*----%---+&-----)))))))))))))))))))))))))))"-----------& --------%--------&----------%----%'----" ----(---------- ----) --------------------------------&---------)#--------'--------) ----------"----%'----"$----&+-------------) $--------------------------------)-------- "--------'--------(----------$----%'----"#----&+-------------) #--------------------------------*--------------"--------%----------%----%%----%----(----------!----) --------------------------------*------   %------*#------------ )----(----!#----(----+----- )----%----) -----$ %-----)--------   %----(#----(-----&----&---------------"----* &----& *----) ----- ----) &---------*   ----- ----+----------)----%)----%----------) )----%)----% -----------' ----------# )----&'----) #---------------#'-----) #----------------(-----$  -----&-----#----------!-----&)----* &-----------) -----&)----* +---------------------(-----( )-----%----- %----------)-------) %----- %----- (-----$------  -----&-----'-----------+------ $-----( %-----&)-------) ------ $-----) %-----( $-----) -----*-----) !------$%------ ------%'------*-----)---------) ------%'-----------+ (-----&------------&)----+-' (------)$------*" $--------------&(----------) %------*" $-------------+-----# -------------)%##$&-------+)*--------&$##%*-% '--------'$##%)--------$--------*%##$&-------------) '--------'$##%)--------$)-----$------ -------------------------'(--------------- %--------------------!--------------------(%----) %--------------------!%-----( $-----*-----)+----------------# $---------------+----------------)'-----------------%----) -----------------)-----+)-----'  -----)-------------%&-------------' $-------------*!)*------------'----) $-------------*!------+-----%  ----- $)------+' !'+------)$ &*------)% %)------+(#----) &*------*% #%$$$$$$$$$%  -----   ----)  ---------) ---------) -----#----) ------------------------------------------) ------------------------------------* ----) $-----------------------------------* ----) '----------------------------------+ ----) ()))))))))))))))))))))))))))))))))( ))))( tцtц|ц|ццццццццццццццццццццццццццццццццц҆҆ ҆ ҆҆҆҆҆$҆$҆,҆,҆4҆4҆<҆<҆D҆D҆L҆L҆T҆T҆\҆\҆d҆d҆l҆l҆t҆t҆|҆|҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆҆ӆӆ ӆ ӆӆӆӆӆ$ӆ$ӆ,ӆ,ӆ4ӆ4ӆ<ӆ<ӆDӆDӆLӆLӆTӆTӆ\ӆ\ӆdӆdӆlӆlӆtӆtӆ|ӆ|ӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆӆԆԆ Ԇ ԆԆԆԆԆ$Ԇ$Ԇ,Ԇ,Ԇ4Ԇ4Ԇ<Ԇ<ԆDԆDԆLԆLԆTԆTԆ\Ԇ\ԆdԆdԆlԆlԆtԆtԆ|Ԇ|ԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆԆՆՆ Ն ՆՆՆՆՆ$Ն$Ն,Ն,Ն4Ն4Ն<Ն<ՆDՆDՆLՆLՆTՆTՆ\Ն\ՆdՆdՆlՆlՆ<Ņ@Ņ+C3EŅ L뀁ɀLŅ ]`wyAnÅÅ3ԅh hh(ֆ(ֆ  a@"yp "5y"Ma)))z  a !a./"P5݆&P<=lPfDކ*kކrq 0ll 6Pmm <Inn BIoo Fpp Lqq Ra ?!?"a5?6?Xa<?=?]aC?D?lPfDކ*k$ކrq bPll hPmm nnn too zpp qq Ra ?!?a.?/?"a5?6?Xa<?=?]aC?D?aJ?K?lPfDކ*k$ކrq bPll hPmm nnn too zpp qq `jP-@w:-@BO `@w-@KLMM0N76A tކtކYP Q!PeedIdideeedIdide@t@ %d7dLY1ቂa;Ő  /:Y:ug@ݔ]MSFT100( 0:YP}t P m: )&u)&u@)&u)&u@QH-$QH?6@@ !"L ՂՂЂЂ˂Iтʂ)˂)  @ @  AAJRASVYWWV!WWY \Q9M-.q# 9/# BOOTSERVZ)jEojiiiimon lhUnve}Mgs)swm~儃jh!nh}IzymtEqaurp}Y~ihMh1hEm!mٍ%ɇq%qPP2``hhpp1a2b>nIyCsQ4d5e7g8hVBr3c@p;kAqK{T?o<lDtFvUJzSL|PM}GwO9iN~Hx=mEuR6f:j$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,01jkjkZ[LMV'GXY,-4RHIlmUBC_*+-M$D;./ !<=()"# @!Ars3S%E*J8 ]5PQFGVWlm\]dehiRStuvwX: \     nofg YhiJKNO Z>`a|}~?$%pqDE`aTUz{(H)I&'^bcdefg,L"B&F [#CxyT2/Obc+KPQW^_.N7@A6!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z------------ -$-!-"-%---- -- - - - -----------#--'---,0,(,X,,1,,M, ,<,,4,,7,*,Z,,G,,3,,H, ,;, ,:,),Y,',W, ,9,+,[, ,=,.,^,,>,,?,,@,,A,,I,,J,,B,,C,,N,,K,,,\,,D,$,T,%,U,",R,-,],,L,,E,,F,,2,!,Q, ,P,,O,,5,&,V,#,S,,8,,6,   q  prssr)!-%/'+#u( ,$.&*"tpq91=5?7;3w80<4>6:2viameogkc}h`ldnfjb|IAMEKCyH@LDJBxvwYQ]U_W[S{zAa&':e,23m,Q456789:;<=BbSCFGCc      ;<Sno,-./Dd    WEe()FG$%"#JKjkFfGg"# !` !cABHh*+()$%g,h,&'"#$%f&'u,v,&'Ii,-./   *+./h(),-yz{|}yilmJj45HIKk0167i,j,BC2345@ADELl9:=l=>;<<=6789`,a,HI:;?@b,kABMm>?@ABCn,qNnCDGHEFJKDEFGrHI OoNO*+./01PQ  JKLMLMRSPQLMNO,-NO[T"#PpTUVWRSTUc,}PQQqXYVWRrZ[TUXYVWXYZ[\]^_LMd,}>?X\\]SsZ[de`afg^_\]`abchi~,?YaTtdebcpq>f,jklmnofgdefg*+o,Pp,Re~oE()UuDlmvwrspqjkz{rsnohixytuVv^_~|}hibc`aWwtur,s,XxYyvwx23NOZzyz}~k,l,{|$%,@ H0ፁOtO>ፁeeu>ፁ|>#?͎?@?',#:@ፁq>@X@)ፁD9#@ፁ-@T>9ፁD9#BqBU0ፁ釀f9M턅ፁ%܀B0ፁ%BVmN0ፁ:#fፁɽff.Dፁ6D#\ፁ)g$gH0ፁـLg`ፁWflf%Cፁe,CICZፁ5܀_\DፁI_D}D F0ፁF#F+Q3M͉0ፁyjcFፁ hF#IU IHIIፁcPGvGtF+}FFIGፁ9PGvGGGGoHፁGyHH\0ፁ%bKፁKLLL MrLፁPGxLJJፁ SJfJJፁJJ?OqGG&K/KPK.TgYTፁTTTፁT#8 0Q[[=10ፁe88ׅ @^\^u0ፁy-ፁ,5#90ፁ鈀99مፁ]`K`Cፁ CCaa+a6ፁoX>`Uፁ UUI㥀fXX`ፁ-eeፁPG6VፁQggrፁYƀr5r3 D= #ፁdjyj`ፁgg矅ፁˀ{{u{ـ}{{:ፁD:`:g0ፁހu G #"ፁ܀'N0ፁ0ፁiXh0ፁu͉ڋፁދvh0ፁ鈀9#dddN0ፁ}88ֱ0ፁEڱ͉PፁujzVVV#ፁ4OmፁYu0β貅͉yɏ!0ፁ)I=եGGtፁʀt2t=} =tSᒅፁ-钅Xe0ፁ-}ፁ-܀„-t0+>0ፁ)CፁEtDፁl{=ፁEZ:ፁ-:#XЄ-7TކhЄ xЄ "LЄ`$фA(҄;҄}m!88ӄ-KlԄo'e'ԄSoՄ^-_ׅ(؄ҁqӁMӁӄׅ-`ӄmم+؄Y0؄gͅՄB߅؄ESM0lۄJLLۄ)`׆SL҄=2\҄3ԅ߄Z؄560لԅ[pӄ@C^=^Llm8 Å3Hyb b…7XY8k؄݂܂9܂\ …hqP|ކԄK4v!FyoA姄yA1, mK٭ 8 ѹ1߅-럅ȅ飁˅嘁aͅ@E霁՜0DeCB"`mbѹ$٥ׅ(ʁ́ˁم+ԁԁ ؁9ځ(؅-Å3矅;?ԅ?TCJ-"K"L'NS+)8.ԅYӗZ22ԅ[ Ł gka1Âʂ@ $lnmaMʂD@ $…7qSS0oQKQR;Q<ӄ`ՄPׄ8XD\`DH   $(,048DHL\`<@DHLPTX\`dhlptx|DlDlptx|         $ ( , 0 4 8 < @ D H L P T X \ ` d        4!8!(>>>?H?x??AAxB|BBBBLCPCXC\C`CdChCpCtCxC|CCCCCCDDDDDDDDDDDLEPETEXE\E`EdEhEGGGGGGGGGGGGGGGGGGGGGHHHHHHHHXI\I`IIIIJJJJJMMMNNN NNNN N$N0N@>D>H>L>P>??4@8@ A,B0BBFFFFFFFFFFFFFFtGxGGItMxM|MMMPPQQ(RSTUUV V,VTVXV\VWWWWWWWYYYYZZZ$\(\\\\]] ]p]]d_h_l_abbbhblbpbtbcccccccee8fff@hDhHhLhPhThXh\hthxh|hhhhhhiiiiiiiilll l$l(l,l0l4l8l>>>?@@A`HdH,J0JJJJJJ N$NXQ\Q`QRRRRRRVVVWYYYYY[[[[[[\\\t^|^^^^^^^^^______L`P``Taadbhbccc cccc cXd\deeeeeeeeefffffffffffggtgxgg$hhiDjPjhjjkkkkkkklPl@mnn:corerxtx0rxtx1rxtx2rxtx3rxtx4rxtx5rxtx6rxtx7spba |disabledpnspi@2008000 !fsl,imx6q-ecspifsl,imx51-ecspi@ Aippipgper rxtx |disabledpospi@200c000 !fsl,imx6q-ecspifsl,imx51-ecspi@ A iqqipgper rxtx |disabledppspi@2010000 !fsl,imx6q-ecspifsl,imx51-ecspi@ A!irripgper rxtx |disabledpqspi@2014000 !fsl,imx6q-ecspifsl,imx51-ecspi@@ A"issipgper   rxtx |disabledprserial@2020000!fsl,imx6q-uartfsl,imx21-uart@ Aiipgper rxtx|okaydefaultpsesai@2024000!fsl,imx35-esai@@ A3(ivcorememextalfsysspba rxtx |disabledptssi@2028000!fsl,imx6q-ssifsl,imx51-ssi@ A.i ipgbaud %&rxtx  |disabledpussi@202c000!fsl,imx6q-ssifsl,imx51-ssi@ A/i ipgbaud )*rxtx  |disabledpvssi@2030000!fsl,imx6q-ssifsl,imx51-ssi@ A0i ipgbaud -.rxtx  |disabledpwasrc@2034000!fsl,imx53-asrc@@ A2ikmemipgasrck_0asrck_1asrck_2asrck_3asrck_4asrck_5asrck_6asrck_7asrck_8asrck_9asrck_aasrck_basrck_casrck_dasrck_easrck_fspba`rxarxbrxctxatxbtxc(|okaypxspba@203c000@spi@2018000 !fsl,imx6q-ecspifsl,imx51-ecspi@ A#ittipgper   rxtx |disabledpyvpu@2040000!fsl,imx6q-vpucnm,coda960A  bitjpegiperahb 7>pzaipstz@207c000@pwm@2080000C!fsl,imx6q-pwmfsl,imx27-pwm@ ASi>ipgper |disabledp{pwm@2084000C!fsl,imx6q-pwmfsl,imx27-pwm@@ ATi>ipgper |disabledp|pwm@2088000C!fsl,imx6q-pwmfsl,imx27-pwm@ AUi>ipgper |disabledp}pwm@208c000C!fsl,imx6q-pwmfsl,imx27-pwm@ AVi>ipgper |disabledp~flexcan@2090000!fsl,imx6q-flexcan @ Anilmipgper |disabledpflexcan@2094000!fsl,imx6q-flexcan @@ Aoinoipgper |disabledpgpt@2098000!fsl,imx6q-gptfsl,imx31-gpt @ A7iwxipgperosc_perpgpio@209c000!fsl,imx6q-gpiofsl,imx35-gpio @ABCN^,j   t p)gpio@20a0000!fsl,imx6q-gpiofsl,imx35-gpio @ADEN^,@j7#,pgpio@20a4000!fsl,imx6q-gpiofsl,imx35-gpio @@AFGN^,0jE$-p7gpio@20a8000!fsl,imx6q-gpiofsl,imx35-gpio @AHIN^,0j~ Wp-gpio@20ac000!fsl,imx6q-gpiofsl,imx35-gpio @AJKN^,PjU"5g pgpio@20b0000!fsl,imx6q-gpiofsl,imx35-gpio @ALMN^,pj6 Vp0gpio@20b4000!fsl,imx6q-gpiofsl,imx35-gpio @@ANON^,0j   pkpp@20b8000!fsl,imx6q-kppfsl,imx21-kpp @ ARi> |disabledpwdog@20bc000!fsl,imx6q-wdtfsl,imx21-wdt @ APi|okaypwdog@20c0000!fsl,imx6q-wdtfsl,imx21-wdt @ AQi |disabledpccm@20c4000!fsl,imx6q-ccm @@AWXpanatop@20c8000#!fsl,imx6q-anatopsysconsimple-bus $A16pregulator-1p1!fsl,anatop-regulatorvvdd1p1B@O 5+>regulator-3p0!fsl,anatop-regulatorvvdd3p0*0 ( +3@>regulator-2p5!fsl,anatop-regulatorvvdd2p5"U)00 ++x>regulator-vddcore!fsl,anatop-regulatorvvddarm  @Pph + pXregulator-vddpu!fsl,anatop-regulatorvvddpu  @ Pph + pregulator-vddsoc!fsl,anatop-regulatorvvddsoc  @Pph + pYusbphy@20c9000"!fsl,imx6q-usbphyfsl,imx23-usbphy  A,ip"usbphy@20ca000"!fsl,imx6q-usbphyfsl,imx23-usbphy  A-ip%snvs@20cc000#!fsl,sec-v4.0-monsysconsimple-mfd @psnvs-rtc-lp!fsl,sec-v4.0-mon-rtc-lp4Apsnvs-poweroff!syscon-poweroff8`` |disabledpsnvs-lpgpr!fsl,imx6q-snvs-lpgprpepit@20d0000 @ A8pepit@20d4000 @@ A9psrc@20d8000!fsl,imx6q-srcfsl,imx51-src @A[`pgpc@20dc000!fsl,imx6q-gpc @,AYZ0i>ipgppgcpower-domain@0power-domain@10izJypiomuxc-gpr@20e0000'!fsl,imx6q-iomuxc-gprsysconsimple-mfd8pmux-controller !mmio-mux8  (( pipu1_csi0_mux !video-muxport@0endpointp8port@1endpointpport@2endpointpCipu2_csi1_mux !video-muxport@0endpoint p;port@1endpointpport@2endpoint!pNiomuxc@20e0000!fsl,imx6q-iomuxc@pgpio2io04grp& 0pgpio2io05grp&0pgpio2io06grp&0pgpio2io07grp&0pgpio6io10grp&0pgpio6io09grp&0pgpio1io02grp&40pgpio1io06grp&00paudmuxgrpx&0000< 0pcammclkgrp&pecspi1grp`&p@l<h8tDpecspi2grp`& penetgrp&@Xl0\p0`t0dx0h|0t0D0pH0xL0|P0T0lX0p'flexcan1grp0&@Dpflexcan2grp0&pgpioblon&H\pgpio1io04grp&8phdmicecgrp& phdmiddcgrp0&@@pi2c1grp0&xH@|L@p3i2c2grp0&@@p4i2c3grp0&@@p5i2c3recoverygrp0&@@p6ipu1lcdifgrp&a<Pa@TaDXa8La4Ha0Da,@a(<a$8a 4a0a,a(a$a  aaaaaaaaaaaaapipu2vdacgrp&\p`tdxh|ptx|pgpiommccdgrp&lp,pwm1grp&(ppwm2grp&$ppwm3grp& ppwm4grp&$ pgpioregusbhpwrgrp& Xpdgpioregusbhubpwrgrp&Xpcgpioregusbotgpwrgrp&Xpbgpioresetmocigrp&Xpgpiosdcdgrp&p/spdifgrp0&H Lpgpiotouchintgrp&puart1dcegrp0&PT puart1dtegrp`&P T puart1ctrlgrpH&puart2dcegrp0&, (8 puart2dtegrp`&,8 (4 $0p@uart4dcegrp0& 8puart4dtegrp0& 8pAuart5dcegrp0& @puart5dtegrp0& @pBusbotggrp& pYpusdhc1grp_4bit&H0pqP8q@(pq<$pqL4pqD,pqp*usdhc1grp_8bit`&pqpqpqpqp+usdhc2grp&X@pqT<qThpqL`pqPdpq\Dpqp.usdhc3grp&pYYpYpYpYpYpYpYpYpYpYp1dcic@20e4000@@ A|pdcic@20e8000@ A}psdma@20ec000!fsl,imx6q-sdmafsl,imx35-sdma@ Aiipgahb/imx/sdma/sdma-imx6q.binpbus@2100000!fsl,aips-bussimple-buscaam@2100000 !fsl,sec-v4.0  imemaclkipgemi_slowpjr0@1000!fsl,sec-v4.0-job-ring Aipjr1@2000!fsl,sec-v4.0-job-ring  Ajpaipstz@217c000@usb@2184000!fsl,imx6q-usbfsl,imx27-usb@ A+iH"S#_p|okayhost$pusb@2184200!fsl,imx6q-usbfsl,imx27-usbB A(iH%S#host_p|okay&pusb@2184400!fsl,imx6q-usbfsl,imx27-usbD A)iS#host_p |disabledpusb@2184600!fsl,imx6q-usbfsl,imx27-usbF A*iS#host_p |disabledpusbmisc@2184800!fsl,imx6q-usbmiscHip#ethernet@2188000!fsl,imx6q-fec@ int0pps vwiuu ipgahbptp|okaydefault'rgmii(  )pmdioethernet-phy@70)Ap(mlb@218c000@$A5u~usdhc@2190000!fsl,imx6q-usdhc@ Ai ipgahbper|okaydefault *+, -"pusdhc@2194000!fsl,imx6q-usdhc@@ Ai ipgahbper|okaydefault./ 0"pusdhc@2198000!fsl,imx6q-usdhc@ Ai ipgahbper|okaydefault1+2"8pusdhc@219c000!fsl,imx6q-usdhc@ Ai ipgahbper |disabledpi2c@21a0000!fsl,imx6q-i2cfsl,imx21-i2c@ A$i}|okay default3pi2c@21a4000!fsl,imx6q-i2cfsl,imx21-i2c@@ A%i~|okay default4ppfuze100@8 !fsl,pfuze100pregulatorssw1ab8FXjpsw1c8FXjpsw3a"FpswbstLK@N0FpvsnvsB@-FpvrefddrFpvgen1 5Fpvgen2 5Fpvgen3w@2ZFpvgen4w@w@Fpvgen5w@2ZFpvgen6w@2ZFpi2c@21a8000!fsl,imx6q-i2cfsl,imx21-i2c@ A&i|okay  defaultgpio5m6 w7 7promcp@21ac000@mmdc@21b0000!fsl,imx6q-mmdc@pmmdc@21b4000@@pweim@21b8000!fsl,imx6q-weim@ Ai |disabledpocotp@21bc000!fsl,imx6q-ocotpsyscon@iptzasc@21d0000@ Altzasc@21d4000@@ Amaudmux@21d8000"!fsl,imx6q-audmuxfsl,imx31-audmux@ |disabledpmipi@21dc000!fsl,imx6-mipi-csi2@Adeia dphyrefpix |disabledpport@1endpoint8pport@2endpoint9pDport@3endpoint:pMport@4endpoint;p mipi@21e0000@ |disabledpportsport@0endpoint<pFport@1endpoint=pJport@2endpoint>pPport@3endpoint?pTvdoa@21e4000!fsl,imx6q-vdoa@@ Aiserial@21e8000!fsl,imx6q-uartfsl,imx21-uart@ Aiipgper rxtx|okaydefault@pserial@21ec000!fsl,imx6q-uartfsl,imx21-uart@ Aiipgper rxtx |disabledpserial@21f0000!fsl,imx6q-uartfsl,imx21-uart@ Aiipgper  rxtx|okaydefaultApserial@21f4000!fsl,imx6q-uartfsl,imx21-uart@@ Aiipgper !"rxtx|okaydefaultBpipu@2400000!fsl,imx6q-ipu@@Ai busdi0di17pport@0pZendpointCpport@1p[endpointDp9port@2p^endpoint@0pendpoint@1Ependpoint@2Fp<endpoint@3Gpendpoint@4Hp port@3p_endpoint@0pendpoint@1Ipendpoint@2Jp=endpoint@3Kpendpoint@4Lp sram@900000 !mmio-sramipsata@2200000!fsl,imx6q-ahci @ A'iisatasata_refahb|okaypgpu@2204000 !vivante,gc @@ A iy buscore pipu@2800000!fsl,imx6q-ipu@Ai busdi0di17pport@0p\endpointMp:port@1p]endpointNp!port@2p`endpoint@0pendpoint@1Opendpoint@2Pp>endpoint@3Qpendpoint@4Rp port@3paendpoint@1Spendpoint@2Tp?endpoint@3Up endpoint@4Vp cpuscpu@0!arm,cortex-a98cpuW(Otx2   (Otx2   l(ih)armpll2_pfd2_396msteppll1_swpll1_sysXYpcpu@1!arm,cortex-a98cpuW(Otx2   (Otx2   l(ih)armpll2_pfd2_396msteppll1_swpll1_sysXYpcpu@2!arm,cortex-a98cpuW(Otx2   (Otx2   l(ih)armpll2_pfd2_396msteppll1_swpll1_sysXYpcpu@3!arm,cortex-a98cpuW(Otx2   (Otx2   l(ih)armpll2_pfd2_396msteppll1_swpll1_sysXYpcapture-subsystem!fsl,imx-capture-subsystemZ[\]display-subsystem!fsl,imx-display-subsystem^_`amemory@100000008memoryregulator-module-3v3!regulator-fixedv+V3.32Z2Zp2regulator-usb-otg-vbus!regulator-fixeddefaultb vusb_otg_vbusLK@LK@ 7p$regulator-usb-host-vbus-hub!regulator-fixeddefaultcvusb_host_vbus_hubLK@LK@ 71peregulator-usb-host-vbus!regulator-fixeddefaultdvusb_host_vbusLK@LK@ )Bep&__symbols__ P/tempmonM/ldb$Q/ldb/lvds-channel@0/port@0/endpoint$]/ldb/lvds-channel@0/port@1/endpoint$i/ldb/lvds-channel@0/port@2/endpoint$u/ldb/lvds-channel@0/port@3/endpoint$/ldb/lvds-channel@1/port@0/endpoint$/ldb/lvds-channel@1/port@1/endpoint$/ldb/lvds-channel@1/port@2/endpoint$/ldb/lvds-channel@1/port@3/endpoint/pmu/soc/dma-apbh@110000/soc/gpmi-nand@112000/soc/hdmi@120000!/soc/hdmi@120000/port@0/endpoint!/soc/hdmi@120000/port@1/endpoint!/soc/hdmi@120000/port@2/endpoint!/soc/hdmi@120000/port@3/endpoint/soc/gpu@130000/soc/gpu@134000!/soc/interrupt-controller@a01000/soc/l2-cache@a02000 /soc/pcie@1ffc0000/soc/bus@2000000/spba-bus@2000000/spdif@2004000./soc/bus@2000000/spba-bus@2000000/spi@2008000./soc/bus@2000000/spba-bus@2000000/spi@200c000.#/soc/bus@2000000/spba-bus@2000000/spi@2010000.*/soc/bus@2000000/spba-bus@2000000/spi@201400011/soc/bus@2000000/spba-bus@2000000/serial@2020000/7/soc/bus@2000000/spba-bus@2000000/esai@2024000./soc/ipu@2400000/port@2/endpoint@3#M/soc/ipu@2400000/port@2/endpoint@4\/soc/ipu@2400000/port@3#e/soc/ipu@2400000/port@3/endpoint@0#t/soc/ipu@2400000/port@3/endpoint@1#/soc/ipu@2400000/port@3/endpoint@2#/soc/ipu@2400000/port@3/endpoint@3#/soc/ipu@2400000/port@3/endpoint@4/soc/sram@900000/soc/sata@2200000/soc/gpu@2204000/soc/ipu@2800000d/soc/ipu@2800000/port@0!/soc/ipu@2800000/port@0/endpoint /soc/ipu@2800000/port@1!/soc/ipu@2800000/port@1/endpoint/soc/ipu@2800000/port@2#/soc/ipu@2800000/port@2/endpoint@0#/soc/ipu@2800000/port@2/endpoint@1# /soc/ipu@2800000/port@2/endpoint@2#./soc/ipu@2800000/port@2/endpoint@3#=/soc/ipu@2800000/port@2/endpoint@4L/soc/ipu@2800000/port@3#U/soc/ipu@2800000/port@3/endpoint@1#c/soc/ipu@2800000/port@3/endpoint@2#q/soc/ipu@2800000/port@3/endpoint@3#/soc/ipu@2800000/port@3/endpoint@4 /cpus/cpu@0 /cpus/cpu@1 /cpus/cpu@2 /cpus/cpu@3/regulator-module-3v3/regulator-usb-otg-vbus/regulator-usb-host-vbus-hub/regulator-usb-host-vbus #address-cells#size-cellsmodelcompatiblestdout-pathdevice_typeethernet0can0can1gpio0gpio1gpio2gpio3gpio4gpio5gpio6i2c0i2c1i2c2ipu0mmc0mmc1mmc2mmc3serial0serial1serial2serial3serial4spi0spi1spi2spi3usbphy0usbphy1ipu1video1spi4usb0video0#clock-cellsclock-frequencyinterrupt-parentinterruptsfsl,tempmonfsl,tempmon-dataclocksphandlegprstatusclock-namesregremote-endpointrangesu-boot,dm-splu-boot,dm-pre-relocinterrupt-names#dma-cellsdma-channelsreg-namesdmasdma-namespower-domains#interrupt-cellsinterrupt-controllercache-unifiedcache-levelarm,tag-latencyarm,data-latencyarm,shared-overridebus-rangenum-lanesinterrupt-map-maskinterrupt-mappinctrl-namespinctrl-0fsl,dte-modeuart-has-rtscts#sound-dai-cellsfsl,fifo-depthfsl,asrc-ratefsl,asrc-widthresetsiram#pwm-cellsgpio-controller#gpio-cellsgpio-rangesregulator-nameregulator-min-microvoltregulator-max-microvoltregulator-always-onanatop-reg-offsetanatop-vol-bit-shiftanatop-vol-bit-widthanatop-min-bit-valanatop-min-voltageanatop-max-voltageanatop-enable-bitanatop-delay-reg-offsetanatop-delay-bit-shiftanatop-delay-bit-widthregulator-enable-ramp-delayfsl,anatopregmapvalue#reset-cells#power-domain-cellspower-supply#mux-control-cellsmux-reg-masksmux-controlsfsl,pinsfsl,sdma-ram-script-namefsl,usbphyfsl,usbmiscahb-burst-configtx-burst-size-dwordrx-burst-size-dworddr_modevbus-supply#index-cellsinterrupts-extendedphy-modephy-handlephy-reset-durationphy-reset-gpiosbus-widthcd-gpiosdisable-wpno-1-8-vvqmmc-supplynon-removableregulator-boot-onregulator-ramp-delaypinctrl-1scl-gpiossda-gpiosfsl,weim-cs-gpr#cooling-cellsnext-level-cacheoperating-pointsfsl,soc-operating-pointsclock-latencyarm-supplypu-supplysoc-supplyportsgpioenable-active-highstartup-delay-usvin-supplyldblvds0_mux_0lvds0_mux_1lvds0_mux_2lvds0_mux_3lvds1_mux_0lvds1_mux_1lvds1_mux_2lvds1_mux_3pmudma_apbhgpmihdmihdmi_mux_0hdmi_mux_1hdmi_mux_2hdmi_mux_3gpu_3dgpu_2dintcL2pciespdifecspi1ecspi2ecspi3ecspi4uart1esaissi1ssi2ssi3asrcecspi5vpupwm1pwm2pwm3pwm4can2gptgpio7kppwdog1wdog2clksreg_armreg_pureg_socusbphy2snvssnvs_rtcsnvs_poweroffsnvs_lpgprepit1epit2gpcpd_pumuxipu1_csi0_mux_from_mipi_vc0ipu1_csi0_mux_from_parallel_sensoripu1_csi0_mux_to_ipu1_csi0ipu2_csi1_mux_from_mipi_vc3ipu2_csi1_mux_from_parallel_sensoripu2_csi1_mux_to_ipu2_csi1iomuxcpinctrl_apalis_gpio1pinctrl_apalis_gpio2pinctrl_apalis_gpio3pinctrl_apalis_gpio4pinctrl_apalis_gpio5pinctrl_apalis_gpio6pinctrl_apalis_gpio7pinctrl_apalis_gpio8pinctrl_audmuxpinctrl_cam_mclkpinctrl_ecspi1pinctrl_ecspi2pinctrl_enetpinctrl_flexcan1pinctrl_flexcan2pinctrl_gpio_bl_onpinctrl_gpio_keyspinctrl_hdmi_cecpinctrl_hdmi_ddcpinctrl_i2c1pinctrl_i2c2pinctrl_i2c3pinctrl_i2c3_recoverypinctrl_ipu1_lcdifpinctrl_ipu2_vdacpinctrl_mmc_cdpinctrl_pwm1pinctrl_pwm2pinctrl_pwm3pinctrl_pwm4pinctrl_regulator_usbh_pwrpinctrl_regulator_usbhub_pwrpinctrl_regulator_usbotg_pwrpinctrl_reset_mocipinctrl_sd_cdpinctrl_spdifpinctrl_touch_intpinctrl_uart1_dcepinctrl_uart1_dtepinctrl_uart1_ctrlpinctrl_uart2_dcepinctrl_uart2_dtepinctrl_uart4_dcepinctrl_uart4_dtepinctrl_uart5_dcepinctrl_uart5_dtepinctrl_usbotgpinctrl_usdhc1_4bitpinctrl_usdhc1_8bitpinctrl_usdhc2pinctrl_usdhc3dcic1dcic2sdmacryptosec_jr0sec_jr1usbh1usbh2usbh3fecethphyusdhc1usdhc4pmicsw1a_regsw1c_regsw3a_regswbst_regsnvs_regvref_regvgen1_regvgen2_regvgen3_regvgen4_regvgen5_regvgen6_regmmdc0mmdc1weimocotpmipi_csimipi_vc0_to_ipu1_csi0_muxmipi_vc1_to_ipu1_csi1mipi_vc2_to_ipu2_csi0mipi_vc3_to_ipu2_csi1_muxmipi_dsimipi_mux_0mipi_mux_1mipi_mux_2mipi_mux_3uart2uart3uart4uart5ipu1_csi0_from_ipu1_csi0_muxipu1_csi1_from_mipi_vc1ipu1_di0ipu1_di0_disp0ipu1_di0_hdmiipu1_di0_mipiipu1_di0_lvds0ipu1_di0_lvds1ipu1_di1ipu1_di1_disp1ipu1_di1_hdmiipu1_di1_mipiipu1_di1_lvds0ipu1_di1_lvds1ocramsatagpu_vgipu2ipu2_csi0_from_mipi_vc2ipu2_csi1_from_ipu2_csi1_muxipu2_di0ipu2_di0_disp0ipu2_di0_hdmiipu2_di0_mipiipu2_di0_lvds0ipu2_di0_lvds1ipu2_di1ipu2_di1_hdmiipu2_di1_mipiipu2_di1_lvds0ipu2_di1_lvds1cpu0cpu1cpu2cpu3reg_module_3v3reg_usb_otg_vbusreg_usb_host_vbus_hubreg_usb_host_vbus