Z pp=PM1)+MOo/Oo   P!:0@" Р@ K`"_B_`"d"_B_d"*K"_) pG&_9+='++1`   pG(;+0R#@@@@@@@@@@@@@@@@@@ pG;+4  pG pG pG pGK<_p` pGhZJhhPC hPBX_K@#@K@_P 8@hFhk-hG( F 8FFF" FF<D$%F;#F8ғBqӤEBqҘaFU+%FQK$FW;FpKFKFiKFiKFi kp@GKFh[KFh#hk+i+! F+iG(p2+ͿKZ" 2ؿTpGn@2+ϿKZ"̿ 2pGn@hZ`xt("m(S(d(0(pGn+ pG pGOp`pGOPpGOPpG pG pGh]"B \5UG]?/J]jJ] 6 ` J]D,BB]BBFh@8 F!w2+ʿKCU 28n@hZ`ppG pG pGi#hPhCQ` pGih C:h C`Zh@Z` pGh@ih[h_ @@@ pGih "h C `pGh"ihi_@pGhEh`h/!<@4C`h$\`@h``=ob!;= -MF0 F<F0h+Mлh  %c F[F!F8F"YFC # s#D @F0G4B o[F8FȱZF2BD LOq F KhBKFbKF"J KF") Cj DB؃hDDpG pGo-A`F" FFo h;`6s,+! "!F@FDx+4$<`0F!F"@Fh 5$,D & o](#sBFF(F0F!F( ((+h3+` Fp-+h;++`,-O4O4#(+O0]O0#F F++FO17F F!F(FO( (,o  F0(O4hDDCh`pG-M$ FFFCFF&F;O ZF!(FF ]Dȿ6$ȿElEL &FRK$FFFDj%iű)F8F陹)F0F Fi@"hFaiF FuemGoKF0+H!HKF0[jh@x}Ozr I 33hF Mb#7hEjk`KFlh$CF 0F FI < jhB8k`KF!Fhn@FlGl+0##0 PilGC `o Fi  * 0) +J@i!V s Hf@i@i)! m! g@Fi!`i Z`i@! Ro pFiei hiQb!F(F ?F@!`i -`i! (`i"! "`i!%  pFhica!`i C`i"! `i"! `i!i "`iF F-MhFi Fh<0{[hkG(>(h ;PF7Fx0ԣz-ԣ~*c'Ԕ"ѮhBF0Fax Gع#z+BF0Faz ?#~+"0Fa~ 7X"j*ГZBZA0F! ,(0chS!F(FGF(h Ufj.e#jj+aаF& z#x"~DD`3c  0(P#i {`ci`FCyh @ ,A A ; 9B 0!PD&. ##hRF#(h F(].#ajBF3F(h (ЂFJO #𵍰FFF!0"hFFc@0#0#iF6p -MFFXĠ (FT0"!hF=#F! !0 ! 0# 00F  0$hihkih{iFGH(0D0DFv-hӹ0D0DCi3Bo *i#E$ iF( A!  D (F+[[E([F + pG pGP8 pG"!FKF4@FpKFKKFi $KA/p *}_տ_p}_տ_pKFiKFiսp@ CkGKFh+KFhD)(F[ F. F@FoF() F@ F!Fo B.FB. 9F)O!o BBFBѻB 1F(FFw.O1(FHZn@FK;,pFJ K LB$ Fp0F!h(D4\@@\@FFFFFP*F# F dpoFDB K ,FɲxFBpG*FpGFFx3)pG8hFDD F(` F8pFFFF@5h"0F (` 4 Fp8hFDD F(` F8FpC J#DBF #Kp#FF!x3Q\ Fx;\h@BFًB F FDBp FFF!"pRa D23D2p FA\F)Fѯ]+;UDix]D!R= F")FfU2[+˿Kd 2cpn@-MF FFF'2+hZ*`x.*.#**h+`b)@!w$ )P!@@@@O@@@@@@@\*?*؀[*Zxb^*sO 3+`+hxlK 2^*$|*/9F F"AF FR#02+˿^K 2Sp#U+`! F !!bZ*`x\)"])-) FYF FQF "E[x]+-!! F!(F FFO (FbOF F!!QF)2 F !bQF)F +hZ*`x)+K 2! FQF/+`9F F+qKYx** " "?)3+`21F F" H#( +` F'o@n@>o@Qo@eo@F9DB xO3-MF FF@(Fڸ%BF!F0FhF0F B!F0F.:FQF(ѻ@(F-M xF/+ F#%B1;F+/*FB9I@Fq #"F@F+FXo(FF/7F @FQ@h@o@o@(   IH  {g@o@p(F%%F8, I H0Fp,B,  f@#p@-EF F()FHu &K@yS4@B 0#c+ ##!FBF(FZ#0G6$4Tp@@V@FFF(F2F/I/H=  / /،,3F"F'I(H-缱,?9F%H%!0F!眳,#F%Os$%IrX_"C_ ?/uPr@-AF F@8K2# h_# |h_B$CDtD0Fhh_$CDt Mb '@'FFF_`#*F`h_f`_@#`*F9F F@F_P#@6`K1 h_/Ѩh_/ F>@p@MbpiihJB3F!(FҲFh_@#2FX!(F`aFkh_1F(F Fp-M%FFOD .FKJ!$d!F'H_O FFEKJӰBFG 7/!D5-ѿ_ H1F p KK@ 0F ʚ;MbFi hF`HLd0 a ʚ;-AFi%hh&z_OD `r9F(FF_.`_FH$d1F(F(`&a@Fʚ;-AF F _h__&aD `A_ _'`_&a)F FA-M FFFi"!  ,Ѐ,̀,Fh1FF3)Ahh[h,h-ih_fп_)F F.@OH+F! FF@#`>$!OJB+F FҲF^:)F FCFFFh DL9K _b`_(!*F F`(!.տ##X!P!C@_*F F`@ch_;>sF_)F F?OH+F! F6O@ FO@>D*)F FE+F.80_c`_(!*F FFFF;_c`_(!*F FFO3z8 FFi!`i  *F!`i - 8o -MFhWLh)!F*Їh|,!VIF F8>F ЦEF@*R*Y*z 00-LxX,(ь8F DDEѤF@TEѾ0LxX,-K F])F,HO0 F xY,E,0<,LxF<,f<,h)FH h)FHZJFH)FL2 (LF KL4F1F"FH!F0Ft(Lh)F Hn@h@@m@Xr@Ar@r@jl@r@r@-MF FFFk%9])K+2Xh`}I3hBF8FSFk;F`BF3`;Yx8FSFk!DF;xD-f5h;xB_[xqD>(TD5`45hSFBF8Fk5`;[xDSFBF!F8FSFBF!F8FSFBF8Fk|F0SFBF!F8F;[xDxSFBF8FkgFSFBF!F8F3hSE 8I\  %(F3hSE 1I\33`4I3hSE *I\3hSE3hSE9Mxp(D3FBFxj4Fe5hUE9pBFx`DX(5i5hm 4L5h ]B]A;Zx3hCDK204;Zx3h [2 CDK`"FHmh@ s@-M }FFFO #  "FEIPF1! F邻逻YF0x+Hѣx+! F( F!! S23 {`+hF`=YFF[E%ڹ.:PF30h`hQF 0F(0`1F  wFAF F)zh F;`hX  F;hh`o oYFHo"s@'s@-M&FF7F,! FF F@0fF(F!F J:!PFF(#;FPFFH!FPF(l-׹o D 3FBB;?+# 0@F1F o -MFFO F;F(FJ Yx;F(FJ1D(F-MFFFO FCF:F(FKhYxCF:F(FK1D(sh Fñ\jhhF Q&@Yh#hH+FHopo n@Bs@hFkFiFGFT3F!hbh hH(F3FJIT4B<8ohhB%8`ik43BТ<is@s@s@pFKF0+b# `KF0[KF0h@-M_O2HK`_Z`_pb`_Rr`_oq2 Da_9JZa_8Ja_EPRa_"!_@!_ !_L!_,J!_+JD!KFO_B (F%HKFO2ZdKFh-I(FFJ(FF(6:!!F(FD+# n >F(@r R,8,B!lB!j FF" 0UUU-7w@w@w@(FI# o (@AKF `JFiCsaKFhSKFhhkh#JFIFIlhGJFiHCcaHHHn($MKJI`""p™`Iabbc4@( "N$OMOdM5cD@dL@eT ($MXfO|fOqU\dlgt@(o$M!gOwu|p` P@([ '&``&`&`qN@`&`nN"`&lIp؀iO  p``Ѐ`P@($ZM@1!@@ OqOI !!LJ@&(!"$II(`P@q,!AJdP!"T!>JX!"\!|@e|@|@А |@@@g@&z@@{@@f@Gz@zf@he@X@z@z@z@C{@Gl@Khf_---*@O ,ٴJ_#  C_2!uJ2_@CC_2! FG(@Ӏ)F Fp(YF F3(! F,(􄭸À #SR 0_Cc_B 0ST 0_Cc_D 073+p+@2$! (OyHvvxv. .lccccppp_*]O f*X&;x, fI2_" @#_2! FF()F F(1F F(-]! F( ! F(!! F("! F(Bph* &*5*:*s)F>H** &#C8K! FPf(?#! F^(! FW(! FP(?(#! FH(ПO .%&&O0FAF4(! F-F()F F[(}YF F(v! F(o! F(h0F(` !nF}@|@@`(?P*! FF(H ! F(A+! F(:,! F(3-! F(,.! F(?#$Mh F&k.$4,$Mh F&\.4,$ FhO%-43,ў!(!(!(ເJIHK6_+ƀ++ǀyJ_xK @C[3C$_5_$D_oKLz_3@@3FjJkIS _BB #O5'FeHeL*F51B*O`baI1 C_A _A _A3-WK4" WK VKWH WKWNWKWKWKWKWKWKWKWKVKWJ`3h #SL#`3h #c`3h #`3h #KJ#c`#x!IJ`IJ`IJpIJ"_(IDB_@@ */٢ ( F?K+B+*B*8J9C95J8C802HBb@*##Y *𓓅T@Sm@Tm@k}@@DHe@qd@d@d@@Ed@|@l@d@j@d@d@e@l@k@D@ؽ@H@@@@@@( #FJ`F M0F+7@K_L#6DA__)dEAKGQc?c#cccZMccjS"jSWcccccW## **TbBbAS*c## %P0+@:0 +R!Hj Hg!Hc(>M %!HV%!HP% !HJ%HEHA% )))%)% %%@@Д~@p@@r}@}@}@ ~@Z~@}# =* ;@" *D" B"ZCH" "BL": *݀9P" *ҀT"  "8*€X" "B\"7 *򫀔6`" *򠀔5d" +򕀔 h20#C l20#Cp20 #Ct20+(#00 +^ #0VF 0+V@B! a *(";-#:*I"\+8@C 08#K+##"F!FB$є03 +@A!ԟHHJ\+F");+#### r1C1[BёK HS"F#ò Hj`2p  !!N0F"J2*L?0( "zH1G2*@?)FDpH+!nKnL #`mK*`ЊBkJ"`"`(#h#3#s#`qFFk #*,OO3*ܠ") FXI ` !XJ`D!WJ`!WJ`!VJ`ZUJ`{#UJ`UJ`J#TJ`TJ`-#TJ`TJ`TJ`TJ`A&+ * 02 2GJR *BJR#00vO3 & ! FF(~گ)F F(~ӯ1F Ft(~̯! Fm(~ů! Ff(~! F_(~'J`_#=@ C_`4-O f@~@~@f@x@@B@@@C@^3@ @0@@@@@ܾ@ؾ@Ծ@о@̾@Ⱦ@ľ@@@(@@(J@O ú,?xO-HM+h#`KFh  KFJ`KFiX .(` !H`J3###cC#3K_"K Y\)T<B@hJSCOr SC_JH433#C33Cs37Cs7B`2#c`2;"*!H(Ѐ !#JF(ʀH" O(@𗀽 0Y@" B(" :(@ 0}uHlK_h__Z`h_&p"_`i_%B_a\i_$_Za!_"2BB@R_!@!_"rBr_@!!_""@R_!D!_"pr_D!O"*!EH N(N#! UFLP0\_8K_`_`_a_;H\a;KF("!  )8#o&( 0M0K.OZ&Ei=F`2o5)H]4 HOo-IjhBEI)h!H'jh"h GF(Q DQ F2B?ѠBA8 G>@@@\X@@B@Ct@ ?@@@@@ᆳ@@@{@9@H 5B6., Hh0DHo!FHQ@@p@@lKFiC7FбiHF JlhX +hChh)``k` F0@ڿFЀ@Կ-EFKFlhhCF B FiFXhFHFphF8FUD5DH FiYh(FI(Fqh(F I9F(F*F#F0FI<8KF!Fh6o ׀@ڀ@-MF(?iKFJPFlF(n#@Egh+dZ&oln#`+a`BX o2FOFXhhki+_1FGF(zСF"O1PF(FYFPFB"YFO3YFPF|J0CCE((  E@" $T?B?o3 F`S,8,BlBj F@j+e*aAhB`+QLC C@HCHCs`h#h<,I$+i Y R! "EH+F(v0)i"+i X @Q 0CA 0*i00FC"p7Ih:F(Lhhh#;CkB*Co F&F F%JGF(+r``* C + j:F)iGF(`h0FI`hhhk'jC)iG$ho o#@@@@@._)i6h)iG`hGci𵍰FFF!0"hFF @0#iF6p0 , #! (]𵻰XjDj>OHo;FF8h(џK 111h!_ FO &&_##! 0K" jiOa( ! *+x4+kx*;+#(0R COcX0k#Z0{K{K@c00##p#caO@cc`hSC"`rJ`eqJ1"fpJbfkiXkiXB$1C $1kiB#3@L#@:3,!S,!<Ҳ D*1+x,++- +_є 1+@Ȁ++𪀄 1y"(F@5h+o{HM-Z.F8h0F0$1C$1 F @F! F#F@F(r F FzF( F(F0C h*Ho(J)I#5! F(۝ B F (3F2F! F#! F( F8F(#5! F (۝0+Иc @<@M@@U@Y@F@s@s@1JBs!# 1+x+ki !!)KxB Zx! 1+Q &I1)#*+x+ki$1[H1x+ + ,+ Ѐ#!(1r#+%#!F F6%#!F F/-#!F F'Ř@h@K}Ҳ_Rտ_!q_"t_ r_ s_ p_q_spG hFkF{icGF]#F)hjh hH Fo#F JIic1F(FGF(E#F)hjh hHo#FJI@s@s@ȁ@-MFFs !F`F!xHQxHro  FRF(F[QO3(FnJnI)(,AhjK8```clV F(,K$`$-N$0+J0+L/X#h+[j+YJ#KFXIhF+@pI"TIkF@")FPFQKG?(>o'F瀱M#F)hjh hIH+FHJHI,hj`j,ѭF h(t5JB"(F3I"( hfh+Ѣ%3K/3KB2K *ѓ BB*-HoL *ѓZ)'H#Kqa#H *FHa)D` 00qH0``PFG(iBt Fu@@@@Zb@@@v@s@s@'V6@R@@@ׂ@0hhkh_#CC3HCc HCC_k`yhhi_ H#_ )C_a 0FC@Ѓihh h#8h*hC `pGo pGhh_"`_"a_ XapG@jh+ o pGK[\+JSpK [\p#ppG pG pGi@#i@P@h_@`pGKP@h_Z@ @Z@_`pGJ6_9C@_ 6pG#@@KS 0  pG pGx@OC `K hK`pG@!B R!@_@!@1!B P!@_B!@1 KS _0( (( pG pG pG n APCh_J@@J@_ `pGPCh_ @`pG|OC `K hK`pGD@p F(8Ѓh@jhhB(F!K6_ JOKFnD)F0F (ٵB#O ;@8DRB@F ;+"oF#ZCCCs_ c`p 8HhEil `+x #q8FPDjl("I ` Fv@KF0BJF030KFKFJFpGihXi_Ch_Կ_O3Ca_)ahCc`hC`pGi_3pGp`FFEil C##`o pFjEii `(- K6_JOKF3` h)F K @x}"A0FxB B(FBpGB B8FBpG 0 +@B * KH@KFHH@@@@KJ (FF@@KJ (FF@@ &0J#FRKBQ#3+ @@CB@.CB@3BذP@#Bذ  pG pG pG pG pG pGF '#B #F!zA3+D A3i( ( K@@B@XBXA   hZJ`KhXJO` iZJ`pGD@@8@7LdhL5F FF G0 d@7LhL5F FF G0 d@OC7#ARF FȻ# %ARFFxOCAR F(ODFOR Fй#FOR F#AR F@O3AR FF0-AFiFFhh#hC#`ch# c`.#hO##`*F;H-*x#i##a_Bs`"i_h_;5>祅@"KZo_ ZoBrZgo_"B_gBpMKo_dIH^ Fo_Bso9q DS DOzq#J #J!@f@х@MbD` CbCpq CC|C@SC_ J6CC_6 KF_ ;IH FABNg@@-MFFFFF FO4+F"FYFPFȹK6_ ` 0C+F"FAF  6_ B(0E FFpNKFS"`!LH pKK2_IJDC&_TFJFJ1F2 F+6ٶ3OR?HFOr=HFA0P +9J9KR#0_0J2 FO13H2 FBOAA$P "OQ%H"Oq#H"!$HOrOA"H~OrOAHw*O|QHqOrHFk"Hg"OAHa"OAH["! HVx@@@e@2f@ B0?@ dB`BhB8Mko_XkoBp\Cskgo_dIH F8o_Bso9q DS DOzq#J #J!@ g@х@MbpF!\H pZL2_YNDCV"WJ2 4VJ 2_#S_ 22_#s_2d2_#C_d2`2_#CCs_`2`2_#CCs_`2h2_` #_h2d2_Cs_d2d2_#s_d2`2_#C_`2`2_#C_`2d2_#_d2K%V% $_B2_$J$5_#C_ $5\$_"2_$ J$5_CC@@H@e@H׽'@0L!O5F JF8JFF0<H!砆ԆN@-AȀF F4_O  $_#@@@!! 8$F_"7@C+#".OcsCxo$H!FHiH OcOSOS H{!F HS Ht#Os 0Єm@s@*@cm@"#-MH#%2+FF"B@ˀiF x#OZKJ:@;_N1F0OKS _BA тIKFS˿_@cE O FOB@𚀿_qHO @;#FB@ (iH 9C 99_CCC@_9#% U-BOO2Fd(.o$E5Bt#PK _ @_ _K_+_LJ+_+ )B ) 0( _9K@+5cV+_C+B9KQ+_C+6JBѿ_",K5H+M_ C3,(?c  K C3C 0PF_<_ 0NC`lCPlC0lCl`(?@ ( \ us@{s@s@s@s@m@@@d P @p Є ᆳޖ@@#"-M#3dFH)FH" * ؐK@ՏK"OAOPhG0F +OrKFAhG0+ +فJ"#!~OJ;` 3+B0FwKh3vIwHvKh3uIsHtKh3sIoHrKh3qIkH|pKh3oIgHtnKh3mIcHllKh3kI_HdjKh3iI[H\hKh3gIWHTfKh3eISHLdKh3cIOHDbKh3aIKHH#jWI;HhUI8HciSI5H#jQI2H PKhOI/HNKhNI+H#LL#`BO FK$hHM0+h@#;R(=HO :yF6H%鲋BV2Hc྆@@@@,@@@ @@H@@U@@_@ؾ@e@Ծ@q@о@}@̾@@Ⱦ@@ľ@@@@@@ɇ@@@@@)@G@a@D@u@@@(@x@@@@*@3y>ՖLi GF!HIchO1A@GH":chO1ApGH"+O1APchGHRAO _BӅyH@B@BWOroLFhAPGO"hFOPG"!APhG@ yF%BO?%"CFF !F(|@  E#h30+A5"#h)FFF(a#hF)F3F(V#h )FF3F(I"#h)F3FF(=#hF)F3F#hF)F_3FH#hF)F3F#hF)FT3F"#h)FF3FP#hF)FU3F(M1FHv+hZ#F;`F#`B `XHd! #hO 3F+h# ;`HO@@@*@@@ψ@@#"O#`B'غ?##`+h"K`Kh(+h>"K`Kh;KhX# @#B" `H+h :`+" !hH#h3! o#h3#`Bؿ#4F"O FB%y)#O kO*hB#`?O v"dK`dKhdKh+@#X B6(daH  C3]KBBO1hBAPGD `gAS"FOCF(QHtS(#h3F[SFF ECKJBhO1APB@G@H4;yAS"FOCFX8H?J 3+h"'K`x/HT#O "O*hB#`##O O*hB#`(##` "K`(ή+hXA "K `(9H'R c!hH#h3 U!hH#h3@@ @i@@@@G@@܉@J@ @*@+h"K`H+h "K`H+h"~K`H#0B#{MuL0B#vMqL0B#rMlL0B"#nMnLFA@0h"pG"x!A@hGOrO1AhG4&cLbhhhT G>P&3F 3Q+*F+ ѻ@.:0+Ճ +PJ"փNK5_LJLILKR _C B$HIIH"#'F%F##@4(F](@Ã2B2<;IL L_J5_K5ON! AANNOLLL?| FG5-ѿ_'KL&J2_CS_2"JR;+@J7_C]_7@uH_@v@@ˊ@(@@@@Q@@@Хm@m@Ѐ@@Kh@Ё"KM`ĕ# ^ F(@𕀎I h Kh "` `yFKNK(KOBJшKpO $O3#;` #;`y~Kx+%"!(F_(Y%csNpJBZ4,y $kKiOoKgNjKBbCE +y@I$C([[[[^K#P; +#3p46"! F5p FX !F#C#(NH5D-;ќ0+AS]+Ozr[]0!F0 N5J0560#A79x)40K3B)c5x-2"+I:p x2 pB8F"! F F( U # C!F#(437363N*F(%*":pp5pp績@@?@p@l@"@@@@@@@@@@)уB8F5xpxkB "}I:p x2 pݲ5pB#wJ;px3p#2x;p+p Fp:2p "/F(%1x Q #w)}"! F F( x Q # C!F#(#RJ;px3pV0#A4B"JKdJK `IK `03"! F (+h ##` 5 =H03+h ##` 6H03+h # #` .H03+He+Hb05'HX&HU$!F%H4O ,!HJ$!F H4D ,)FH={+#$@H*0#A 4,  @,@p@l@@-@e@@*@ @l@o@|@! F9aHD:F! F+[HCXKO1A8P[hG!@ F@ @AIH! FEH?! F?H"! F9H!6H6HO!BD F-H? )HO!PBD F!H?l B@B@B*K"OqAPhG !HRIHN&0FO@DFjHBnR_PC`r@@@@@l@@m@m@2n@ qԠ XBXA q0HKF@@KqJ (FFX@@KqJ (FF@@p IFhyFFFED$3* F `p @-Mx!UKhUKC"x #!AbF(@$4MMF #cC  {x!CBxFC3x CBS CcO2+CA0baF(e09JCA0b RF(VO FAbXFEF(I"FF{hXF 3x #ABQF#PF0#!F"J(pOzp-3xp O@CA0b!OC FO2F A0bF`"F ABOzp4,o @h@d@ Ԇ-MF FF-$FF%3xC "O YF S+ B J  EYF HEF@F K Jh[DB#  E(FF砆@@h@-AFFFFAQAR#F. FF! F( FF+x @r;h!FF#ABm(+xAC"F#F{(H@-EF F_ ( F$FXq0ZH,#O 34,J; #r!F:F0 r#F*FD3F*X"hA@\'B42B,$ FHd@X@-M FFFT#FAb9F FO@cA0b9FFF@S+3H(F p0B1F-H9F,Hı&p0;!'J;D( Bؚq03A6+B9F3 O3 i*S<њ s@3H$04[D`F.@\@r@@-M@@ FTddt |D@Q DFO:L#FOR)F0F2F0OR)F0FC&Fй.%FxF ,O: CFORYF FF8FK4B7FCFORYF hX+ B*KB  EF${-M%")F U xF&!O6K(FhKC")FA8R F(@AK5!>H :K h(pH!9I0pU7/46p0B)Kh 55xFOOp0Eٚ0@Ӏ$hX 9!H I0xY] )p'"{#FCFFo(7 /qP%A Of  Kh HZ)Fd@@@@@~@h@@@@@@YKh 33D"F#FF%F(x6FExxpNs2h[u2YF#FZFF(YxxYFs[3hZF3#FF(AYM3h\T3YFZF#FF(-3hYF\U3ZF#FF(433p0BR@O=hO 55xF"Op0EҖq0C2IT0K"S(0F#FCF(;hO2Z3"F#F#FwF(ʬ0 O3AbGF(O3!AOs 8F(K]HABAA3P?X?%%TTKd@j@@@-M$I 0 KFh)PэKAR KFȹoFARF FhOEF+FAR F( F"{O{N;h!FF# AS"F+F(!FtH;hF#@$ D@3!FnHjKhjKC"@#jO ;LLLLLDE@ɂFOxp0B$Oxp0BƂq0#A46 Os! q(@4#6 F c(У0#!A0F AF({ ?HpOs=M!*F AF(i#FFFRF4HO2F A0b)F(Q0ZFFq@,A5!30FOsF'F)FH+&F5p0B.6!KhKC"=3 # F(0 H3kD+D,4F@@@h@@<@d@t@Ԇ@@#AR! F(O3FAR F(ٮO5FFA0b F(ˮFFA0b F(Kh30B"#F0B!0mO5AbFrF( {O@s!FF#F FAB`F(A8RF CF(} F F5X+ @B OfKfMp0Ba3F7/53ue!OpC-A(BO`CF(%F(FOA(BF+F(9OKh0@LKS"@d *kq0#A:h*""H3kD#D<"Y CF#FF4p0B03K "Fx3F( BF10?OCAR! F(֭ #FAR# F(ɭO3FAR F(KFARF F(0?ȭ$0$d@(X@Kl@@h@0!KhKC"O3!AbFBF(|#AbFIF(qU#A0b! ;F(cI~~[CB:hCcFA0b &F(NF" imO3!FA#F F(9mK:hB#CFC A4F(&0T aK!F\_J[CcA<F( OPcA! F(FFFN4Os8/! (?(#OEORF F(ڬOCFAROC F(ˬOFFFOR F(F3FOR F( ##FARF|F(OsFAR oF(F+FAR cF(%F+FA0(FVF(~NF+F2F(FJF(r#FF(F[(?ܬH_@h@?<7i@?^@#-M 1zKFx $ F"9xpO3AbF F(#AbFF(9x ## F;x%p0Bؗq@,A!&F#*FFX*F#F F 0 P! +V! 1)+ 0F0+F"!AHF (FA.8" ,T#)FF{F(q F 3 T#F+FF(aU#F)F`F(V F 3 U#F+FF(FK 6^U5mOE 0 S0"P3)FF3F()  2*(" +FFFVF(Eюi@@ǎ@.@-MFF# FF(.%F.F  ;x3ARFAF0FF\@ @\@1FCFF6B"F-MF0F ]Kx+@i+x@e$ 'FCSO #FZFFXFF(UBJSFZFFXFF(E@m3O F ZFFXFF@m3FZFFXFF8#FFZFXFFعO FF ZFXFFpFFZFXFF(m F q0C   p0EF#"#FFeF(?hw#4#O #ZFFFF(##ZFF#F(о@@x@q0#AD#Z0HCp0B/@0Axd@#ARF(#F(L3h+@!iKABFhKF(;"eKFxABF(-#ABFF(" " XK_ S Khm)F+lѺxٺxٺ xFFxF9F 8OC!ABFRF(Yp0B]$O  #FFe,@lOC!ABF$q##AbF F(?#8OsARFF F(?]ٺ I@@H FI@@I| G0PLP0Jpq0#A#0C4@BH@}  @W@m";O#OFABF(4,osh+t!ed!KF pCARF(2O`cARF #F(%@f#FARF# |F(OanK0BBFARcF( 0\  CO Dp$ #CQCSOpbCSC C!JFA(B7F2C#OrCqA|B%Fp$AB#FF(#FAB!F!KA$BF@wF(3h+@M"!hFA$BF(n,I D #!ABFF(w xC(8 9F8 P8Os!A,BFF(^OCA,BFOCF(POSA,BFOsF(BQKARFOKF(60#ARF }F(* Ob[ FA$B~F(O3FABO oF( +x:v%FFqp0B!h#y!CFORPF(sh+@##ABFF?F(ڬ"KFxAB1F(̬;&F3FOR!0F!F(+x@ OS"F!F3F-(!F H04F7l@Zl@w?< @@\0J" ABF(,  ABF( AB(? !  F@FAB4pFFPOcA$BFFF(?@FF p0E<$q0CO#F 2* DTBBF!FH$#FFq0+A "y;}BѢhiB)F;H57h'FFcp0Bq0#Ah+ ###"FFF+i+ ,("""FF45q03AD3X0HC+p0BG#Ab! Kh+?KHS"&F'FF;xFEm@@<@@H@@B-M̂@FxNF #" 0 F# Kh?F;O @##`;nB@݀e`d0$p0Bـ+@ -@FA(R)FF(@O#ABF@FF(@р#FA(R@F}F(@ŀ-̀#A(R! nF(@A(S#FF~xHwK[i!*FFGAxc@Atco#FFH #OHORF F("Bp!FCFOR F(F*F Kh;W%H]##A(RF F(A(SFF#}H@sAB!# F(ڮACFF#qH##A(RF yF(%F+FAB(FlF(OOOt pHFCFAR(FSF(O8 F;FAR(FBF(r66F6ZFIJ3F(FA(BF#)F(qFZ3C#Or(FCqA|BF(\#FAB(FF(PFCFAR(FF(CSF:F! WF(9F;FAR(FF(,[#Ab!(FF($!0RF##FFF( #"0RF#FFF(?H@܏@@@B@@0!FB! F=F(7!FFtFx  #"F F5T 0-*"@F"F@F(?"/"""FFo FF(5!FF4F(r-)@FF"F F(""9)@HA 7@-M!xFODFEN  p0BӸALANz!AH"3hD# *xK "KFKHKKKK!^KJ` !H5#+`#"#3F(F{H""yKzL`zK#`zK`**wJ"`"`(#hO#3#s#`pKh2"`nKh2"`"kK`l"kK`kKpRKhjK`n`hK2_DC +eJ٣ (cH@B*$++#! +Q#@@@@@C@@C@@C@C@C@@@#`u## ##q0 OBFFORmFF?Hivq0F +$Еq0vOs!ARFTFO#ORFJF#ARFF@F(X Os!AF3F(!F#H.@@֐@H@X@7i@j@e@ie@e@d@ee@n@e@n@@@@@@<@^3\@0D@@@@ @@@@`@(.@L@ +#!NJ3` 3+B#FL#`B#M#`*h@"2#3`(ـH%xFՋH&BH0NՅKi GF!HO6!ABFtF(@-{H"!F FAr`F(@qH"!F FARLF(@gHRAxpB]HnRUxF%[Opp0B'?%O "#FFKF(D@  7B#h3Nq0+A5"#hF\F#+F.F@#hF\3+F"F0F#h\3+FFp0F#h\3+FF(FX+h_# 3`)H#'*hB#`"##`#3`"Kh(+hT#3`KhCKhKS" @#B8(BH7` !hH#h3@h@d@<@@@*@d@@@Kl@8@ψ@`@\@H@i@@F#O FB$x(#'*hB#`EO@#3`rKhrKh3rKS @#B;<(nmH  C2O2CC!AR C4F(D `7AS:F9FOC8F?(ZHDoS7`t(p#h3PFBFF#E$O3HCAR! C@F(FH;xASBFAFOC@FX?H H2+h#3`6H# '*hB#`!# '*hB#`'##` #l"3`+Khn(ۮ+hY #3`ر#HR 7`!hH#h3 7`!hH#h3+h#3`H+h(#l"3` Khng H`@\@H@@G@@܉@X@J@ @*@v@@#0B#LM0B#LM0B#LM0B!$#FAB F)F(@"K FxABF(@O3A FOs F(@3&Lh! #F> -A$#F 3Q+*D+ -,q0@Os#ARFFF(?fFjHʻdKh@"bKfM`ĕ#F(@]I h \Kh "` `xFXKXNXKddYOp0B[VKpO $p0 $ QO3 #;`#;`xJKx+O"#AFFR(%Ozr=NpcEE4,x$3K1O1K؀-Np0B [E +x@d%[ [[([[$K#P; +#3p46"F5p!F#FpF#C##F$(HGd@<@@ @,T@@?@4@0@R@)@H@M@>@.@(@$@4@@D;`hq)AըII])\!F Ozr056Vq0#A<:x*9КK30Bq*J5x-7"I:p x  2 pB8F0"F!F#pF("U # C#F##F(m43736*F(%*":pp5pp*уB8F5x0pxkB "hI:p x  2 pݲ5pB#aJ;px  3p#1x;p+pp91pF!F#F(1x"Q #*"F!F#F(" xQ # C#F#F (#:J;px  3poq0+A5p0B"0Kd0K `0K `03p"#)FF(й#h#+`1#H 03_#h #+` H03W#h # +` H03N FѺHHq06Ѻ)@>@(@h@4@0@@-@e@@*@HH$!FH4z ,хHu$!FH4o ,O 9FHf    #{C;#& wHPq03A6.3̺" X 1FFjHD0"SF1FFcHCO3!A8RFF(@ 1F@# F @ALH"F 1F FGH?"F 1F F@H#"F1F F9H!F6H-H "1FF |-H?4 ,$ H "1FF c H?4 ,$HP "1FF JH?4 ,0,F!Hw!FHO +~n @l@o@|@@*@@@@@p@@L"hOAAPGh" !APGOBhFAPGh"OAOPGOBhFOPGh" !APGO2APFhG @8FD DCB4,M\P.F;i\I%xF0+Sx\D 3۲x+$ J?\D D 3۲9+Կ0;W;B8 $0BO0h@-MFFKS'#KYFS: 0H+FfKFj8FPGFXFZFHV@H<-@"8IF9FF<1ղ-%x]@CH]۲@20C*Ʋ @@@`-B-?O0D"KEx+?+#HO0#<䲣@E]@C@@%(CL@K+ Op Eh@+ H O0O0@@#g@N@UUOp-MFFF #F&w&M;zBRFhMO1A8`G 0*_@BYF F[O1FhA`GYF FPO1FhA`G2FO1A`hG6OK _YF F8  FO1A`hG_@-AF%F. #cCjx\BCx܀B2x5OBCR0O1BbBrhBFA0`G A0`h*IBG"h!A`G Fihf (OBA0`FhG 3y"!A@hG"HF5OzpFOBO@AA0`hG"FO1A0`hG Fg("F!A@hGOzp F(@@ Ԇyy$,$ F4g, !KhKC""KFA`hG@,@@-EFrF{0 +&&F$ b4,J  0FKjh F#!FF JR("FUWk2q@B4B$ F(@X@-A!F >O!:h Fi(O$"rB;h"!FF_! F(r+<;h"!FFJ ".%q%qA;h!F!F4o FY(.;h0!qAF!F! FC(ђ;h!q6AF!F ! F/(~(@-M KFyFOEF>OE=L>Mq:K"h;H"+hD# 4y6Kh3KS"@d F0+A O:h!(F2F((F1(?;h2 F)F"F3F(:hF(F2F((F;h: F)F"F3F(:hF(F2xF((F(*F!H0F5"+h(@,@@~@b@( IH " L I4_2BIH` g@@@BA@-MFD0 FFF F"6OFhA`Gh"O@aA0`GK+.HB)F*HAF'Hd%>"$OCDwB#.F0+A5\DF TEӹK[hO10G*S<њ KG$04D`@.@\@r@@@-MFF#X,&F5FO@,A!'L0 GR%0B K7B)F H$Hh"OAOPGBp{OBOPFhG)0C   Oc0RF# FFx#0F#RFF F( F@x@@-M FFFFJFdd BF09F@hG+y+y 1h[4 A@B"0@qGAC"F#F(H xP@@@-M$"!F D+ q FyF!KLhKA8PC"O1ch GO1AIGObA<h;IG"OqAhG"!AhGO\rOqA`hG N7Or:FhGEO "OE#'E)"A`FhG F(eH+y@'A#"! wOrF0hG  0;A"Oq00G7@@,@(@@8?<ړ@0;A O1ch0G ^#B'0!ch 0G3h `3kD;D,7Eљ0;AB3h`3kD;D<3[sC#C#9FFFO1ch A`G# @ @@3hIH`3kD;D?3hDH`3kD;D 1ɲ07Eѣh"!A`G (OSA#OR! OS"! "!APhGh"!APG3h3B+y K>Jhh?|cC:F#8FoFȹF#8FgFF#8F_FH#:F8FWF(7F 0C   VE FPFF #8F(ј0@!& 3F7w#4#'#RFFF+F(##RF#F(лؾ@Ծ@о@̾@Ⱦ@ľ@@@ 2AD2XHCBlL+"!A`hGhK .S"0 "s+*aK@`KaJFOPh^IGObA@FhG"OQOPhGOROPFhGh(">!APG03"OqAPhGA@hJJJIGJK!xA@hG"A@FhG ('"O1OPhG#BZ%3N#;@ $#FC:@# !:"@@A@hG '0'Jh @A@G@A@hGFA@hG-h.  @A@G5 JV JT A\C3@x@@ }@Jm@OAA@GP-'pKAP]Pp Cht!GH@FHL"!A@hG;K!xA@hG8KhK8K&HS"4!/F1J1H)F0I]B"jAh!z-BBHB OHB@ HB34 FL%FFB2h"zKBh7l@@BMbј@@@Zl@@< ?ܾ@@@@x@w```0+A "z3~BhiB)F H 56 F$FFOO B?Q0#A3i+ #"FFF:si+ TOr"!F F"+46#yӬF<@-MWFTFF HF!FHYF~H+|H M"F0A`GwKA0`htIBGO  QhPFkK-@!PxhOEl|Lc xCLCBRB"B20_IA0`G- `!!"O@B0 CAO1GVJ+O`2@A40RIB|RGz;#B"BboxAA<0BG0OqAG?Kh+8- _22B"O1A0BBG%B*%B1$BJOzp (J [ O1`A0`"0 MG Fn 226"Oq0G50+A5 3' '?/Or0F: G?OrF00G4#\@r@@@(@ 3?(?#-M# # F Fsy  լLO1A`chG"A`FhGKhOO 44FQyF%NEз0+A@ŀ"F!(F(𹀔K%#$*F)F F[FdE[F#&' JMI E@$3 KKO KM~K F B@%|KwN ءxO B@&pM B@#'FqJrIrH B@فhK$#"#!FF#F fKeMeKF\K B@сO #XI B@($ZN B@t4@O 44EFy$OGF%"AFF+05 -FE yx F%050 Ao 0 T 0#A4657  \+K8!K< [hO18G y +x+r#:p+pB @B#+p#;p 33 BٲBڲ  Fp@(@@|@k@u@f@p@a@/@\@W@ 0+AE5373  6 @B#pOK2phOO T33"E 32p BٲBڲ  F4B:pOѹ yx+"KhOO)FF T33F(f"}KhOO)FF U33F(Rѻ?##0qK8p# "F!F[FfK[hO1 Grm#2p" pZKhO T33)FFF"SKh)FOF U33F(?7 F 03A63 yի]+CJ@K]h"1FF 33^F( @A32 $yF$TT4,[ 0#A43567(KO  yx+ѸF"KDK[hO1Grp# p#*p3p @*x ;B8F*p2xB(FE2pѽ A y\ 3(@|@@a@p@/@ OOUF B)њK!#"#F;FMLL SE? 0C ـ  3 45 0+A< 53 3333 x p 3x3BٲpxBڲp Fp3BbngK y x+# pO_K)FhFO T33HF(î"WKh)FOF U335F("MKh)FOF _33"F(p#p!Fp;J ";F"F6NshO1 G?h#p x)F C p+Kxh"F 33F(X4 y" KKSD 0O10G x+  ##p;p 6B @"x;pB8F"p*xB(F*p" K |@W@\@@p@(@/@k@ 0#A''MJ yxt)t!H &! H H )pU1p7/46VX 9!H I0xY] )p 0+ApՁKo  Kh#H$2h 22Y+ D")FF'F( 7Bx x3hRrR@)FZF3 F(x x3hRrR)FZF3F(r`O2h\)FT3ZFF(b2h)F\U3ZFF(U533 B~@OO 44FiyF!Bж0 AQ"X!0F#F (E0O@Z3")FFF( /MyO1A`hGhOrO1AG y##I B? A\*?+3IT%N13 y?  THTTT@k@,@@@\@/@D@@@@@p@(@-M$ F("!F DL@ Da FH TFBF+H: +؄#! " H$O#F%FB  "#FF 3y "#!FE|(,X yO F("!~L/0_BE +h`VDh ##6(F`B2(+!ѻ 0F;"YFG(02XFw020+`s0F02X+~+4 0B,4F;h$Q;hH;hh`XFB`=h%Dkh+Ыh+лh3`'/-_>O/@XРỶРỶ440 SPР (/(@@@T@F=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡK<_ pGJK(FF@|@K_pG0P<0[ J7_C]_7P,_PC`K4_O  pGK$_#@@@  pGpFF(F FF0F&KF$_3"@C+#".OcsC#@_#H)FHH pOcOSOS H)F H H#Os #`Єm@s@*@cm@-E$F%FOtO 3B!(F@J;@ICC_G5kC@_H50 C?,O@D5-ѿ_ KLPFЀ-MoH!nHZmH{mK6_*XX(fJ4C4aKB_T_I`H4$^J9C9[J8C8TJ_UK @C[3C$_5_D_MKLy_3@@3*FFGNS_BBO3O O AIAHF3 *O`b; O C_K "_K _K4+Ѡ#)#+# # fFF8I(H FRF$KU+_C+BI H FH J2_CS_2:dIIHKn@s@*@Хm@m@ЀDHe@m@@m@2n@`n@ Q/b:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/Q ; aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P-PA/P-PA/-@ @@@w@@@@ᆳᆳᆳᆳᆳ        p  ~@@                                             0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-                                8(HՖ@@@m@#@@ @@@}@]@C@#@5i@5@3i@L@4i@c@6i@c@d@Qj@e@qc@@/@C@[@K'@%@&@ނ@@@@@(@Y @3 @)@ @ @ @4800T $go048<4800T $go048<0:+E3:).4:'+05)-(2V6-(+{/"3@!$@5$@ґ@@@f@W@e@s@@@@@@Ã@σ@ ۃ@ @ @ @ ] @9 @Zn^MM *XX4 @  J@!@'@-@3@9@?@E@K@R@Y@`@g@r@}@@@@@y@0:+E3:).4:'+05)-(2V6-(+{/"3I@ @)@ @E@      @ %2%5 %6%7 %8%:a& `%9#a( a& `%:a•:`%;a%<a a a$ A(”<…;…:†:…9„<€;;:„:€99ƒ9„98„87„7M@`M`M`@M`@ M`@M`@ M`@M`@ M`@ M`@ M`@ O`@!M` @  M`@ M@`@ M`@ @@ a@@!`a`a`a4*`H4*`H4*`4+`H4+`H4+`4+@    @000 0@@P`@@a` a`@ap ap@a@aa0`apa`apaa`apaqa` a a@ a@!ap!ap"aP@a@ a@@a@a@a@aaaqa"aa  4 @*T` 44@@JJTT` ` 4  **` 44@@@JJTT` ` Zn^ __of_translate_addresshws_ref_clock_sethws_is_serdes_activesys_env_model_getddr3_ctrl_get_junc_tempddr3_ctrl_get_junc_temppattern_table_get_wordmv_ddr_rl_dqs_burstis_prfa_donehws_update_serdes_phy_selectorshws_serdes_get_max_lanesys_env_unit_max_num_getmv_ddr_is_training_donemv_ddr_is_odpg_donehws_serdes_xaui_topology_verifyhws_serdes_topology_verify(((((AAAAAABBBBBB                                                                                bootcmd=run distro_bootcmdbootdelay=3baudrate=115200ethprime=eth2loadaddr=0x800000arch=armcpu=armv7board=turris_omniaboard_name=turris_omniavendor=CZ.NICsoc=mvebuusb_ignorelist=mtdids=mtdparts=arocsdxbmv_ddr: 14.0.0Error: Wrong device size of Cs: Error: Wrong Memory size of Cs: DDR3%s Training Sequence - 2nd boot - Skip %s Training Sequence - FAILED %s Training Sequence - Switching XBAR Window to FastPath Window ddr3_fast_path_dynamic_cs_size_config FAILED %s Training Sequence - Ended Successfully RE is too long (code overflow)RE is too long (data overflow)Jump offset is too bigu-boot,i2c-transaction-bytes### ERROR ### Please RESET the board ### No closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\/aliaseslinux,phandle#address-cells#size-cellsCould not read count from timer (err %d) resetting ... NONEDetected Device ID %s %s: Device ID Error, using 4 SerDes lanes %s: Error: Lane#4 on Device 6810 is not Active. mv_seq_exec_ext:Error: SerDes lane %d is not valid %s: SerDes lane #%d is not Active %s: Error: ref_clock %d for SerDes lane #%d, type %d is not supported hws_ref_clock_set: ref clock is not valid for serdes type %d board SerDes lanes topology details: | Lane # | Speed | Type | -------------------------------- | | | Returning to BootROM (return address 0x%08x)... alloc space exhausted ptr %lx limit %x cyclic function %s took too long: %lldus vs %dus max poll_op_execute: TIMEOUT ## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" unknown cmd (%d) at %d ^%s$Error compiling regex: %s %s: %s: error: gpio %s%d not reserved %s %s: Invalid cs %d (err=%d) udevice *)(NULLi2c@11000->i2cmux@70->i2c@0Cannot get I2C bus %s: uclass_get_device_by_name failed: %i generic_%xi2c_generic_chip_drvCannot get %s I2C chip: i2c_get_chip failed: %i MCUomnia_mcu_read failed: %i, reset status unknown! EEPROMcannot read EEPROM: %d bad EEPROM magic number (%08x, should be %08x) firstbad %s EEPROM CRC (stored %08x, computed %08x) secondMemory config from EEPROM read failed! Falling back to default 1 GiB! 1333HUnsupported value %s for DDR3 speed in EEPROM! Fixing up DDR3 speed to %s as requested by reset button Fixing up DDR3 speed (EEPROM defines %s) malloc() failedInvalid bus %d (err=%d) %s %s: Invalid chip select %d:%d (err=%d) spi_flash_probe_bus_cs() failedspi_flash_read() failedbad CRCCannot import environment: errno = %d import failedngpiosmvebu%d_clock-frequencyu-boot,i2c-offset-lenregcell-indexu-boot,i2c-slave-addri2c-parentreg-offsetreg-shiftreg-io-widthspi-max-frequencyspi-cpolspi-cphaspi-cs-highspi-3wirespi-half-duplexspi-tx-bus-widthspi-rx-bus-widthstatusokayMissing DTB root_driverspl_init() failed: %d /chosenstdout-pathconsoleNo serial driver found U-Boot SPL 2025.10-OpenWrt-r32933-4ccb782af7 (May 13 2026 - 22:42:09 +0000) High speed PHY - Version: 2.0omnia_msata_slotMiniPCIe/mSATA card detection... pcieforced to MiniPCIe via env sataforced to mSATA via env autounsupported env value '%s', fallback to... omnia_mcu_read failed: %i, defaulting to MiniPCIe card none mSATA MiniPCIe omnia_wwan_slotWWAN slot configuration... usb3USB3.0 PCIe+USB2.0 Error: too many serdes lanes specified by board LAST_SERDES_TYPE%s: Warning: Wrong serdes type %s serdes#%d %s: Error: Wrong unit type (%u) %s: Error retrieving device ID (%x), using default ID = %x %s: Error: serdes lane %d is configured to type %s: type already in use %s: Warning: serdes lane %d is set to type %s. %s: Maximum supported lanes are already set to this type (limit = %d) %s: Warning: serdes lane %d type is %s: current device support only %d units of this type. %s: SerDes lane #%d is disabled %s: Warning: SerDes lane #%d and type %d are not supported together %s: Warning: wrong number of lanes is set to XAUI - %d %s: XAUI has to be defined on 4 lanes %s: Warning: wrong number of lanes is set to RXAUI - %d %s: RXAUI has to be defined on 2 lanes hws_power_up_serdes_lanes: unsupported ref clock serdes_power_up_ctrl: serdes type %d and speed %d are not supported together High speed PHY - Ended Successfully %s %s Warning: Unsupported freq mode for 333Mhz configured(%d) Warning: Unsupported freq mode for 400Mhz configured(%d) Warning: Unsupported freq mode for 533Mhz configured(%d) Warning: Unsupported freq mode for 667Mhz configured(%d) Warning: Unsupported freq mode for 800Mhz configured(%d) mv_ddr: unsupported dram device type found mv_ddr: negative timing data found mv_ddr: unsupported dram module type found mv_ddr: unsupported cas write latency value found mv_ddr: unsupported cas latency value found mv_ddr: failed to update topology ddr3 init failed: %d done Enabling A385 watchdog with %u minutes timeout... Disabling MCU watchdog... omnia_mcu_write failed: %i Initializing LAN eth switch... Trying to boot from %s SPL: Unsupported Boot Device! ERROR: Invalid data checksum in kwbimage Error: %d SPL: failed to boot from all boot devices ranges->i2c_mux_bus_drvreset-gpios#gpio-cells%s.%sset_dir_flagsset_valueSF: Failed to set up slave spi-flash%s %s: Macronix Quad bit not set enabling reset hack; may not recover from unexpected reboots %s %s: Cannot set speed (err=%d) %s %s: Cannot set mode (err=%d) spi_flashjedec_spi_norSPI probe failed. /configu-boot,spl-payload-offsetERROR: Invalid kwbimage v1 ERROR: Wrong blockid (0x%x) in SPI kwbimage ERROR: Wrong srcaddr (0x%08x) in kwbimage ERROR: Wrong blocksize (0x%08x) in kwbimage U-Bootns16550ns16550aingenic,jz4780-uartnvidia,tegra20-uartsnps,dw-apb-uartintel,xscale-uartns16550_serialjedec,spi-normaxim,max7356maxim,max7357maxim,max7358maxim,max7367maxim,max7368maxim,max7369nxp,pca9543nxp,pca9544nxp,pca9545nxp,pca9546nxp,pca9547nxp,pca9548nxp,pca9646nxp,pca9847pca954xi2c_muxmarvell,mv64xxx-i2cmarvell,mv78230-i2callwinner,sun4i-a10-i2callwinner,sun6i-a31-i2ci2c_mvtwsiatmel,atsha204atmel,atsha204amarvell,orion-gpiogpio_mvebusimple_busmiscblkSPIFlashSPIBOOTROM/clocks/firmware/reserved-memory6810682068116828PCIe0PCIe1PCIe2PCIe3SATA0SATA1SATA2SATA3SGMII0SGMII1SGMII2QSGMIIUSB3 HOST0USB3 HOST1USB3 DEVICESGMII3RXAUIDEFAULT SERDES*** spi_xfer: Time out during SPI transfer %s: TSEN not ready error: %s: polling timeout A38x does not support interface 0x%x DDR3 Training Sequence - Ver TIP-1.29.Bist Activate: poll failure 2 DDR Training Sequence - Start scrubbing DDR3 Training Sequence - End scrubbing DDR3 init controller - FAILED 0x%x DDR3 init_sequence - FAILED 0x%x ck_delayError: %s is not initialized (Algo Components Validation) phy_reg3_valg_rtt_nomg_dicg_zpri_datag_znri_datag_zpri_ctrlg_znri_ctrlg_zpodt_datag_znodt_datag_zpodt_ctrlg_znodt_ctrltip_dunit_mux_select_funcmv_ddr_dunit_writemv_ddr_dunit_readmv_ddr_phy_writemv_ddr_phy_readtip_get_freq_config_info_functip_set_freq_divider_functip_get_clock_ratiodq_map_tabledfs_low_freqhws_ddr3_tip_init_controller failure adll_calibration failure ddr3_tip_freq_set failure ddr3_tip_dynamic_write_leveling LF failure ddr3_tip_load_all_pattern_to_mem failure CS #%d polling failed for Old WL result ddr3_tip_dynamic_write_leveling failure polling failed for Old RL result ddr3_tip_dynamic_read_leveling failure ddr3_tip_dynamic_write_leveling_supp failure ddr3_tip_pbs_rx failure CS #%d ddr3_tip_pbs_tx failure CS #%d ddr3_tip_dynamic_write_leveling TF failure ddr3_tip_load_all_pattern_to_mem failure ddr3_tip_dynamic_read_leveling TF failure mv_ddr_rl_dqs_burst TF failure ddr3_tip_vref failure ddr3_tip_centralization_rx failure CS #%d ddr3_tip_dynamic_write_leveling_supp TF failure CS #%d ddr3_tip_centralization_tx failure CS #%d Title: I/F# , Tj, Calibration_n0, Calibration_p0, Calibration_n1, Calibration_p1, Calibration_n2, Calibration_p2,CS%d , VWTx, VWRx, WL_tot, WL_ADLL, WL_PH, RL_Tot, RL_ADLL, RL_PH, RL_Smp, Cen_tx, Cen_rx, Vref, DQVref, PBSTx-Pad%d,PBSRx-Pad%d,Data: %d,%d,%d,%d,%d,%d,******** DRAM initialization Failed (res 0x%x) ******** mv_ddr: completed successfully max poll IF #%d write_mrs_cmd: Poll cmd failddr3_tip_read_training_result load_res = NULLpup_num %d not valid if_id %d not valid WL: DDR3 poll failed(3)WL: DDR3 poll (4) failed (Data: 0x%x) WL: IF %d BUS %d failed, reg 0x%x PBS failed for IF #%d dq_map_table not initialized RL: DDR3 poll failed(1) IF %d _read Leveling failed for IF %d Training Done Failed Training Result Failed ODPG disable failed _r_l: DDR3 poll failed(2) for bus %dSpecial: Pup lock fail, pat %d IF %d pup %d CS number is different per bus (IF %d BUS %d cs_num %d curr_cs_num %d) WARNING:Wrong configuration for pup #%d CS mask and CS mirroring for all pups should be the same polling failed IF %d Freq_set: DDR3 poll failed on SR entry Freq_set: DDR3 poll failed(1) Freq_set: DDR3 poll failed(2)Freq_set: DDR3 poll failed(3)Wl_supp_align_err_shift: unexpected phase WL Supp: IF %d bus_id %d Failed ! WL Supp: IF %d failed fail, IF %d pup %d DDR3 A38x silicon init - FAILED 0x%x DDR3 Pre silicon Config - FAILED 0x%x DDR3 silicon get target frequency - FAILED 0x%x DDR3 Post Init - FAILED 0x%x DDR3 Pre Algo Config - FAILED 0x%x Run_alg: tuning failed %d DDR3 run algorithm - FAILED 0x%x DDR3 Post Algo Config - FAILED 0x%x marvell,orion-timermarvell,armada-370-timermarvell,armada-xp-timerorion_timermarvell,orion-spimarvell,armada-375-spimarvell,armada-380-spimarvell,armada-xp-spimvebu_spicompatible%s %s: flash operation timed out env_buf [%u bytes] too small for value of "%s" not locked%s: cs %d, pass_lock_num %d, max_bus_num %d, init_pass_lock_num %d %s: subphy %d %s %s: timeout error: %s: unsupported pattern type [%d] found WL Supp: CS# %d: IF %d failed %s: NULL result pointer found Freq_set: DDR3 poll failed(1)training done failed WLValues was changed from 0x%Xto 0x%Xodpg disable failed _r_l: DDR3 poll failed(2) for IF %d CS %d bus %dERROR: ck_delay is not initialized! error param 4 train_status is NULL wrong parameter train_cs_type %d edge_comp %d pattern %d direction %d search_dir %d control_element %d result_type %d pup_num %d pup_access_type %d if_id %d access_type %d .flags## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' himport_r: can't insert "%s=%s" into hash table *** Warning - %s, using default environment ## Error: Environment import failed: errno = %d %s: Bad cell count for %s ERROR: One of ck_delay values not initialized!!! rootnopsimple-bussimple-mfdi2c_generici2c-chipspi_genericspi_generic_drv1066F1333H1600K RU3m ; F J R Z b j r z  N V ^ f n v ~                                         " & * . 2 6 : > B F J N R V \  pt x |C\  pt x |C\  pt x |C@Ih?@ @@3P@6@ P@s@98P@ڀ@7`P@s@7 Q@ @&@7@HQ@@tY@\@]@Y@y@sP@d@ef@P@:@n`Q@ @8@$Q@@}V@g@W@ @:W@uY@@8@X@w@@oHP@@uτ@ 4@U@܄@@؄@!a@˄@@@3@6@6@W@7X@I @7@E7@ɖ@9@:X@%8@7@Ƅ@ImX@@N@B@n@ @@o}X@ _@smX@}:@9@@ $ޖ@u@t @@}f@3d@ 8 ( Turris Omnia7!cznic,turris-omniamarvell,armada385marvell,armada380aliases ,/soc/internal-regs/serial@120004/soc/internal-regs/i2c@11000'9/soc/internal-regs/i2c@11000/i2cmux@70>/soc/spi@10600soc"!marvell,armada380-mbussimple-busCN`Pq    internal-regs !simple-busqi2c@11000+!marvell,mv78230-a0-i2cmarvell,mv64xxx-i2cx |okayi2cmux@70 !nxp,pca9547xpi2c@0xi2c@1xi2c@5xcrypto@64!atmel,atsha204axdserial@12000!!marvell,armada-38x-uartns16550ax |okaytimer@203001!marvell,armada-380-timermarvell,armada-xp-timerx0@0P   spi@10600)!marvell,armada-380-spimarvell,orion-spi xP|okaychosen /soc/internal-regs/serial@12000 #address-cells#size-cellsmodelcompatibleserial0i2c0i2c1spi0controllerpcie-mem-aperturepcie-io-aperturerangesregstatusreg-shiftreg-io-widthinterrupts-extendedcell-indexstdout-path` @ᆳ (OР iHMP  H4P  MOЍHM  H4P  OР iHM! H4P  HOР iHMp! H4P  OР iHM! H4P x OР iHM0" H4P | hOР iHM" H4P V1)  <Oo/Oo   P!:0@" Р /////@ Q/00////00S+ Q+ \& /A-P@ ` pV: \ : "& \*000C0@0/ /@- 0 0@- @P @oRPPU P @@oT RS   P00E-P@0 `R` T 0S0:00P긠pP  0P T 0S0#0%P ЍPPVTPU 0 0S%P T00RQ# PS 0@- ^ \ ^\PX@@TPL@ \!a2>2@0 //0 0  //@-@ nM-P^̰@`0040p C@Q&"       04 8 P    B  B6ЍRQM-@00P0S,`pPᨀP"  $P0SX  ᲠZ B R  T 0  AЍ:AA @0SQM-  P R(`,@qPPm 00S 0g Z00T 0!HQIQ 0S0XV0P1p0 Z V 0&R @ Ѝ[ @  @@)@@00 V  R 0p0R B `000 R V 0S :@-@PqT00ЍM-`@qQ4G1U: 1`MF 00LT W030#X0S0 CRS  R 0 0T0F0 C 0?? 0ttP S :!  Q *  `g`h5Th0@P/ R/0@- R 0 R0#s01 # @0 PUS A00\ "r !\ "0 p .~. p .~. %s: Unknown relocation type %llx %s: Relocation at %p is out of range (%lx) VarToFile0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-RUNTSERVnP̬ԭLʅ̅̅,LDas U-BootIBI SYSTnH % UbEfiVa@-qS\0S/  0SR0///0 1C4SP 00CP S#0//0 S0 Q00CsQ0//0 R R/00//P00/0v00 000)S0//P00/f\P00/va00 000S/%/P0000/j\0@-P @\*  0S*0P*SP: S*S0@ 2/ <Ͽ03?0p@-@M |8@P8 <hb 0 0 0 8< <<0 @A0z,00 4 u 0$ (p000 i00 0 bVnNz Z c0C0vVS@0 @01 0xCt?0_ @-0???Oo0??Oo///@01_  02_0 _ _00'/@-/@@-0 101>/ 0???Oo|s@-@P 00`,00 P  P"0\U1t 101/d00S  000 U0Ѝp@/Ѝpbbbрb|/@-@[^ c<00C<0<1,c@-@M^ U<00C<0<#, c@-@?^ G<00C<0<,1c@-@1^ 9<00C<0<,Ac@-@#^ +<00C<0<+Mc@-@^ <00C<0<+Wc@-@^ <00C<0t<+\c-P0_ @0P^ B2^ )$0! _ _//,00_ _//80_0P P P/// @-@P Pd7P X^@Ѝ刲@P 4@ 010Tiocvccc@@-< <@010lP A%00@Tic40P A@ @  0 _S/@$PрP/M-`@P ࠀp _0_ SS 00 0T3#R#2P  SR PUЍs@-rP` @ĀȌ_H0 @ĀȌ_H0 }*Ѝp@T@T E-@Ppq`p 0 P ( Ѝ0 c@-4@0S6$ P00Pi@0@SQ@-@Pp,M `P"ADoK(0Q$0Q?P``PP00S` 24: _  _0 _U0,ЍPis@-@P`7 L P <<Ѝp 0 P .dJddp@-@P`* $P 0 p@pd@- @ P Ѝ00  P  P00s0M-鈡`0Sp-pQ ,P@T IЍ@1PE  $r "$. Ă  $ (  W@T0 <00 S00@P PX  2-W p0 tT0 $0(0, 4 8<(5Mi0  R 2" B 8 Z@P$ @fS8Hjjj-$M 0 04080 <@  0 j$Ѝ 2/ gp@-0PC_ P@Tp  p@@P@ ᛛP@,Ppp@jj kjD03_8S/@- @P@@jM-HMPp`0@P,00 0 0BS,0S   eHЍ!8#؂0P0 008 0S:0$0( (0HS$0S 0 ,00 400`P 4@T08 0@4OZ*!80# 08- 0@0,0@pp0  10Gq[4p 08Cqp@ pG0` ! 8#OS$kp@-@TpP`P}h v1Q H03?S ,1$00p?kjkkk~@-MP@R`pW 0 -!SU A <Ͽ2/ @U0@@@@D4?P0Ѝ`DP0 @PM-`@MM6 $tD0H`L`P`T`k"D g"00040S 80SPP P MMdgލЍQ, 0$&0$P K0SxP0 F`C``wo0P0400%0`V2  P, M>00d%0$PP ؤD5D R  "$0C8p0`$XxP`n`,0 ^[XpU 0 p,0 t~rP0t0͵,0PU4 M+!U8pt [0  U M+ M Mt ML PZP{  :PPA U=8#p 0 p$0# P 0#$P mZ 0PPS im$Q c<0S >@D~?o2P0SP`VX0L0P0@@SH8P0M. 04P0PS L0S1L0@jP PPa$0Q D0  ^P $0SP0 }0P 0px hu 0\!S qP 80S  LP Ѝ05pqp@-``P @ p  E-@M` PPp & ZЍ0R=0C?o20S 0WfS*pI GPZ   L:ЍE T@0P 0* PP" ɕpP pP `PPP0 PwP| P lݓPڠP Pt} @{l03/,t5Dq-q p pTiq|qqqq@-@M@@ @ 03?@o@ЍM-P00M0p0  0(0  P  , ((,\H`ሠ儠P0 PV 8Z00Ѝ 8R ἠP&tZ tcPutQ mV 0S S S@00 03?0S\7 C`L@ W0`D0P P   ( ,P,0L`P0(0TH0000000 @02/0003?0000SSLp_P  ,0 0T6 0 0000?(n0S 0 00|` P %Q031 R 532 0 PJ] @嘀F P`D X, pV㨀@ P (fs+LT  %P  $P $jP $uP 0 3?004$Pu 9sD0S03?0P0S 44p$TLP`} XH|0呀 00@$00T00删00H?o20S` @?@P 0, ,0P^,``,005 0000 `,0PC  &x Tx@@Z@#T L;H900U x  $/ ???A00$ TS 0@@RS @$  D0S "0SrrS P x@X,000PaV ,0, GP",    `~r+( 1 AQ?o20S 6+jP$@   4/0呀Xx4 @4/P  4/P  4/PV xhqrr!r'VSrPonri|h1s{ iTs @4tt irir ir iri!s ~ssAh;s ts)tcttuuKuXu!h;cuuu//P0000/1R@-vр000Cs R  0 Br P 0///0QS -lQ  Q0 S 00S0\0S /W0 _A- 0`CqpqP0U:@`T PLTDP R ,,@o0DV0D~рp@-@@ @0PCtq8rq4@PTp ꨁVVVˁp@-d^q`@XP`VTHUqDSqp0S T:, @HP؁~@-L@BP 8=P (8P`^-@-@ M < 00 @@0 000r Ѝ@-EM@P p{P T00 @ ` V <0 0@Eߍi ƙ@P0\  @P 0< 0$ @P OXr"  0S/L R M-M T@T b`P P@Ѝ2 $Pp:P\᪓PP P7 8pP1,P獹Pㇱ03/PP ݓpW0 LPP 0S `PP  偛P !e P R dPpHnP Г,낉8?:DO\p@- 0 M\`V-?P?P@0 `P" 2P@?P0  !q !! Rq!d0P0S01 ݍp@-@P@MpPlp`   BR # ⚕P |`0 wP Ѝ@Ѝp@-M` P@P U@ 1s #8 0 0ލp考@-P Ѝp@-@P``  LPL PL PL P tL P`L PP Pp <L4L剒oPꚃ˃؃ド݉p@-MP F0S 0 P剿P P@/ 0(U@P`PeP! Pp@0 ⸚Pp@0L̚@P  ,@P `  P @ލpd>@P !PD@P @@?<0P C ,+@P t{#Rp@-@@`4P,NfF5/@P@Ep6^A-PBU@(MpB`0 R:R00#R00S2  yP PqU 0U(ЍX `FVp 0V0 0V 000000@0 `$@.P 00H0U0 0U00U 0 000 P$p0xhkA-`0BSpP@` myP 0 DR U00^p0A/,6RA-@PD`B pJyP 0 A//XA-`0BSpP@` /yP 0 DR U00^p0A/,6A-`0BSpP@`  yP 0 DR U00^p0A/T,6A-PL@Pp ,pT! `P m`TAmVmm8`PW* A%#T00`CA᐀pDVAVt t 1`W:X @pTL0DV0  4`ꯄф֭VEрӄ܄X#ބ@-@Z@ wW@M-ptAt1@Dp1RMDA`aPI100 M p0Tc"!DX`1$0 0 , (0 gP, (0 0$0VZ `T P K!0HsPZ 0  \`  1xP cxU 0DH7m۶H7儉-M zmmЍDRZM-`(rMP@P0  P 00` 0)P  #0P0< $QPy Pp`s 0 S !0S 0 S0 0` 0Lt0Z000彠000000 00$00(00,0000040 0800<00@00D00H00L00pP00€T00X00\00`00d00h00l00p00t00x00Sd00 0. 9  " d " " " 8  ,, ,8    " " `  " "< "   "<!\  ! @"\   "x " `@  "!x  !P t "  "D " t$ "D   "L " H$ "L   "p " PH  " !p  !X l "( "0 " l, "0   "T " 4, "T   "h " X4  "(00#h  0# 0n0 t0`S  |b|0000$00,00800@00H00400P00`00X00l00t00d00  `; 0E0 VPCPe  .0S p Sp p #s5   hU              00pGsW 0  " V 글T$0! 0!84 !*  ! !*  ! !缀. ..*  ! !*  ! !*  ! !. ..*  ! !*  ! !*  ! !Ā. ..*  ! !*  ! ! *  0 !,Ÿ !! !0!0 RI/T@  0 00S P SP P P1[000$00 A 0 (0QPTTpT`T(0 Pp`P%0P%P@(Dp'pDZ`&`DQ 0@0@S  0p@0 0 0C 0|00[grߍT00 Q걅"   RA-`p`5@PP @P0S z^"j0PUT p^ŅM-0ppGjԀj`̠0V:ЍRPP0 000XU@ iD`0VU \\HTEP,@,@D,0 SU,ԅ0DV݉0Dȅ~р*3=M-M`@*PPV 00-S0PЍ 0p Pp@dp` p000p000`P 0 pW pP 0 ]^d`!02#V:01,0p,0C,QW 5mP @ ⊠W Z  nP  0S   1@@W [T!^  RP 0S   1@0쀍Ts0000@1|00S  p0AP0t0 00 pP &plp p0 pVp @|P  P|pPP@0S0  Te$0SF 0<00S% 3/P T`E4;v@- 0 @{Ѝ@- 0 @{Ѝ@- 0 @{ЍT@-0W 0 0W00W0 0040 0sxh(obox~M-RPM nPPP43X  `\pP @ @PA!1 p`4$ ` <0{0D <0PPPP P!P"P#P$P0 P< @PK<0\ @a`04b8c<Rf*0e (g4 0,!$80Q4R<R", 4 P$! S$" S(#<# 0$0"r 0* R0030#Q0S90000 0!0"0#0$0  p` p( @[T哼Ѝw @P!1 p@$ 4 @@dr\<0@ \a`04bc 8<Q:`<|`@P@tnR@- RP P Pj0P<6G:M-e0pH@0THx0t  ll0@D P\`\HD eP<PU@S|nP9nр[)؉nnn}A-`@pTP̃@P U 噮P὆P -Rp勮Pp \兮P L׻`0@DP0 ᶆꦉ܉ʸRA-Pp3`Pb@PVpPPppPU! R@P@`╃PT 0W0 ឵ ePំ`VЍ@.ꉉʸ@Rs@-H`Z@PluЍp ᕯ P启/4`@0$`k \ꀞ€%E-M 0@T< `P0@DT7 $0嘦0p喃(ය0@  0 5S 00 3# ᐬZ!3,0d"#-`#3 !$W0@GЍ ףp= ףWM-@`0ԀpT:Ѝ0GS0#tP\eU7 P!P0 $q {P 0rP HHߺ`@[0  OPxn}S@- 00S Ѝ@-P Ѝ ЍE-R4M-`@ PzP8▂@P`PG @I kP`@D  cP.  ]P  WP`@D @+`@D`30@T(8P0 00@ FR.AP@P p+`@D0 Y,P,PE,0S4ЍT8 ⼋P @ypAV@P@q1P0SD2  V$ V@ V"0 0#V0 Y@cP 0 0 0!, @ 01$ (0!10 Q 0@0\!.@P(03/( ,@1$(01 0  R0@0 @Pz ,03/P' P$0 @j@0 00@T. 06`dRр[hƊxn㊉ŮX5xmPs@-@PBU`-P sQpQpAoPR@`  ⹳pPE`d000\<P@Z 0PPP $00SdЍpxttm A-R2ՀMpP@4Up `PP <C8b4P(;Ѝ PPI`P Ph  ,` R@] @ P `~P@P k0/@xs P h@`k P P@Hc P 8۵@0[`P P ! 3 P!3 Ը8P pʸUZC 7/gb娵x夵pZba3k5 iaol lvll"+2>q֭͋_Rz/Rs/Rl/ Z U Q , ' #p@-RMe@Ѝp@00 x06PP x`#P 0 M@@0S ~tA0l=| 81@P D3# Q   $@)ꩌԌpm"0H0BS /0BS /RW/RP/RW/RP/Rp@- @-PX0 P`@03/@P (ڷpTp/hi`p@-P0BS@` @P@00V }p嵷hiQ^RM-P: P PP1P @ / ȱPp p`ᛱd@100S/S/00`(  PP QPPPU@M-R@PPMR or@D@DTPЍp 0z `u`P P$T T g@$<Tp 0U@. NPf% ɩ P T T >@ 9 0pt @U  )PA0P0@ 0壩 P!T@ P!P߶U ۶z׶ | PT Tm@|ƶT <dS@ TcPTV ?V00 0A0F?o20,0000 ̪ 0垶W4=`Y0P-  0f0p0T P 00S }T | QP  h KP  T EP  @ ?P 0 `f@0FS-vP,L0SU00 P,0001, _ 0彵0S㷵0P0T0 0U0SoPU0 D! 500Xa   00(  20 P0 S0S0X0SM0 00  ᮨDoPQ " 0x3ꆍd֍ڍi 1%*X*-05:$Xi\imTM-p` 0 hMPڋ@Pd 0R@DOoB@< W  R  S000D岵0000 <0 U00`$`@P: 0!pS0 P T` T0P`S0 兵hЍ 03/@P 0 ᅋ0 S xR0 L0 0D 0Pft  ꃏlрQ^֭ۏM-R M` PV@ P pWw@&PPV@ @ P0`0V`P0S 3▇PQx XI@ ЍU  ◇P0T000$0[ pW V  ᩮP  000P V 0S ɻ0 000 00P U δ@0sS cS iS`~@P 廴tt  tS` n``P PD,00 (垴XV"P0ᔊ@ 匴 t!冴V ᅊ p}x 6V V@t p@OoBLT XexF VAAx> PʼnƏ叉$EW@-DMPj @P j ⥅P <DЍU U@ڦPp]9P ] 0<00S t3/P=@P T]T3Pt@.` VP 0@0ESP0PE0 ]@` U;P Pd 02#00PP U,PPU  0S(0P0S$0}P0;S 0h0<00S% U 00 "?RcdPd 05#PU3/P~ p嘳{Xm40PTT, (0$0关겐[^ːِ40QX?DA-p `PU@P 0DSJ@@@-@04 F|P 0S03?0Ѝxp@-P@)|Pp p@n{ꂑ@-@0, '|P0 p00Ѝz;@-@0, |P0 p00Ѝa<:@-@0, |P0 p00Ѝt<@-@0$ {P yЍ芑;7@-@0P{P  B10S *R ^ ( Ѝ0 <ϿꖑA-`P 0p{0P@4O {@P  0{P   Ѝ0@3?4O@@@00 {P03?0곑"͑@-@ ]P@oЍ@-@ uP@oЍA-@pg{PP"T 0h{@PP #]`P FQ`P P  0@0 zPPЍבw@- @{P Ѝ@ Ѝ@-`Lp@P P000p@? 0  Ѝxt瑉M-@P`wXp5 XbX @ɤP    0 @  ߂P: 0 |i3T# PT1 @P p# P ` 0S P߱u@ 4娫P@ ⧂P ˱Ʊ uЍ 厫@P ⍂p P  `0S X@ OzTh報H kPz@4咱 epp剱P Pfu 0S @} IPMX @FP 0S z cxP% <  8 40 @,K Py 0 |0TP  =ݣP   0 @$ PR 0 |x 0TP X ddli8"Ikx6NT@-@0@ @C꜓lmM-RPM~P  @ᳪpPm`PE@U 0-S 㶷V 2 P Z77cS qSX`0S@PEZ>0 00S 0p P Z  . 堰PЍ_PZd>d 0  U l  2/P*V  |`&P``V b s ?`P.UI렍kP  @Up03? 70 2/Q*\ L {P a, BCplX Y PU P yPa  zPa  pPU x0P 0Upm 0x  R< źQ 0 0PE<S4@< @>[P U  [pA @  0?[ 0    0  LR0   ^ P  @L {[S0,K5@ @K 0 ]R   R0 Q Rp1 0 :0D 0]Q0 0 :{PR%a J n0@   U0兩0p U@p pgW0U0pU0sS  p呮P꼆  ]0@ST00  _W Ph& `6Q XXAp@T DS@DW(0AdT" TP ] 1^P 5_U PWPACWA< 7`xA2Wh| XPwPU xP_xP_hWSU00gSUPpd䪠P P UI 1+1P0 5O2/0l10\ 10L1ܭ<٭041ԭT01ͭU 0 1ƭT0$1濭L^庭% ᆧPUF呴00k xpPU8 Ҵ P ̴0 P/ $\PO00pS^@倭~[< 0 ]pP_0 00$ 0 0haS ᓴ pP ፴`@^P 0@wP ^(dS  $wP^ P 0P ^ PpEpU@p @@Dm P ۦPU P 6nщlmē哉"">qᔉ䔉 (lioNWрĉ•ܕ͇Q)~F̓㓉P '$/<Pjؖ+BYptgt牉ȗ旉_M-PpM Q]0 P F] 墬Ѝ 00000\P@p pa> *]`卦 T`PJx!0fuP) dwX!0\uP/0tp`PWTL"01t P (hBd"0't P H83/Z)&00 0!ftpP!0t P hZP X00 0!HtpP p ZPp 0Sp tS 00 ZPP0SS r[ ΪP` ƪYěz'VSrPoϙ㙉$';Q^dבwvbyÚz֚욉Ɋ|(>Q[~R@0A-Pp`@pz@U`A-@0 MR0 0500R0: 0P  00# 0PI@4b,` #pP P# E 1R@oP; W 1P4 0S0@0@S3* 0S ЍAPV)X 0S PL ЍP X rPS0!PPX0S PP 0 r`P SP W ,Pt 0 P Pۛq'V )97G~JawʜٜR@- RP P P/ *0P6G' 0 0 0 /L|t|x| 00S/ 0/L|x|,0 (0 $0 0 0 0 /X|H|L|D|x|@|,0 (0 $0 0 0 0 /H|X|D|L|@|x|(00S@-S0/|漉p@-P @Q(M0 Up@F D M-`@PXX5pH1Wp8,p ' W#@P֭~@-P`@M@D0SЍTpW.8  @p%@- @*R үT T ƯT0t@AR@-$@幯 ӨwEs@-P`@  R 0-Q  R  ЍpQ0A-`PD@P*V` `>RP㨏V00Sp0P  0 P,僨@PU vFoЍ\r@-@ HlqD0 HXkTi  RЍ ,000 Y px~R@- P0HhG@&@H>7 y@P (5TЍ0 귽ʽݽ|R7@-7pPP@  Ѝ0,@,@D,0S @7y P @-`P@P VpLT Ѝή@$ᭀ@P -IXVM-(M n`P/ P0<0[jpL p0}p@ @ T  lp0}p@@ T `[T TT塧@;僸@P1⦀⤀  `⟀}x}@P `Vx@}⊀ↀd}P`}P x@DQP@T(Ѝ;/@CSj[wRA-@PD`B p[P 0 A//A-`0BSpP@` [P 0 DR U00^p0A/$,6A-p`P@d [P 0 DS U40Q 0A/,6RA-@PD`B p[P 0 A//R-0D0CQ0 BZ q/WR0 BZ/༉0*S◭$S/0{S  /S 0}S00M-Pp`ᣠ\Ah fPFᖠXBVP @,0U:0 oЍPPP o@k0U0 DoTTTTT@ TE# ̊̊R@-@#[P0Pp0 0OP  /᥾A-p0BS"[PPp0 @X` 0P*U` U``0wR1p@-`ZPP,ʬ@ƬP U0U00U0 R  BU0 R  B0S  /p0M-p2M 0FoRPU Uh3@0S pC T T T @ 00 $3R UP @PF@ hp D`hpv` `Dv`0 0h 0RDp `pv`P[C[U\20S0d00[Q.WCPFPF@ hp DpPF  hp@  `vPFPF PFP@p p`0 K[PPE㛤0 P0j 0U` @P  2ލ $ PEPWp!X1 TR 0KS W0 S` SS @Tw  "hp`F  p00@D T?@@ ,q&`þ,Qp@-@P5P01@oU@ @l巤d@PGP T%@Tu0姤p 墤0PpXcM-AMMP@  P($@D8D4DDD D$D٣,P Ø/($0RCkB$R+$ $f p`@ T, 4W@^J7@tpGW d($̣($RCHB$ $0$R ,坣0$P`V p`(g@P$R/$ R  P P 0PQ AAP qxQ 0@q@A`@ TVa@QX R P4Ċ *$ $ $@` @p00)$R$RXR^00+$R= 0$R: ,B0$P5 @$W'T t $ BRAAAAAAAAg )$@:tw@T徣P 0 0` 0gPXP+Q+ \B P*$  4$R 4$R.)$R[[ $0 B$$ 0 H0 p$$ R\ P R\R\Q r\BĊ8R B08$5Aq\+UA00S0c{ { JA$R )$L($RC@A$ $f9A)[+!  @K(QC&A?SPWFP噢@0\ 0`U5HFPh劢?? X PZAލЍSPxѿ_ ֭ÿ࿉<р忉꿉&`M-0`PZPE ʩ@ 0VL©V@ p弩pP X ѢP GZD 0LpP AR P`kPP! p弢 p@T6TP岢@X <嬢P "5D 0L̰P RPЍDPP  啢p@d5P剢5%@5 5%P 0# 㠥0555 55% RP PP|R` xR 0@s0S0'nR 0p v0 `FpPv0S `C1aR`P0d0#000 00N00J0 01ER AR vP{PU30?0 0P_0 `F Kv`{憳P$V,R U30?0 0P#R P 0SSS0#0#0# 3 #0S0C00CS`I~ S` D ! S` ?  Hß Br S` 5  `@P  ?P@ S @ ` & S ` B -   "S# `  N S `  1S ` S `  "0 0 00~0`0000 00Y0000孾0 0`0咾P Q0E pDRsP`F!0Q !`@Q 0 ?Q@02/ 1 Z10S00T X103/P SRM 0\1Q 1 E00#0`0Y00`f0 0`M 0BS1P00PEd`vDP XQ㷠`VU d0 , /t '0@@qgvDJ|t|H P|T|t ||||X||||\|||x|W꿉&`RM-M`03P0t0 ( 30p0 3@t00 p00 @S@~Zx0 010 00 00 t0h0 p0|0 >pU@P娧\2W00p0 埧t l0T0d K1 T0 s0dK0 唝l0`0l0 p90d Ks0008QP  0 3h0SJ 0 00M0x @SP@T@ 0RP3!:| (x]x0p`h0S!10l0 W0PEe 0V0. d K S 0C 0H Cd K?xI J>  | 0|0 h00Ch0 wPP p0  80 ,0t  (0@K/Z PxwwWM-R@ M<@ UPPD0ES !0 `p @  FP@ U0 U00S D` ` 0h P`@ P Ѝw0S@ O p@w@-@< P,ǟ Ps‰sM-@0XMR00,080sssssssmʼnsƉƉvʼnʼnEʼnʼnWʼnaʼnʼnnʼnʼnʼnʼnĉʼnĉAƉ~pƉƉƉƉƉƉeƉdGljqljxĉThljĉĉljĉĉʼnljljljRM-hMPEH`bHp@,@D,0S;\60D0L6 0p@0<604046000,60<0$608060 06@6pP0xS>P 80D0@00S ( RwW $0SrW0@ DhЍi,@0rW0PH wW'UL 0HPp0 0UC .oPV J H7h000 0K4HeP8 <^PPEUH 0ESU;*>@P @ DLPlWt@W P1>D0rW 0@0(040$0000<00800 wW 4 p3 3( 3$ 3 3 3 3 .00040>P 80@@0D0Ty@ DPtxҙP4`V 0 Pș 0S <™P U@TY帙X 0 0 00;/ 0R*, V R0[   0;/P`0SP# 20 0S  07 ᙠ  0  ( 0(0Zm80 $P0S U00`,0 ` (0XX80W$P0SJ U00`,0(Z0 ,;/0 S1,0V0S (94,0S   3/PU){ %`0SP2 0   0S›*  $0  /T"ssssssssslj ȉȉ$ȉ~.ȉCȉWȉ^ȉbȉp@-@`=T)Pş?.0P d 0xRQ@%P :p0Aq ^1#!0HPd4pp@-pMPp@`UP*?`?`rP0 48 0 Pb 5b 00 4;0A0 Rߍ Q 00C`E-@0MXrWPo0TS!q4gX ,r00R40TR8",]Z1 S"StPŸPP4 P(GQ B@0"S9A "]0S" ,A`"N p20l"SjfP`P`g`O`A";4A 2V$" 3h0?c AV A !&A!!A 1Ua`p A  `U0g `Z 0 ۗ81ZP! h0S61 8rAVq@PP(ė0S S S  0S@%QߍqT寗X _00r00R40TR8",ᣗD 5 5ȉȉȉȉȉȉ$!mȉȉTgɉɉ~~ȉzȉɉɉрȉ2ɉGɉ?Zɉmɉȉ}ɉˉ̉ɉȉɉỏɉɉɉɉɉȉR@-@0oRH0M-p`@ KPP 0@DSV t0Rl0S J_ R00D@ 0 M/,6ʉ@-P@P J~_P(@P ʉR*A-@pP 뀀@`P 0 \"0 |VP80T0 0 T/-ʉd[ʉR7A-@ᴝp尝` 嬝묀@PPP 0 徖0<00S 3/P`峖0 |P40T, , T/oʉʉdʉ@-@0BS|M!p`PP Vf`b@0 z0<00S 3/Po|Ѝ  [P`@ |V]P,0T$ $ TTʉʉdˉ@-L@P JHg0P 0S _ ?ˉA-P`1 BRS  H1@`PU' 1pP! W0@i0S/ @@P`p~PҜ@ΜP` ȜC (ڕpdWˉuˉ0ˉˉ @-{M-HMp , 4I0P0 0SY?@HЍ0SP@0X a ANP0 C0@ @ZPX0[2? 0S -?#ᮕ&? #᧕$0 3u` 0@S kH01$0S l3P# ቕH0A$0T ,3,# 0TX` t@PU>1 0P 0a 0Z` {ևP0Zz`$0`0P$0ɇP 8ÇPj$00$0y ,0P 0ZPV1Hz RQ00 0@`C00  0VE0 ӛH0∱ 0 A ᎇP H 01$ S $ C V0 B<}P0V!H0@!$0R0$0B0lP fP H0A$0T1$0D[WPP QPP JPPh=>`嗔5Xˉˉˉˉ~̉^-G̉n̉ȉ̉̉ˉˉˉ~^*̉̉bRp@-Y\`Py@PDnpuP44P0g0 0uPp/͉͉̉p@-P0`@P 0ShL@pV  &P  P  7P@ 4͉9͉p@-P{@P  t #pO͉M-`@V(pR@' R R@"V oz@PpGU V 8 P: ȍP W08 !@01Ѝ8 !@<KzP}0@-EMܓAzP@TUѓEߍ00ST8ȓ0S “00当0t0帓0S L < D0P<<4姓0,!0CS=0 坓 嚓嗓Q 咓 叓LQ 劓H凓4儓.8 yY<Py@|xtplhd}͉Ή͉͉͉͉q͉͉͉#Ή?ΉXΉpΉΉΉΉ%͉͉Ή͉͉ ΉΉR&p@-@P#  t!0S|:xzpP8`2` U0* 0zP  0(#0P`/pΉ'ωGωM-ppM PPWPU@P  t0 0C0<0ό0P`(0  njoobp4`Mh@I\$E<0DS8=P(0HSGP,0 ZP 㳙G, PZ08 婙00800 0 P 庒PypЍ(0Sp pZ匙pP 0P 0[ E0pp 0喒0 P$0S(0$S ,,0S倒<0SE@5$Q%`& P00004080\ l 0 0\P^@0S00P0<00`S 00T0$0S0$0\0,0h0$0S,0$0 0l0 0yPPD0S L<@pP004080\0 0)00`40S/ 0 `0X00myPlQ`Q l0S ^P 01/PL0S> 40S;tPvh0 0X00T0001/H0Sh0T   0`0X00   04yPZpQ@dQ l0SC ^PPQSl0\  S*0X0$0S0`0X0< ` R< @ @ h 0h0` l00l0<0@ 01  0P  0MyP~ 00`Q  01/P Ph0 0X00T0001/PP 0|L0D SR 4 1Ra`L0@T0 %g(009 0`(`F`* 00 080X00S 0 , 00呦 p 0E,0 $0S  ᑦ07,0 `(0S,/(0S Uk 4\t08 `Pa귄dωωωωωωЉрbωpωiωZωRωAЉxЉ~ωωЉωω@BЉ!щЉЉEщM-@`M@  `T@0PP  uD@Tp% Tp ẗ `@ 0#P  0P @w`Ѝ@ `0X00$0@S` c C4316200 00墐(pp,0 P0040Pp@@0(0_Z"-x"P { 0( @T`0, (0, ( ,R : R 0R0:0  0#Tp X0 3/Pp0( @T`0, @dщqщщщщ҉@- 0 @LЍ$R/@-@B<0P ㈡P  o7҉Z҉@-M⭛ P)XP `\p@,@D,0 SЍH⇸T(00H 00,@,@Dl҉рs҉RE-@ ) PYa@P @ Ѝp0<0$ R (Q ,0Sя2/~pԈPP ψ`P'.0<0(03/0<0,03/pFZ.. 奏p҉҉҉M-`@ P8Mp BR(-Q/ nU`  qXpG@A  0P @p P0P1Pt8ЍsQ bQ cQ tQV> V:`Q @V1 W8ЍM#D -@P .Z000@?Pp ¯@PZ U/ EXy tm҉Ӊ&`Ӊ 0@-PPM   0 P `Ѝ0@ @Ѝ00 PP ⏯@PP8b- @>ӉEӉRA-@P0 -R0aS@DP p`V@ TP /8Ԏ@PɎp`jӉӉR@-   0⬻ oЍR H/R.0@-AM@M 0 0AލЍ0 0PP0 l  `(P0L Q  0 P 0/ွӉӉ@- 0S@P hm 0SXh@T %!0 3/@P WTӉӉӉӉPo@- L\@0-S .\^  0S fS kS aS @C 00S ӉA-pR`-Q Pd @000`FV fSp 0S 0 BTPPPM-P` (MPPEU<@-QF R UpJ @ကPD 㴔[@TU ` ` BD X  0 "   0#KPV1嶍NdQ bQ cQ FrQ tQRH RC Q`R: [% 0R0S [ 倍@ {P $@D0 0噤$0P P 7(Ѝ 00 0$#ԉtmԉJԉEՉ}ԉԉԉՉPRA-P`pMF PA0-S P5PV@PU0 \P+T`- -Pp QPX \0S R0 pPUM<ߍ@LV/zՉ֭рՉՉA-` MPp,0FS {\P ݍ 0@0S LQPW W00P kQ@P 04 9V 崌ՉklQ^A-RMpD`PO@P0FS@ 0 w\P`Vb Ѝ双4PFЍA3* PFЍA P  xP  d@PXX1X!P`B6Hq QU,5(5U:, OP~@P-`FV*`  p[P 8@ 00CP`U0 ۅP 0s0S0hPkU@ꉲQ^`džᆉO݉Չ`WW`W~Չ`WW`WՉA-@-P $PUЍA` 0 00 @@$0SЍ0   0 ڋ0hՋ`p 0 L̋Xp8Ƌ`@Չ!։g։7։B։2։L։m։։%i9~7@-@PMP0  Ѝ0@6d Ѝ0RA- Ѝ@~z`PP qpm@?ou20S dP0 aP  q~ω։M-`0BSЍM9@Bp>@ :P ըP 0 ?ox20S@  Gd@T  Z X 2@Ѝ[ }P0 00 06b P 0 000`,b P ㉊0ES 0pGPω։R@-P"p`ܑ@PP W@ ё0T0p<0 p0`S 3/ P 44݊P Ѝ`T @Ҋ~ω։.R@-@!p`᧑ @P  WP 圑c P 88岊@U P R娊 Ѝ~ω։.M-R M@ Ѝp1@ 1001P1` ?ov20S   c R  ``z@VRPP`X  G[ p1p#0  `@P T0W30P0W @([t0 l0Ph0`T0d0600 A^R083,(|||~ω։։#ĉy A-`0BS@Ѝ@P刧PpJ?ow20S@ b@T  ӐX̐P0ES 0`` P ۉ@ Oω։RE-@ Ѝ`᪐@妐PAPp?ow20S@ b@T  媉@ 凐 E` 埉p`0FSZ  PP咉0 ` PPp倉~ω։։R]RBA-MPpT@PP`?ov20S@ ab@T  SЍ /P`1`#WO (@ 0_ P 9ᯈ/ω։~ωE-@hh24M``pP P <282 ERn  Vi +|pPPv1P c; F1P Z; =0S 70S 11P E; (1P <; hd1P 3; LH0S <U 4ЍEuV P ᡏ‚0S0 0+0VP P4Ѝ冏L0+00P0+ 0Psogvaolol|o"P P/@-P @ 0 @SЍp0T `]  0  b0Mр։7@-@0  Ґ0 ͐xPuE \5T00S S S4 0'( Ѝ0x։p׉tHp@-R`PH M Q  . @T  ЍpV  0V0H%S4! 0 ~0 y0  t0  o 0  0؇  Ӈ-׉M׉׉׉׉؉M-RPM`@b0Fs0S P'#8AVS rV 1D10lSP@DT 00rV00S sV @1D0*S 8y800S6@Dr0F?oT20S.rV} T*sV'qyi<Ppp@T XTP QP`D` H`L`mP "@pTP@PЍ0.\ B8$0 q P0 080B(P0!$0 ` 0S8yV`8P0a H`D0ehL0WdV D XpWDYP  WD XPD, m0P0: h@@xq@ D WX P" ,P@WD XP D@D0S 000WS @WD XP rVD00nS aSul#b0C Sq00 wSkTi0 ,PЍM,,qW` W``U@pP X0,5H*娆U1#@[垆6 PE@U@P Q0#02S@50D D L儆@@T0  ,PЍMhT 0,P+ + 0S+0 ~ c%@S@@\Zp0 w 8 o0  80D  R`p 44 0Y kD Q4 b 0@Dp"SPD 0  x0R@0@T00 x0||  t  0 0 PTPU W I؉<؉F~Y؉w؉؉݉+؉/؉'؉р؉RA-@:pP彌X0`巌P 峌 P,p/΀/w؉// P0l S0 X/T SP/H/D/@/</8/4//(/i}р/////// /0 0R00/0 P/0/0/0P D /   _P R=@o//W @0S/|$00S@-J/pҋPp@-@P P P {p@53T T +U U Up@ 0@DT@ U| PUt Ul d`\XT }&/!5cD8I[jnw@-0@S( 3/P܄ԄR@- R@\P :VP @Ą,00S$弄巄ҋ!DR@- ڋT @VP <处(00S 圄嘄pҋMoDE-0@<0tM0S 3/&pPp`2倄%PtЍ0<00S 3/  X0<0HPU Z0 5/PP 0 t\% dWvP `VUPP%PZ0  BPRs@- 0P3Ѝp@vP@\SV`T`PUT XTH@{P00S@Vҋ4@-@0M 000 t0t@@\VPЍ 00 000@0@0݃VX_CBA-P`H@B pl8P 0S 0 A/RA-@PD`B pQ8P 0 A//A-`0BSpP@` 68P 0 DR U00^p0A/,60@-h0M00 ST0   0@ 0 P;PᎩP00Ѝ0afR@-@pP  }P  p@ P (GЍB@ Tal4;0@-RP4M@P@4Ѝ0R@@ ^}Pt l0d 0? P Hd@$s!T+rTaaТ4;рo@-gP @׉gvM-R00@ `@p@T 3P ,@Ѝ0x0PU { h͂@pW0 0luP0 异2PP}>ӉӉA-R@RMPRu@P; iT0STx坂Rߍ H喂 @TR* RlPh@ iTPP TS @TP1@P#`  @P 81t4,JP@@Pq0U* S0S0# D , S   BD 1R tҀX.. S10 R?0!CH D0@,\2P@U`kWр@-`JP  yK@P!    Ѝp@,P,PE,0S T000S ,0@,PCoLPLP 0S PU _LP  `KP @&s@-IPP`@ P 0 Ł,@,@D,0SЍp[hM-R@P8M` {PpPp8Ѝ Xv{PL3P RpPp @T@"-P  0 r P <ⰰRb僁~yto?ⰰjep``[PV@Q b44L $R$F A <,PP> 0  `P4,0V3%댡Ta!   t d  TH 8 (`^H  0V(  0 00④!ڀ`P 08ЍM͉VҋOS[1Cs~ȉzȉ-Y7Rfz}~Q@-@<0T Q35P!3?A-`0PS0Q@ SpA"0XW 00C0t*00C00 S*0000P^*00C02K0A-p h@PQz@a=PPE hA hPPP9: @45 0h@P*ZbFNURp@-@P` TyPHPp (yP p@m 0͉ҋM-RM,RpP`EӆU@ 0 OPPD00$0 0400 |= P  ЍP P' f)P " 2/@ AL  @0p|  PP  P PL>) 2/ (0@>4}}R0 B3/ȼ@-PpMA-`pyP@P$a  @4;7@-P @*R0T0 T t0 00P 0 Ѝ0000q 01S/A-@Q!i 0 #4`"yP(pHyPyP 0  1S !|10! S0#`!~ !C0 BO#44~Ѝ!*~e~0M-"M!01RpB~"ݍ`@pT. 03/PP- @ 0 3/Px뀀PP U~ Mq p0Sʀ0S x"=08@,ܳ0Jp0W`W`W7RE-`0RDM00pSx20@9RL`@[ L2H:Q@O0.SG0@S?W 91W 0A @QS q Q q 00Bs0 S 70Bs0SW Br0SP0~DЍ/2s00001@0 !` 0`喃 xP 0 00 0000 倜PP@P 000| ɏ@P`| t}ḏTX}` 00BV<}ҋ@Bҋҋҋҋҋetҋs~0p@- `M@q P P 0 00 ᥿P(0  ЍpM-R@M ڬ`@ zPP`FP@V@ЍMw2VlMpP@ЍVpH`P<}`(в  yP0  yP0 yP  00000 0wPi}0000 `0$⇝P@ $⾣P`R}4 $⡮@4TTaa]x4;7A-RP   0 0A0)2 `h0P3$C<Pp}_:Vdh<$} }ЍMbRYgRM-p`MPB@$3Z0 P0oP0" 0 Zoߍ C R  vo᫲VoW0`vPnojofo렿aoP p pKo᫲ p p[ p p[ p p[Ө p p[ p p[  姽P .xPV|| Xv0 oS S S0`&k PEU AXp>WkX[f / "){RA-`P@P VVp  Bp@D@ 0v&p(|ЍP  |pҋp@-Px0@0<00S`{Pp3/PP T$@0S +00&u  {pҋ 7@-P@ PUot00<0 0S 3/&p P{ Ѝ0 0 PtP {&ppҋ0X@- 0 @8Ѝs@-@RP@ R {@w`s0 <)@P@P  {պЍp}&`Q/@-M?@?@< 5$Po{ݍM-@g{1@!  10010X{1S lS{\N{Pp1S@ЍME{0B{ !$>{ <{#!"!6{$1S 1{$,{`ذ%1SpP*0  {+1J0S S S{0 {+10S.d{({ `р^~"N\d{s@-P BP`@ ЍpD0,@,@D,0ST(0S 0S (0S E-PM@tp,z,i  XZ 000DS  0SW0   RZ S< 40`Boo`bzW00S 0 Cz X | 0 0p0!00CSH!H!!1@0`ptzxtP(HrtP ntP 0 `z]z, | 0SЍD0 i 0 00S^xBzD  (P 00 0B0RS o00 FRpû֭@-@ M   W Ѝ@-@, 10SЍD    A QR (P @-@ yCPЍD0 ~C0S D  (4/@-|P0@0y(y0 S000c0lҋ @-`p$MPaşm70Sd \\@P Py$Ѝ0 0 0`@勻P! ?}? @-`p$MPa4P0Sdy$Ѝ PPú@PH0 0 0`@\PX p ?} p@-R M@P x`1sP h30S\Xyy@ Ѝp < sP0Kyr sPU #=yd20S  sP"3 rPU @y0@PR x rP]U@PP@y@  9@P0SSESF0Cf0Cs R! S0 x`T, xdT0h  0Dt@#0  Lpd% `xjXx`Lx`@x`4x`(x |r@P!P0SUIx`xz<0S0P`%B 0 Ѝp@O@,džhҋ [^ ƀ l @ȁpȁ( > [[ v  7 t   "p@-`(M%  PE0FS@ 㔹P @(Ѝp<0z(0 3/@PV  僭0d!0 `1RPCTotLap0W ' 0 K3/PKgP媳P女P堳PK〈PH|PZ 0XpfP$TQ Sg (ˉ#Uq  . U Ӊ`WW`W #-Q^2fP`P[0U%?P?P@P pMGP?P K0 ]P KK8pWVРKsK)s%#!A-pYPPsz@a@P 0Ss`Ps@0|SQPP0 |U (s@s<TgWkN@-`pMPaX@P a P 0xStpsЍ``@P T{s{0 0 0`@XP<TgW?Wp@-@gmeDPP LQ@@W0 |帼T KspGsppN@-A0㞄M-R M+44坃 ,&P+ @ᒃU  U   CPpe`P pWPs ЍP eP `V@` pP 0( 8r0S( 3/0P0 r@Q  08 0rrRq AqR0 xSmCP<0 X  Tr @H0Z R (r Jr@Q 0庠0S 0 @ R  (0 SR S:|r0S p ☖P @`h 0S PgrL ⅖P@`X0dP0  Nrvt 0'  Dr+T4L@X@@T Q  S 0St 3/Po>aHIsx +b -P?qp@-@Pp0$S`0P  0P?S D0D 4n,pPU dPp}}} s@-`}l@P@ЍpplPP `~lydPilP 0S (lPP&@_͟ @(@/@- @ 0@@p@-0P0S@ `d00e!P0S  P0 00pp@-    M-0`S@P0S 0S 0S0 lrX0S RbP Pp0pq0PW cPH0 ;  PU UPP c 0 0 @oPP PPP孻0 000 ĻP0 q 0S 0 S2( p\R00wP 0G pG0 0 00S R 00W 0STႻ\R0  @-LPpM-@pP j`PX j@Oc P jPЍW F  @P`wj V D :ojpPD PQvPM0S ~j{jP 0 PVm ? W:  [ 0`S 5 bjPP 0@S- pp b Oj0p0000-S =S0 +S00 3jP Z ,jP bPsT@uW:  1M-0@8MS8 `Pp0$0 0000 0T7 00CS0 \70S0,0 S 00 0000 VPPU# PPUP0 `S@@ R Q R 0R RS 6 p8Ѝ Q0J0 0J?o 2R0S00 0_oRZ00SZPPUZ0S [00[ 000 0i( 0K00P00$0 0 00P0UR $ 0 0 P ` 0S0 0S  S` Di0P C`i 0 $ 40$ (0H0$00,0$00 ap.0 40R 00k00, $ ` P 0  0S S PU p_ Z Z 0S Z 0S000000 R`pg`1( 0pP0( `V`S`Vl(#0(0 1,01!00 s`P0 _Q pP(` 00SS00(00C,0p0,00S0Vh0   L# `2pw0L"pCppMi=`hP00 `w  R  P P1p0Sp Z?o2 Z 00 0W 0YSqPP`P !R   B p(qh00p,0VP` M0S GD00p0S <Qh0 ,00R  `u;, "hP,  d7n4(00P A,#S0 0}_쁋7}֭+DM-`@M@ 0 P0p<`,p$p(,$0p8p4p咸oP&  ,  0S 00 03/p/40S $V$ℸ(pPᐸupF0 8%pQp(mP{  5R00SPUP@Ѝ 4R p [  2/W GQQ  W$P [$80S0S00S "0KS0 \[ |[ ;[$$ 00#03/ Pp 0y 3/z  Ϸ 03/ 03/\sp   $ 00003/p0000_P0SJ 03/ |?P {P $ $   m$j gd 03/(]$ 000 03/ 03/}Pp}PbJ0 0 03/'PpqR0SP 80 00?o20$X&Z@ 03/e$N|Z6 03/[0 0 03/Pp 0S&  1 40S 8 +u 0 $ 000W  X '[#![[ 0 40S0Sdl000(0 00C X||| WA-PP@M% @T" p JfP㬀@ 0S bf`^|C0@0 0`-@ tD0@Ѝ0@0 0P@ܚ~}/ 080C/@-P405&p$"lP lpҋ@-@ v=P 5 P@ P0lЍP  k>URA-P`!R@r@p^PA|^P p00sAP <@0sPA 0剹 ŊM-R@MtP`BZ^@PVo p (_0PS@a(0S:S:Sp P 0S (_(0p0SVĈM 0 ( 0_ 00S (00SV? ( Ur0`S (00Ss0 N50P 0 08 ⤉0P 08,50Z0 , S0P 0,0S$000S  0Ak@@ЍpPሇ``0 SXGpWT) L]P <]P ,]P5Vs`,q0 Sk ,00Sg 0∁LsPcV0: X0U#8 P80 6sP 0tj8P<R 0\ 0 LjZX<}0!R00$ dP `Q  0 1/P P 0 jp[]PpjU0ӈ53?2c@010P0\ 000i 0S00Z0S  ZR j@cA0Co@D T @!idP 0H  d`iji !$ T0$ FRP 0  fP !RP 1T0   b0!RP㔣`i @ E-jPß L0|,j@@T@ cP  cPU  kP j c0 S 0 \R@2 iT iVR2@it\PPV8ڈ!8 rP 8`<V0* 00 +S00 0p0P[ Q0 S 1SC0cPUp 0Rif`Q 0 0P1/P 0  R@ hiTPioL4\PV 0qP( 8q@P{ P  \P \@PXQ0 U8 \Q 0T 05/@PA0@1/^rZbҋdQ #KVbQzNMb%BωqPo~ꑊM-0PU`8p   000 U @C Ѝ  jeP KT 0G Z\ i@U U  0 B  Cd 40 00M-KMhMXL +K@T B0P0  K<@PeP:K00ChKT ;KTT0CA@P;KT0CPb  R0h K@c[R K,@dJKP@D  K@bK(J;KPP0C 0  1CРP!ᐺ9K+K0C0JK\0\A\ B($R K B0 ,@k0 SP ;KX0C0S 0+Kd0d B0+Kh0;KXh BX0Cb  R$:vh;KP0CГ00p;KXX0C [+KB>D 0Cp B0\ ;Kp0C0 0S `;K+K0C,0C` B+tD0$0+KXl BC!pwp:WP:K@$0C0;K h0C0+K0\ B ;Kd0CK 0)bDAP 0S) ;KP0CГy+Kt0;Kt B` `0Csd;Kt0CP0H+Kl B S 0K00 F000;K`0CA0*b$A`P;KP0CГ;KKATT0C@{'LRA-PЍ`@0  0P>P8ZT00T0ST p xP4ЍAnZP00 gZP PT aP0 0QPP x P 0x@0"+S,aPaP /ZxʜPP g{gP/S$S %0C S0 ^S |S dgg嶦n$GE4;M-`3p8M@WnW@ nWP n`hP P` 4 P` g 3R6Pg8Ѝ00S 000S0W0S f0S fߎP fUt%*0 WQ` Qm Q4p@fTHv@??lj[  f2P hP , ⢳P,0S W0S Pdx 0 ⼳PHp ↳0P000TP1X#P ap@D}f 0WpN P Jnf040(05 ,  ,0 `$0PPt]h[q'VrSrPoO^&`~_7ʜٜ<g@-PP,M@,Ѝp;`P` _@P`0V}S`PP )`@  "` @aქ0P  e RyOo0B@d0mgM-PHM 0 00 p0S ˟0S ; ; ;; 00 ȷ_ @00<0;T`@P80@90W`0D=`>`0(0S $0 SA H0$ 0,S[(0 d4b@?c& @ `P/ `05( R $ R*0$0H0 ,0RS@@s0 40R R245:T08  e00000$(dP*:$0(00 S S$@@p _40帉p04@S!S `9W0S  0 l)Q0h)000 L9 HЍ R <ɟBQ0 OS[S S0010CS0 0[S00H0 ,BZ0S ~S 010CS0 02S00CS00H0 ,B$0 $  H00,0S( g~S00@@000S 000C000@@0004 S *0000@@000Sy400@@0004S 0A0*td400@@0=0S @[0S  Cr '  R600@@00@@004 P*JZ  _0  d Z*400C40@@ [ [`&0KS00 0 S0Q 4AJ 0y_i0  kd b`ZJZ000C00|00004Sw*%AQdH400 0CS40j<00#<0f0Qc 0 0C P R0  B PS4  BA4  0-_ 0000Z Z#0C Z8  0 00 000C0000S4Q 8$8c400 0CS40S;# R7 00S00R #Z* 00S4Q xV]04P @t000C00T#Tc400 0CS40>0S 004 S:  D ]400000 0 0h P 00 00 C400 < 4R00 S800CZR4 0JZ J^00 0 $ zc00000Z l000  kc 0l]p@ Ա0p'u P`P5 P30 P P$ P*0@W 0@00h0 D00L@D 0@0p0 0@S0 Sp00 @3 R V0000 P@@00  0`000000000`0 dҋ ҋ\ҋ`ҋDҋ+??@@рjJ@nKs2 0 sA-0@Sd Ra  000l!Shp0XQX!00\0 ` `00!S$1``0P`U Sa0SPMU00PU \P 00P009UP S P\ph\ P * 0L0@'U R @0 (0 000``։։s쁋}}GVMVXYV0!-!" *,-+!0 10|0 R|0S|9 R  /0@-@M0`0 P$0 $0]@^RAލЍ@Ѝ/l 0S/ 0 0 / 0 0/ 0 0 l80S 3/@0Tp0Ppp@-@`PnnM-`0R0M P Z(81p0  $A  000 `S UsP&  0`( " ', '( / %$ 6 R   0 P2/P 0    00S0 0 0B00 ͢ $0 Ѝ 0Sp` Ջ@ՋM-`0R0M P Z(81p0  $A嫢 000 `S UsP&  0`巯* " ', '( / %$ 6 R   0 P2/P 0    婎00S0 0 0B00 o $0 Ѝ 0Sp` Ջ@ՋM-`PpMB??㈀0 0 00 n00020$00060S0 00003/P pWXk]dB0S L0:S M0L B \] 0S p ܍\[p1 320 S0 0ŵ f Ib   ^\(Yb p0儀2060S0 0000<3/P0忀?00 ሀ %000200060S 0 00003/P Z\- 000 02/  3?  S3#"d0 P800S0!10 p|@Ջ21 1 0 / 0 0 ~P S @-:/@-@ R: S @-/;/@-@ RS;@-@ A-P`V P@pi0TWᰀڄ0 000 0P0p0S Ѝ0@@-`PXp@T0W ЍhXp@PWP 0T cP 0P 0V@֭RA-P`@p唛P@0!\ P`U/Ӊ@-@ 0L?o02P00S0 $,^P@(}рp@-PP<`@ 4[@pNP @T2I@-@P 0 [s%2M-`d@TT[P4pⴠPU 0S cNP W@92p@-<`P@T RNP P@@psA-P`@P0 ,p7/P@- 0P [ Ѝ P3#U2A-MG@?@0:0: 01P90 ` 0p0<0X%  0@8/0S 0#S 0Sp000ЍP`Fv9S SZVmM-M`80S* p@P dDt@0h 80s0 000`0@ P00np0SP0S <XЍ@-MGP?P`0 pPP@<Zߍ $Z@  @22p@-PGAM Tڕ `VG?0lZЍp 0S 0hr Č}?00 00q00 0 92E-@`pPXM0h d0080s0 00 PPUЍ@-r` qP  p@P0 00P0 00P Ѝ R0S P    R0 PS s R0  Wd0@-M\*)@h00Čr 0 0Ѝ@-@M0h}?00 00  0 !0P09hY 0h0:8Y 0h0/ zYЍIM-$"0@q 0RFMWs&P 07h401ܡ 0`1?`00p0003 00 0 0 uPS0W?9Y `0gd0h 00`aS ` W tP 9 W  OPp㘰 0 tp' 9 <PpP P0R0 0CS 0S Q03FߍC@֋USBCUSBSp@-(MP@ R410hP}?0 0P 00 0!0PXX 0h0<`r 0h0i(Ѝp`7|/M-!0!0@R3P8MhD% 0G@A@0 00h }?00 000 !0`PI 0h.0I8Ѝ 0G@ApW 0 02$0$0 S0(04  ,0"t`),0R   $ 0$ 0)4 S`9 00S 04 S [ K 4 0S(0pWCE-@PpQMG`?`q 0Sm[p 1#4L01M01SPF Z 09,03/Qߍ 0S3 l00020000@0060S 000: 0S$Z09 B0S$R W "M  L @ 0SSS S X M D L @ ;X$W  pPN330M-PP(Pt#,IaT@VM0?!1S<"10CS88 ``P`"1 0#1S 0%PS&"20 ,0 0 R& pP 0S 0S 0S 0S 0S% Q& |Wt"t2pW`0D"0Ѝ+Q*  +Q* .% 0Q060 Q %0S0%00 h0 u1$90 0<0$0SJ03I0h_`}?00?` 0`000 P$0 ! ]0 000<000, 0 `P[    pP  y(`P M`P !P`{ 3/P 0 S*4 }!`PnpXi ՋHG3 NK3'lҋ3x33A-`R M ݍp00(?@RP?@ 0P"0S08090 P W @0\P10#0%*@P?T@- @R@00RQ1h|00  @PbV1 S|00 S S0 44V@S0h000T3@-d0h00Čqr 00 #0 AЍp@-0hMČd0 0P0 q 0 0@+`P,9bP 1S 0 < <0Ѝp0P/\/A- P@8`8pU P@TnnA-P`@88p1S1P40S 3/@nn 0S/ 0 0  |0@ R/ Rp_  _p_  _ 0 0/ 0 0 J M-@`pM$0pSP 0S 3/$0PS  R 0P 3/P0S.  P$0 S Up2/P PCHoUP& 0pUۍ0S0 3/P $0S P PCsH0U0P0S 000440@Sp@-P3#@P, %PU U p(0S 3/Pp 0d 0 0X 0 0H 0 0< 0 00 0 0$ 0 p,q=(\W7аQM-@TM 0 0 T 0SPÃ` VD3 ^ (^ p Q# pG pp00 00Z 0 0 0 GQ0 00000 yPRPKn pR p7 Rg   F$R'R R @ $R   @  @ pG p p00 00s 1Z0 0 0  0 0  F$RR00R00@ 00 0$R0 0@0000  0 @     ڦ@uU pZP2 0 H00Spppd  F$R!R0 0R00 00 0$R0 0  0000 0  ៦p:pp000,#4X QA-.p 0 0 APA PP!P3Xȃ`P@B`Q @E`P 7ET*@,Q@F pE0epppG0GS0p@G00C  0   00@@@000CS000000w@ M-M@PPS 1 B`᳀lPU 0S H0U!\S `WP?P_S 0`P 7P1S`P 1 lS8 :RP G0U *R0U0  ,RRZP*XPЍR PSP@??/`PI 0P _P4PP0Q`i RPd P⤥pE?0 SQ  R: 0RY R* Q7 R[0 S$ QUڼP1U]`U P{010 G m 0%! &!0pu 0E#&! &! A 3SS!u 0%Z"S %! J1;Q Suz  n `0VP0hd000 000! oPP(lPpP\R(p ˤH` Ƥ ¤Q 0 Q 0 Q 0 )LRPH4W4{444595]55555 6,6R6v666A-0`pP?P0S@&@  # @ pGo Rrp#W  B$RR R00 $R0 0 0 00000[X ,9SY M-$@.MT `?` PPp W p P r0 0  3  /01 S 0 0 0R 0 000 90 t1S IP0<0`0@SI S451S2 @0`Sh: 0h d000 00` P20 0<0 0S&,9pớ`P(pᶛPP 8`1S!V0hv`d000 000 0`aP 73/&00? .ލ080` p刀 9V%2P  FX1QdXd`r 9V0S00p"0S%00`1`S  PQ PP0  p0`  p pG1 R P00P P):_0?0 PP P P:   0ᲀ0   P P:    pB    !R    0     L0a  R Q /6`$D֋7*7P(M-`KpP @,JPP@4PpWЍ,J@P P6P C0FS030# 0 1 00P0  4PP01@ U0" T | |0QqAZ   p  P ,0S 3/nnA-p@P`3CP |.CP h(CP 0  U 0Ah hP7=DԂ 00S/00CS/P00004 S0 00040/A-@P`p@ 30pH PzOL0 0 R0 40 0S/ 0 0/A- 08 0 0@T㉃0@D. 08 0Ѝ0 0 (0, 03/ 0$ 0 0$ GOL P0R :8QHO080W 0@GT 0p*OL" P0SP`R7 0 / 0 0 @-8@P @03/0p0qIOEՋT00S / 0 0 @-P P0֋}0@-Mӡ 00C@PT 0P0@ 0R @0 3/P Ѝ0 3/  Q 0@U  2/P @W`W@W M-M 0 03 0 0  <0CH0 0, 0t tP 0 0 t 0@T >P 0 0 0* 0 0 P ; >ODH 0 9O+ 5OK  2+B322<2 "P +#PoPP_t;0_0_8/<0_C59!< 0_@;0_8;0_0;0_P50_Q_@Q_ Q_LQ_:1_`p:D1k@PU, v( 0*( 0 R @ * 嘎L`P *0S 3/`P 515v 515 0R0PS`V ,* 03 0 0pm N9@_P$H_ K&8TuPB , 8T8  7T> 8T 1 97T #8T6KD@DTx934"h N,(8T# #8TL U U4 4T F8T = T U U ? T UPqRNPP 8 ZqP@bq1@P@!`OqVPVq1 S`@@188$_e $_'_$Bq`PQ 87D+_ P+_䧟 p+_ _'D++q!_7@P+_p 0X$ d )qP`F 0V\:H9_00_9_ +_k_(7;_;$90$9 qP _6D+ _P+& _p+0S&4_7_4 0@ 0 , 0  ,000 0 0   0 0 0@/rP E,{|s 00000 0) 000C00 00000 00 0 0   00H0C00 00000 00 8 @A>8 0@T  `D68 08 0D K @)8 08  00S 0003?  000 0 @08 0 008 @8 08 4 @`p800C80 0>p0⃡ 0Bp  00 000`X@0*#!0_4?4_00SP 008P 00@0P0@ 0#%M 00#S?o 0c0C p?Acq A `a>06003 PT!00U?o 0c p0C" ?L1cs0敧10 C `c2,# / 2#&<. R 0QP L"LLBo$xL4_  `L4_1SL S@L14_,,L(L ZY 000S 0   0 2/楞 0  0 0  0 005C<0 0  咞 0 0P0@ЍlU U UT LH= TKD&@D 00AP 0Q mm7T7777t?7 "" 0UUU-7Պ888%8S888-88~88868?8H8888`֋֋֋рgfff8H8888888^88i8t8A-p`P @<P p `P0@@0 M-XM@ RRpta0>PP0 S DtPpW(KPXЍ@P@P  0Z 0@ `I 0t T5TILI 0 0 8IPhp@2 ]\[Z"@P-&AI$0SP iP`;PT0$0 R  00pP ddI,@,@D,0S0p0  (pu0000 40403 03 0303030310@PpQ3ȳȃ # @03!@PE ! ld@P=00@0 l#@Pd-0\00L#L@PD!2 0@P$s$W : 03 Rm JD @Pf JpK @H2"@fHT 0'S9<0SH AHP& h20`20X200 0@P @@ (@P0S 3/@P P &A&ADpDp@,@D,0Sh@,.JP ph@,@D,0StbP- 0RQ\( @6 P 8pH,@)0P q0S (,@,@D|H֋T֋P֋L֋97n#9|n":9:~4:99::L\t֋h$`ppx$$$\֋څ:X֋څ:0DV;x֋ ;$;-;C;n;p( P!;;;;Pommgv' '6(','…跃,q=(\W7а-p*(T lt{҇\{@`67=Dnn;; <<<<$,<֋<<<<<<@<dp=l_C=X=b=q=d===>g>7T7ƀ|֋O<w<PdZ$=Ů>t2>%>j=o>8x>>}>>>>>>>?֋?@?*?>֋ӉW?L% 0 52A  G03/P74G 0S` 0DBH߆ TAN @P 01`FP fDp:20202h`02020P Qp:20202h`02020 ` 0#0 0#0 0(#0 04#0 0@#0 0L#0 0X#0 0 h30  0 | $  (  ,  0  4  8  <  @  D  H  L  P  T0  X0  \0  `0 0<$0d 0H$0h 0T$0l 0`$0p 0l$0t 0x$0x 0$0| 0$0 0 0$0 0$0 0$0 0$0 0$0 '$! $ `$ p ${ V`XWXp |W wV r 00 0eue0Z0 X 0&LP 0^F jP60S\ Sd Sll8jP 2@F DjP 0f6F0SGkP/ l0S00'F jP) , 0j6pP,  fFW00F jP " )DjPD0!SD 0S"   A0E {jP DjPD]n 040'007"_"Q 6_S2(0CSw *('jP 0<(P HE PDjP  pDݗD|EDz8 DD0<  j`Ph` EV- V Ti`P% jP! 7 xa?P}00Cs0S  (x~0< }0\@0 jP h tEsR:t )h0S8 hE/ P 9 ^Ed>t*p@`҇pP 0OS@$0 D0 00n@o40SP3/@7o iP D{Ax*P: DP!b`L*0(0P!b`L*/( DQ,b )`*Q$ ( 00j<pzj`P iP0 mPD mP h 3i10h020i030j0E0k046BmvjP 6 g d aH V < ?08 yD D6L|TO7P/ hp-)x  `P* fPpP' HPxTh0D0 T Dh0  HDV h0W Dhqh0D00@h0ST rD iPp 0 0 0 0 04 0 0 0I xm@T =0=@00@ 0 嵃P e 寃P  8 ` 壃@ P   P x$>$`P4pPpHP Whp `D 0 0x D@>@0PC  `06/h W ve 0 04  /x /t  h0l p Cv VC@P m@ TC@P `@TC0$V00S'CCP:`FX $?z???M-0#,`(V0p0W0R0P@0`F ?o2R0S [ [! !PA ^@ 0 (pЍM/   R @TP 01Ѝ.F=P@b=@`F@P0U U= P ?PV0 !@@@@}M-pM$ 05P ܍0=`0P00@S0000@0 05x0  R R0 R `0 R R R   V  <1V$I2A(000ŸA0 @x0KPZ PIT T T@@ <a<@(0h@<0PTk  `Vp=X]Z00S0_000 0@@_Z0`0@%?o 2$R0S T T 0( cP P P4([1 <P(Z 0 V_\ ^0S P@U T T T <a{<PEU0@ m<j<NP@(Pt\B$\<`0MSD8PHP։H70Dm۶H7֭l_~00@p R/a CRWC/A CR7C/p@- Q|00Cx@`P l l00Ch@0T  Q @03/P00p@T@`WW`W`WW`WP00 UP0SS!3#/%//H @-<00S @.0 $R00$0֋Wp@-PPp0 04@0<@D< 40Rp 000ST$<@0P 0S 0<00S //%/0S0 // /0 0 0 000@//PQ00P/00 0100/P 0/PR0      /P00_ 1/PR0    /P0_0/0@-@ ^Q1\ b01130\*0P 0 <00S /%/P 0 <00S /%/A-P@U$P`0p0<0S P 03/PU%A-P@U$P`0p0<0S P 03/PU%A-pP0/ ##c@_ N@ 0_U H4Hs0@D@@X 0_H4Hs0@DMbA-p@p@`P_`0 0P_`_@00 AA-P_P0c0X0#C p_W_W@`VMbp@-P `P 0r @P _@0 X0@P0_pM-PD`ᴰ0 Et@A@p_  XP!p`WT0T PU_0 0ғ,0 #?Ѝ ʚ;Mb@-@P@ 廓dʚ;A-@P _p__`` ?_ _p_`Adp@-`< <00C8@PT@p2P D@0DV0D@-0@,0S PO00 0040S T$D0$00S 4 R 00<0S T(20(0D0:D01US'p@-1PS$0s/ R R0PS @S@QPp D6t9P  0Rn9P dp/ppAAM-@ MPPPs/o"T R0T  ` 0Q3 p0@ P 0zP _SGV0ڈ 0 P@0 `V*  0r 0X`C+ X00 Ѝ \A _ _( 0MV00XP@0_ 0?P0_0`Fv_S 0 S@0S @ `S FR0[0SVF0_0_(  `00_0_( 00H-0?00@0M?P?P@0 |8P `Ph0S1Sh`l0KM- M0 X?0?0@0 M>KW@?@0 |pP  >P !|oo`PW1O0@QH @oW Q00S 0S>PU0 SR 0W 0 00 0 `VQPAo0 (0 8xx\$0 l0P\ 00$0@ B>W SR AIAuAр AAA@-@ .> 0 jЍA0H-@ P㷑D$?@?@@@M?0?@0 |{P1 U: Qo?0QP 0S@ K0Xp@-M @XpT=ЍpH=P4`00 ,`P= XpAB9B-|M X|ЍA-Pp@`P W @0 000`0 0MhЍ  ?p@-?@@6PP  Ꮟ_pp@-@PP9 D0 5P,P,P1 004P $ RDP- $0S 4P 00<P (0S@P (00SD0:D0PPD0  Pp0S@P P^L R3/PP M-p 0@0`D0P000H 0+04=UP.=4@X<@D`p<0U' < 0R  <@<@DV50 S=PES@<@<@D<0S X Y]@PJ`ZЍU   0@TBQ^#xB}BB$@-@LH0S070Pp@-@@4P0 :Zp0S -p [0P0P @-P/@-@{p vp@-1P ЍA-B*4S 0*4`p䁟P<P`UU 0ES 0 U$4p0W$4P404`P  40 4VfЍ P UQ;0TPEp`44S܅P (4S4 $0#S ͅP 0`0ŅP(4$S \ 40?s0S0s0R $s0Rx | |x|| 0S} E-@=QMB Q? qn ЍE<(Q 6Q Q mQ J AR132 xI0^ #Q Q X;^00I00  00;, 0S z 1Q10 I0^ ;jhpW$ X! @4US0e03ॏ몦 &Ed 0@x;Ѝlhd`;XЍET@`@H ,0T@b0q7@-0 Ѝ0@PP 0,0C,Q HQ0 ,0A-`pPP@ Ѝ 0LV@ ,@,@D,0SP 0P/ 0000C  Q/00Cp@-@PI D0F@D 00S5aPP4 00 0S1D0  00D0 00D0 0 000, 0 0 ,0R00 @ < <0@0D0 3/PP p3/P PPs@-@P; D8  P@P0aPp*` @0 U    R 000S0S0S@0  0^ D00D0@3/P Ѝp3/P 0(0S 3/@-F@p@-@QP 0`@?x@P$p@50 p@|DM-P`p/4@<@D<0SX .P<@'0 @- @PP" `0 4@,@D,0 S`Ѝp@}D0@ * 084Hq (4mP,@ЍpD~DD0@-0L0\= 0s0_@@00CS00 \ \ 0s0_0s0@@0?\@ \@4O @_\ \0@3_ @@t@@0t@0A- Pp@P\0@$  "`1L^S0 00 RI @ # 3\ R?  ^= 0000`s0_0Ѝ\ \ \s0_0s0?\ \ \_03?\ \6o` \@P_@@P! 000wSP$//7@-@P  0P  Q1 0%J3#3?&0% Ѝ00 @- 0  Ѝp@-@P (LPP $P@pDp@-@P``LdPP  $L  L$pDDp@-@PLPP`$`| $LH 0PpDDp@-@PLP PPp 000 LppEjp@-@PLPP|P 0LD  0L, $ $L p pE"EDp@-P@@P <LrP $05#0S0ppj7@- 0,@P P-U@ Ѝ0@- 0P Ѝ@- 0P7@-P@  0P 0SJT Ѝ013?1@- 0<+P@- 0 @- 07@-P0P$P00LP@ Ѝ0( P0 R058E@- 0QP 0 l/A-pQPP@TP`P@0 j^0P0U0S` L 0   0@-@PM0@L PPoP0000 00Ѝ0@ZE-`MLP@20p},Pz,w,t, PPPPP 0Rp`OpLpHIpFp 00 0$ PP ЍUEXE0@-\MlP h@0 *@P0@ 000R\Ѝ00@-@0TMP0L$ PTЍ0hEM-XMLQ 0 0@XЍP `0`0`2"G*P VLP aJP @ 0 L@PH8pY Lo80 Xp@`P x@ 0  ?P@ P0 SU  { @UR 0$-sp -G@B0@-0@P0S@B@-@P0S@- P@20@-TMP@0"( (!0P0(TЍ0hEEA-p`M@P`P`p0 LPPpUPUL]^P{@ p`_ ,p_`_,Ād` p``Ѝ*G7Gʚ;@- 0M-0M 0Q` 0 00 0000 0l"07@Pv 00L@ 0P 0 0 0R02PEQpUL tT@ wZS1  0  @PHP 0 pP=@T|a||Q 0 0 C 0S P!0L@P&40S PEEQ2e48RU 0 0ЍM 0!0S00W0Sp@0Ѝ0S pD`@ pN&000P @  0 W@P @@$VVV0D0DV>G[vFG@-\@P@[0  :7@-@LP0P 4 P 0S0T0 Ѝ0PG @-Pp@-@P@LP PP L>Pppj 0 0M-P0 0$0 M0WS9 Lp.P@PK`P@FPC P@> P8 DPP @2 0 00HSP @PP@ 0000`0 Vp  0 0   @ Ѝj[GiGtG@-@sPnPiP 0 `P[P 06 0\PPLKP<FP,APGGGGGGGGHp@-`Q@LD0  %P pP 0@04P`P00 P 000 0500SppW ?4;$*0 c500h00S2x0`ߍL0S%203#0`?$@@p@-P@_e`0/0/0s0_p`Vp@ ;! &O1S/@-@0qiP0S 01P$ 1S @-/p@-@P0`<0`S%M" 0 000<0H00h J0dPTPP `(@PJP 0T00X 000 0A81Ѝp/wAOIO@-@P$@pP`UDM tQtPQ @ r X0p P`P3/DЍ/0p@-0@P?P p $r0* p00?P 1S 9! y:8! u:M-'M3  0#Sf0P000 {@'ލ@T po`W?`, ntQp00ftQ Xo @0S0400   !0 Nt0Q 0 R pp R     #r  S0S 0| @P 0$(0 Z @&  0    qPZ 0v0 @p0Sm 0  <PF000500!1"xCr q0<P>00S!7"tHr q<P(Xp 2(r <PXqpwpW <P 0S$ 0 S <@ <@P @?UOOOOP5P_PPPA-0@0 M2,00<00S 3/gP (~zP Ѝ PU#0eh"0ec010P0gPh m-P&pc ,0>>,0gPP0<00Sgp0Pl000PQg3P0<00SYPPig0 P00 20S10 00 0agP0S10cq币70 000 OgP>)00000 0R0 0 1 0=gP,0S`VF s0<0 0S}j?gP 3/P3/PPh3/00S?00 6Q(B 0P0WnpPT|$`UP00SPd6P00m^P6P QQ%QD0 /R$ /PM-``P 0Si0@S qpi   ;P XUpPfU p{M-P@`f000p00 S 0C00㄄ R pW2 Qt\P $p_p_ o0媢0 00C0    UR _ 0. 0 S"0 0S10#0R Pt00*_ _ s0_ 0 _0 0q_0V00_ * 90SPL0? 0`  _$S C9  0C r _0000E"?o2_ .0  P: ,m 01 0$0_Ѝ000_ 0_0U0P0@ 00`__ 0U0 HE p`T00_ IZ0 0$0_ ) _0 00 0R#:000pW/*t0 00S  _00t0 `g_0`0AQ0 0 P _ _0 0BmPP4%SQ_QQ}Q@BQp@-@P$0S 0S 3/0Q d0S d0(p_ ^0  0 0(!B BRQ00s0_ (0$0S 0S p@/ 0^00p@->$0S 0S @/p@-100 P@<P00op0$_0P0 ppA-P@`0@T@p0$0_6#S:SU #GPmM-PP``6@$pM0L@peA00 0 0Q 0 `LP0 P P U&Ѝ0100200 20PLHL8P0800L1P0  00L*P0 00L#P0@00LP000LP0<0LP0<0LP000LP0x00LP0`;0LP0H;0LP00;0LP0;0LP0:0LP0;0LP09 LP080LP 090LP0 20 0lLd0L00 H0d @_0 0& 0_#8000  0D _0 R8000S!4s0?00P0S$?s0_0\00#44 0468000H00€   0 B  0  R0;00<0 R000?00) 90__S0(0P% 00@0< P80$ Ph6  0n>`0000 @0C04@20_0 0_0 0 R /o0b R b0% SQ Q _ 0) $0S 0S 3/_ 04 _08o6C60 00_ )0 0Q)qHHQapQQ RR$R1R?RLRYRfRuRRRRRRRRRRS@BS $@SIS;@-@ JP0Ѝ@ ЍfSM-PPP(M`p@P`(Ѝ a7PPn`n` x0S 0G0 e00<0C `V*0PGS R UP! Q|B S #  !0$0  0b P0 UUQ0Dn0PE  0b P&0 00 0xbPn4P` `SSM-@P@8M` pfPP 6P|RP0@0Z @10Db `V0 T1 p8ЍT+ T   | Q     $ @)bP hT 0 00$ 0bP 0 4|0Z(ISI@-`JP Ѝ@QPx V l[ @T  X0RT@@0pa 8T (~ ֭gTT T 0P1/׋0P "/׋7@-0S.81884@0(!QU;@<000040PSL0400S  C3?0?o $0R B2/ /o30C,00 ;A S( 0 Q   01/P_p 84<0@SP Ѝ0UT(T0 pGd,0PrA`!0⸰ἠᰁ$P(`,P001pP$@ pP01pP0 `"d0⸰ἠᰁ$P(`,P00o1pP ,R$  !8Ѝ !VHH Q/0@-M?@?@PP 0R 0R 0R  0R DP Iߍ0@M-0bMS$0@ PA80SG P0PSI0400800 4<0.PP2 @Tc0406 8<00480YPP!0 S@0#86ı 040080648<0YPP @0DPHL`RD0HPLP`0S- BR)  PP bߍ00PS6`CPP00SPdS?!00 6d* `! X01 p0l00US!  VkUR8| 8?8.8 P0`N%n&3.5"1 0 0 *++,,-<Qtt0P|0\ 40s  4 84<08 ^Y0406 848<0SYPP|p`pi`PPt>Y P-Q7 P &P((X  T2YPP[30P00` 0 0?` XPT`ppPPI03/< 0S(81 S8 800(0 2(07@R! pQo`ط?`0p0@0000$ llt$`,0(0XPP03? pW 03?(00(0(,0Lg>H7V@XrXXp@-P@PD0 P p H0pXA-@P`$`0x (pp `LtP LLnP  ,Le L` [ YY-Y 0:" _ _P _ P0!" ?pa0Q_0:ƒ{ 000 4_000C0_0  0$!P 0S 6P [XY,Z`P 0 &00CS 0S : =0 &00CS0S  (0!3(\ۋZZZ[Z$ZZ=S$k0 p@-`P`@0\0 R 0H00@ \?C"0C" B 0%p ,ۋTۋۋۋًp@-dP0S pP`0S-@P00 00@Ppp,ۋTۋۋA-PpU 0MLPU$ >`P 0 P ` Ѝ VdV 9VV'00V00S >@P   VX@` \TH 000 000hʼnPG[B[u[[@-W 0,0C,Q ЍH,0PM-PPH0@$@s0MW(Pi(YH0S   WR$000P P0LL 0 pwH , KPL ` | } , 00 $p0,LX 00ݱP / 10 110001100S$ 00S `|8 R $ 4$ 8 p0^PH0 00LPd0Ѝ,0 R0` 02 6o0Q0. $0`Q (0  0jL\: L\:$ $0 Vq$  ``  00,0 p0C,0p' pS`Z[@-P0 @0p`0 P 0 #120uS<Ͽ \̠1W\  2/"E-PM PL a@P 0L 3000<0Ѝ`@Z`pV:`pP 0,S 0S.S  /낉[M-8MW#P$8Ѝ0L@ð`῰PVppȡơ 0LVPᨳU W@Wᴡ岡<PI 㘰@PD 0L0@ 0NP9, HP㔀0  <P 0S000( P(0,00P 00,00P0 `bPD$  P0 (2 e1 <03?@2j~s~#J3 2DԡH JR," ""*0 0h  dA Qp!<0: __<0: <0l0_?>P@0_< l0R0(  *p P P@A(00<00S (3/P [$000 00-(5*()*[ H[^[[[[\B\i\|\Z\\\!]2J]p@-PPS @TP < @Lh < 0Lc< L^< LY< LT LO L&LPP020ĵ  24 8P 040 0=s  0C?o=r20S,00,00=s  0C?o=r20S,00,0ppk]]]]]]]^$^=^p@-@BPP PpP@P@-PM 0LPЍ ``P@V  u 0SppP p P 0@ptP  P낉Y^i^0<0S /@-\ 1A_ `014C0@>'P\ U ># 0 0\ S0\P P   ," R ( 0  Ѝl P[рm0M-`⡁ Pp@P@ U 0P 0[P 0v' %"0  01_ ::_ 1Ѝ l 0@-M0 @P4P    Ѝ0[s^7@-@PFP,JQ Ѝ09PJA-@P$L``$L%LPP(LPP((  pedP 2SD09D0T 0(WsP [ 0S0 <08ЍT(00 0^^^^HH@-PP00@`pV0  Ѝ@0P m ЍB>Np@&K@ PP0 sPpP00 0p@- P@P@ģH$H U00  `pHH_E-PP00@`V0 O ЍpP m0 @PB>N@%K@0 3PP P @-1PD @Rq`; p$0 CR 0CS  0000p0 P@VP P6$0 SST'S T! S0#  p1 P _Pp0 P Ѝ@ P S0# 1p ЍZZ%(_HHp@-q@ P90p@ s0E-PPLp`p`PMLHpU0 \#\\@P@Ѝ0L]P'U@@0 0 ?P 00 0P 0  '00SJ <& SG 4  R  S0@0 0 0d@P U 0@ <K0"@ E @P U 0@ 0!@S P!S S `'S " S% S %S 0U00z`V} d@P|9 s0@PtO U`Pi r@Tm@e w@P_0 s0@PU@S8P  a@PI@@DT0 @P> p@P8 ;s0ЍE~HHS_ho_~__p@-@P`dP` P p#PUmpp@-0P`0@S t >=l0h>8`0`t L @0 0 "ppppPۋlLۋolHۋ00S4 p@-=@PP) P( :PP J0p0=P ?l0p=P 7P0P @6Pp00p/_Dۋ@ۋ>ۋ__8ۋ :$ @-0 0@P;@ۋ>ۋA-PP`pb@PU @P P0 000 $ 40 0C8`0DpHPS00 ( , 0 0S 3/P XX  " 804 40WW`A__WZWX#U`ZZM-0M00Qp@Lps`0{P40S4P U.0Z1PU0XO 8//o0P!|P00 0SV   08 0 `$0 0Ѝ3/ 5??oZS:o0 , 2@00< ; ;@0 0P*  s0P P  pP",00   x0PWPU AP wP  Pp@- PiPp?M>M @ @ @ @   VPp  @ @ E F,00,0(00(0gp@-@@`A-p @P4w0` 1 *P v0'A-p @`Pw0  1 u0@-@9 0  0 0 0 < 9 s@p@-$0@ 0CS  $0 CR S Sp0  0 0 0 s0$0S  090 s0$0 S$ 0s0  |P 090s0l@ 09 0 s0^@ @p@-@0 sK1 nD1 i(< dF1 _32  ZM1 U <  PY1 K0 F$0S00 > 700s0 3 ,88 s0(0 #d$0S  ?09 0$0 0CS0   $ p0 R00 00s0 R 0 R0 0 ?y? @-@0 p0 0 2 0 W?@@-@0 P@vp@-@D? P0 00 u0 0  p@-@0 1 0 2  `0 | u$0 Sp0p> e9 s0b@-@lPA< V@@-@0 M 0 H0 C0 >< 9>U?@-@0 + $00 s0 0  70 "=0   p0 000 >@@-@0  p0  00 S;  0 0 0 00  \1 0 8 8 0 @1 6>P 88 s0p@-P`@q0 v0 9p@ s000S/   WR/M-PP@@p`P0 0$`PP <00_s047_< 0<0:*_,_<0:*<0::_88_< *:D H00Cs 0P H0D 00CX0DPH0d h00Cs 0lP h0d 00Cm0d00h0_0< *8_< 0_< 0_< *8_< 0_< p$0 (_<0_<0_ < R0_< *8_< *8_< $*8$"0P]0E_o0 PeU 0 0_< 0_ <0PEP P_<0:X_<0_<0 H0D 00C 0 $0DH00Cs 00 $00$0dh00Cs $ 000 0$00$010<00S =@dP<0::_ 00_<0_<00 0C0 4 20_<A 00P ,PU  [`aMa$aa7@-@P@0S R R0 Ѝ0@A-@Pp `\ 000WS 0<0X%  T#*0 p8/Ѝ@-@P` p\ 000WS 0 ` Ѝ@-0@ P?00ЍM-@(M ` 0100 1k<0pX00H?o02001 0 0S=0~#X8P0P [< A< 0S V0   B  BP:0B0A<101$ 2 S101!3< 1< (ЍM+< #< < P0Es 0PeP!1j 01p0S 0a  ; $ ;0a R  A B  A\0;0S ; paM-0M 09@PQ0@`00 0 (1@` @`PpX0P 0:XP_0T0#3Ѝ@ @-p P@@  ;00S4 H`u;@?T@  0R W #4`V0@ ЍM-pPH@$0MH0<00S: 0 0`00S 0 `` [H P0  $P$400080R0 R 0 S:308 R 0 S:304 R 0 S:30 T?T@T"`0V`A\ WLp0 0 <0E`P/<0SS  D0 `80UPDp 0 @0s- L0 P'L0 #4L0t0H 0 p TG<0T0@0X0L0d0D0 , P0 P P0s #8\ `00LH0PPP"P  * B: S'd( 0 60X00m X0T 0 0 Lp0uP 0p 8S] `0p p00#s00S fQPP0q TQ6q XQ0q \Q* q `Q$d! 0 0 p0 00 P0`P4p0  H0H0 S 0 < @ L  3@0 0,T40H 5ppP `Ѝ XH000 ᴼ`P \v 02# Q Q Q  4Q ^*400Q ^*008Q ^*80LP"I`P$: 0p84 _6#R 0 a7 9700S70 `o|jP T=;0P$0  8 9800`P0$00  < 84p*$@ &49 (0004990,09H @(br 90H  Cr 9 9 0S  c B"**  "(`9cZ  0 B"**  $"(~90S (u9303W   B"&&  "$r i9X0!a9303`PR P 5K .S223F p 19p0? D 4: S7dP2PХP4 00 ,00H  000L (04  009t p 96P ,0 ,# 9`P=$0SP0$0H 08p4`0 Cr 8X  " B"**0"(0 8W &p A 將 B"**0"( &0 8X ,8VF`Vp[ 00Sh 0S0100(0$, 8& 80S, (8 ,8#,0 8 8X. 08 28% H (~8  z8rp h8 pp B"&&0"$p 0 i8W 2 B"(_8 0 Vh>p '> N8pH0SP{%WWWaaaaabNbbb@-WlP Ѝ{P0 S'0 / S//////|/x/t/p/l/h/d/`/\/X//L/bdʼn cc/cAcScacyccccccccd)dA-PP- 0<@T) 0S& Qp$0S @ `V ?`03/@P 0S VQ "P 0AF%@p@-PP@@,0qCU220S" 0<0S 0S 3/&pP &0S $0S%0S{ 0S*,00,04=q U 0<0S 0S  =pQ@ =rQ<3/&p P P|p003 &Prpp,0  0Q+P,0 U 0<0S 0S  =pQ  =rQ=q 3/P%p@-@B&p p p00rp  @$0  0 0S/ 0 0 0S/ 0 00<00S/ L /E-48sML1,8,P1(8D1 8H18810 @PPW uQ04S0*0CS7410S 0S7410S0741p |C0 01000100 0D0000LBP000 "00$  ,*  0+#; : ( 0<  @ +%k Z &00\   +'t z l&;0|  \f +) 9 `(  㤠 ` @3 80200500S S* ,S( 5 R lP P0S 0R  | sߍh%hU MT%0 100<%  C41 S 0S 3/41S 0S 3/80S0_ H0$80@00000;0 |4X0x4`0t4d00$10$10 $10$10 $10$10 $1 0$10;;001000  00081S9!= 1S1S0s0 1 1 S 0q0.*0 10Sv 0 & X3^rD3\p 1 Sp RSq S3l 1 S:30` 3/P L0 1 R h1S R !R$!  3/P9a RR00R0SH0 Ed1Sr 1S 0 R  % 010101011!;!7!3嫙'0 1 00 \0P0x10p1S<p0(10 Ha6/@ 10S0Da 6/P`V  `(a0 Ha6/ljP 3/P WXU|UpZ+P3D383wdfAdHH`WXb"dadddр~ @-`P*@P   pqW@P 0 `0`PP0@@ ЍP%@0 S P 00@0pa Ax0x xP0 D=T D00 S Ѝ@7,@ Ѝ@P8ۋ4ۋ0ۋ,ۋ(ۋ$ۋ>ۋ@ۋDۋ7@-(@PUP Ѝ0 ۋA-T`0S0P0-@T@ Tp|@DP ۋp@-PL0MQ$@ !0學0P 0 R   zL PP%0Ѝp@`0#100T 1[`  :P P Q0 D @@@ 000\S0<0403/ddHHd7@- 0PUT ᙷ0!ិ@P : P B ?@P00<倷0@P0n㋶P0 L T ,,@, R P  0 0< 0 Ѝ0T 0 0P 000nS*P nP n¿P nP 6 pdGe/P0        00/00<00S//- <s\ ^ /^%P0 (0    /P - 0_; 6;:_00S P 0_40_ Q0 @0_00S0P00 R  10//P0_ _  _/P$0S/0P0//6   9  S <<0  /7'/%/%/P//0S0/QQ 0/0AQ/AQ/00S/@-P^0< S0P$ 0 R@0 0000/op@-d0P~M _ h@ R~/ !~/ QB`V ~/ RB0S  Q~?!~ߍp^q 00@- \0S BR \ @\c S00   @@NP!_0/3@-@P@/0A00_;_ 0!_000_1_ 000_<_ 000_<_ 0 00_;_ 0P 00_;_ 000_<_ 000_<_ 0/00@-  P@TN P@TF P@T> P@T6: @T0  @T*@ @T$0 SP  0 0^0  0P   0P  0@o0000P0/Q / h0_00_h0/00_0S/00/A-0P`/P /v /V$/ /p@-P@@Lo3p@-P@$@ Ly]p0@-@PLP$PP$M mP j p$Ѝ0 L]Dp@-PPL@ @P @Qp0 00 $LHp0 00popp0p@-PP(ML @@0`30p  0S> 000WS L! L  L RLPL P  p0Sh06_`  \000V000pp00&   (ЍppppD s@-@PL PP2p` V00L 2p L 2p ЍpA-PPL` `PC (巵 ! L岵L\ LXpLTp@LPA@p@BLHp CL唵 0@S0 L L凵 0@S0 KI``J @JI8Uj]ppppppp"qp3q@- 0 ЍVqP0p@-0$@0PS QP1P!06_  00`E`<PU?o0 0c0C#@ b ?o0 0c0CS2p0"2 000<_0p p@-P@@PL200pA- PpU0 0E2`@@ 0# al w''l  0?`0 0P? P諪0 p@-@P11 (  ! !":@ 000pp@-@?`?P P0@J @D^ * 0RPCpp`qA-P`@@DT 0q0C0ކ܆چ@DA-P `pᨇ@P Q:@ P "G: P廆Ṇ@ 8:010P0( 01 0qa000 0A00<0S 0S 3/@-@,0M ⰯЍދqA-P &M@: ,5:0#SD  91 00`0(36 0_p?p00 P aBT +P@ &ލ,: \904 0DR2 ?23?2'5UqqM-@Pሀ儠0(MHS` @ 9@ 0HS00 @@D90V1%050Ot@0T 903?0Tp1p#w0Zჴ*(Ѝ0!`!#(#<00 0@ 0 !00  pFP0@D0 Jt@0'q@-@P$*Q$MF Q Qw WX%Q< (Q $Ѝ@HQ QM 5QP0 p@p`'91 00 0V9P0 0P0  & _08080_@S8_I TC 0P U0S0030 '98 0 9$Ѝ0P601   9 8  0o`$Ѝ@L@Tr'qFrM-XMPT@/T0S  `T   X)P$@ # # 0#0P_T?WXX0S_0_00__[ p_100__P_0 0 0_0_$3 _$3(0033W:0_0_00_3_$S$p_U:0CS$41$ (# 0000U400q0 0Q(Q4!Vxt40H0h40`$  T$  H$  <$  0$  $$  $  $   #      ß @  ̃ ģ 㼳sp4LAP0CR R2000  0)PZ 0$ 00P -  0 <  R ^ 0/ R   RR* $^  R R$ $$0S R  B 00S 000 0 0 /P0_07@-0 0PU 00S - ֲ 0ڨP0S }fP0S 0꽲@P }ぱP 0  P卮P Ѝ0 pv0_ _00_Q00;0000/0_s/p@-P@`P$`P@L(p00 P pU40 006_(  $000p@x} M-p!S`!@0ḁS0P0ᶡ @ 1 @i000<0S 0S 3/@$0 00s0_ U 0 @P:m+!0s0R0_ 01 < R  R 02/0`v` 0 )1SP%`_0( 0aaPЍW 02_01S`P%_0( 0aaPꀍ[-ދvM-P M0040pp0(0$0`A01s0000,0`40 0@0 0A`D00%0g 0(0t`x`|`0 `00l 0X007*x00P 0E @0D2S @E@  U 7*K2 0@@8 0B20 8 R<}0+P8 <0 Ѝ00X000000R1@00 |$0$ h00l`0$00`@0C7 0 X00\00@d0 0`P. 40S ,)(0 S 0 b00 B 3RNo^ 00 A@0 B@@ 03  R 0 0Sv@- Ѝ@- ЍE-PDMpE`@ @p/000*e RP@@E  z"0(  PPDЍM-@pT@PPPo`P  @S0 P 9| x /0<0 010 004 P 4P000 |p20  /D I/ ^/|M-`P@0@ 0`M <0 7P" "V@@04`4080000_s||p`Ѝ|P Pp p W/0 0_ _0s00S0$001(000: 0R4,090,0_0 0lP 0 =P {pPU PPh *1 F(0C8, _0 $0 00_( _, 00_0 _4,090,0_0 0:pP q 0L嚈P @  . 0 00#0LpH0   PP 0 0iP 0U  B[唀qPP 0 Pf @{cP P$ [P P {  J0! @ 0.0 00 <08 帤!  B$ $!$ 0 PP"@ . 0  PG?040 <0c4PU,09LH0(00$00P30"KR U?$0!" 0(0 P  00P0PD00D0JP D0 PP 0P P; V 0PP ,,0 P4 ,0R ` RP  ,0*P,0`  00tP[4P0U 00PU0@00000傤P0  0 @ [ B ; 08IyxyPg`gPgyyjp@-@P` `P(PQ,I0 00p@茁%-',IpA-`pP@_t @T PU@--!R @00_  0_00p@e꠆yPQ00-1/A-PPL@@SpP L^pPP 4$ 1a|_LRPvv` !8__:_8U @WT00V0S, $0 ΄ 0001pS`3`0141DASL3 4181S<381<1S03<10_00_03ip/Pꀁ2n06._p_p0RLP"Ÿ0P0 0C 0420_0 0_0`_\2 3_$s013/@1Sq00_s@P` &0@0 :`D0@0pP`T`X0_0` P$&``` 1S(P Q 0 !0 S  !_0 0_81    $  "$   $  "$ 00_00_ 00@0_0_ @000_0_Q(!VP3/PP r_ 0 @K Py݋zx|&z$!4:z00CS/@-,9@S ( Q $9    R L0 ;((50 00S(0Q 0( LzM-M 0, 0? z 0`S00 0 1o 0媢 0,0 0S0S 1S@ '3@0lPPlV`  % %0 3010l0000w70@0000@$0T 0 zz4 8R$t0|,!0=1R(9T@DOo@B601@0 c 1@S@/00 p3 A7400 0<,00S *b 0pp R ,4< 280P80<  fq3  @@0Px,0pSP 8000(p0 &0 80JZ@(0@ 1S  3# " @ 00@00倠 )0 (0$00000_?0_ 000_   0_ 0)L2up@ Z0刃#?SCD,C  (p00 ,BP:00$0@ @000_@0_ 0 7Apl00_  _ 0 X^ 0 R00S 0??0S 0PG!0@S0 S S0 S @"0 0 PS0 l   l  TH9 0C0 p0 P܍zzzzz{M-@,ip$?S04P T4S1S00 0@4/r P S #S R Sx Sz 0909##S0_*0 0 $R R R,!<0< 0_081 3/ 0<_ 0}>vP0_ 01;1jS9 SD S0`0@  04#$R R RC `_ 0T U PUPTU #Y ЍB'0`@`0`s0S|"Ax"`0)S\B` 0 4 0`@ #_0000 00000000 000  00 0413/P 0P00 0 0`        00 01S; 00 0RA  080 0_000_ 0:00_K^_*0 0 $R R R R.  0R R 1;10 000_ 0:0 0 0 0PЍM4R5{!Ϡ\ 0/A-Pp@`P_ 0S | {EP_ @T |mt|p@-@0_0_0_0 P= P Lp0_0_0$0Pp p@0K{@-P, `/@(91|0pc 000() P ! 0P ()! R r/d0dd` ",R  H0VDD", Ѝ m Wu(T3=0  0$00$ S  P wR%1 00 Q`"!00( 000T@( 00P%1400n?00000(040( S$00$0000+@0  0S-1Օ,Օ01ᗓ#0ӁƟ@^3 T.!R/o@b`1T) .AT@3T@#P@D! ( $!," -`؁R.AT@3T@#@t@T .AAOo @d@D T @#[/5"R` ` *<06 0  08p 08 P ; *!+<0#H#(dLl@@-,!80$+!00 R0 @00(0 0+!80  r 80 0 P480(00(0000T +, (9@ 00|p7`2 PU 0S0 0 n   P`$0 X0A8!=R$ p R R88 $|(,@  $(,D  $@0 7 0p0{S%0S xs0 p0  ,0P@00#D0p0pS08H00,0L0 @0  @ D H 00: 0L0@0  0 $ PP[ 0 # R/1S80CV. #1,000 |00 0Sb |0 [|0  0800000 PG p  9S $ p0S,P 0 S  P  X W 0909m{{W|NC|1|R|\Nr4`4cU   @U}h|(T80/P@- 0\ X\@@0P D QRW0 /0////////// ////@- @0$ S*0 \ #3@-! " !Ѝ0($  Q:\03#//(AA-0`@PpW p@0S008/PPPZ PP0 S) Q 0@00TP0@0Q Q00R00P TQ0@P0 00S00RA-!1`Pp0 @pq An  N!JV41V81U4aQ&l1U8%\a1Q800CS80) @-0Ds/iW뀊(Ti XX8i@6i-Ѝ@-P@@Lp@-T000 0 0 0 Q, 0S  ? ЍӉM-`Q5 p0S1  P0S( 0 @DT#@ 0R UP0=S P@D R !T: HlЍ@M-PPP p,B`P&_P@. i@P P:/PP 00RPOEP  7/PP hV @ mi@P $0 0hVPPM-!Mp`@ 00M  K:P4 $010 P pM 0 K!P chV 3iP ᓼVh(iPP ᇼРKFhP Р  0{@-@(  b  ^X5@-@(  Q  M$M-`R02Q@@VPp% "0HS0 0 7 00S ,0 - 0 R# S00S00XS 0V] Vc V 01SyS tSXS0S F0Cs0S! 1 0\ЍY0C!s023 00  0S Z  .RZR0  0S  S 0R XR Z  :RZR 0  0  @ 0|T `PP@ @D0T@@ P ុP 0(y р ʂ炊Պ@-D@/ 400P 0(@ 0 R  0 A-Hp`Pv@P ?@?LtP@!g@0 (p,`0P408p` P$<-L0$M0 0000 ,0vPݥ@o$Ѝn7@-@P4  t2400CS40'.0*80 000"{4 80R ^"0r|  m???Wh|(T~}e cPa 1x 0e@ @7 _ r CQ .424400 0C 0420_0 0 0_0pN$Y ` a$` W T _T __hQ(!X!L$P  o`Pbbx`G>x 0R_ GQ_!,~$( _ 4404#44 4$404#44m0 0_0_ 0= P bn$xVh|(Tk`P@Ѝp@P 0(@P l] P/0P |Z)@; @@@ P 0 R (0(n?@Ȇ؆;tm00@-MPL 0 0@P 0S@  ]]Ѝ0Lp@-PKP |`@#0P0C\80@:P @`PP@ '0p%Y 0@-M@  0 PU T P0 0Ѝ0 A-@PH H00C `Q8pU@睱PA`V(WV 0@-M@  0 PU T P00Ѝ0P 080 P H P R//H/M-PQp00 1 !华@P%  嫾8#ዸ`P ? ذ0F  0@P ` 8@P卾 \T`PpW 0SSP0S 043/P80 00@Ѝ`VHPLhiA-`QPt ؂P@dpP`P 0P3/P @D0 <0`ق@THP@Lhi@-@h$03/00hi@-$0]03/@hi@-$0@P03/@hiM-`0 MФP?H Rp"  2/@P UQ Z  R Q  P D@ ЍL  @ 04/@hiԇM-@p0P04p8``p0 ;/@P SR 彽@Ѝhi7@-l0P@,0@3/PmU 40PeP Ѝ0$0 0 000hitmL@-@,<0003/@KT0@d@Ѝhitm@-@P0403/@4hi@-PP`p 0` Ѝ0Sd^`@P <S S(Mp Gtm'U8H@-$0m803/@hi@-$0`<03/@hi@-$0@SD03/@hi7@- PW@P @ Ѝ0  PZ&`E-P$M@@P @$Ѝ `ZpPP<0 00p@` /VP!pҼU dqf000 _?, !$_f ]f⌵nH~@- @P fP@- @P eP 啼莈p@-@P@`P Up@D o@-l1|MP0 0000 `,0P@P@T k@|ЍD 4Oa004 (@b)0*0+0,0-0.0/000@P 0L  0F@4 40T@01!wv $xy(,0v uzw x y ${|0(< nψ@-@@Z@-0 00@0$0(0,0Č0Ȍ0̌0\4@8@<@-: ^0(: 0R&#: 0 Č 0Ȍ 0̌0$0(0 , 0 0 0 0 P48<:\03#@-@dM pPl0`D 0@@@@@@@@ 0@ ]@P@ 0@<0#wv $xy0(,e@0S  0嗻t@dЍ0S  0 0 4 8 < ČȌT S:0 0Dqz x0@00 @D 0HL舊U-$M! 0! 0PP$ЍT@-8M@cPP `p 0`MЍ0 $ T :R *`p 0 0`T 2(0c@@ D <0 ꉉM-@<0@M 00 (0e @``400 <"48040 ̠@#Č00S 0 $0(0,048< d @ЍP/&%*P'p()+P, P`PQ @P@P@?,00 0 (`eW`(00 0d pPp@PD$ H 0L T X\ @@??@f??@fPXp 0$  `,( $ 0(@P 0$ [`XX@0 0 0PdPP* E? 0@ d &%04'( 8< B d M-p `<0TaPA?P?@ 0e@P p 0@  R  pPXЍU  R 03 vXpT0  c  ?pPU  00_?SP/_Xދp@-0@P`@a @MDb Hc LP P0H!e0C2TJQ`TBe`#@?@Ѝp0S 0e d P  0@!`V0 @,Q<08 <"4R$% S$& 8S(#<4(040  0P,0!Q"0Q00!#$' 0pV>M-@@a0`PPMTb0Xc0\00X"<PЍd0S 100 5$203(40,4687<w`cP@100`4Pd20h30l50T60X70\P 0lXU0e @V 0S  ⅵPtU3ePP @e Be0 4 8 ̃048<0R*0e @00    $0(,0P e@ H qp`0E0eP0 @뗻"0e @< }HD L0PH1Q2M-PM0`000T0R :S  ,  (,  0 0߷@)Pp0&,x`Pp匀@P !UV"XW40040 2 0 p@P &,P V @Ѝ004 0 004  t&80# 0 0 @Q0P U$R0(S0,T04VW8<PQ "L凷80D;80傷00 "*0$400P00` 0VH0$0@2P00x 0C @` x⮳P 00x00"U 0 x`|0" 0Px {P0P0. "$ 07UX [ PP % P % x "/u u@ u a `04b 8c ,00pW 0S80 xP|0V0 0P1<00<00000 <0 A a00@ P0 2,8PpFU0WP0 0`F0 0b P0 0! Q0P U$R0(S0,T04V8W<PQ "島80X080N ;80媶@0 dQ  0 SP80080 [3]0 @@! x@L PzXx0P 100 5$20(30,404678< "{d 0qX $0 S$ @Q0P U$R0(S0,T0 4VW 8<(P,,0505$045( 5 SQ4꽊T9?oS݋.E-@@RdpMQa `04b 8c <WTG*2e0P0 T$0X(`0\4 8 ̎ ,< pP80 @0pGdP @100 5$203(40, 46 87d,@ <׵DPЍPAM-@@@T`p ڡ"0Q @ a`0 4bc 8<X:@T ~PP u80 08P @0@DS  ePP  u80 4T(T(TS#<0R4B0R8", !C01  QS@?A<08 K 4 p@ 80۰ߍX!W14Y!8Z!L@QJMK$@<{<(,@Q@@[> Sd Q o1 S?KD 0@ 4<@P 1h@@(1#wv $xy0(,0e @@ 80@r겧$RJd `Q Zo1J0a0 [, 0 (  $ @ !0! H+V 08TyOPP 80`5 @W 0KPa@P00ŧ  80$%NF@P1Q0FS%0!*Q&#: @B 0 4 @00 B?$HVUttl<0S 0'LQQ?nDՊڍD "ʼn0~M-2`0,0M `!@P,0S x嶯@ЍD pLP`0,0P0L $$(-P.P/P0P1P2P3P4PF@Pt@LT 厯L0@ a`04bc 8 ѩP@p=Q ]Q XQ S%R'%R"&R Q5":Q0S P15:P0S|p0t 0l; ' R*P@L>P Q 470F _P |PP 0G 0(0F  0 (Q*0 0  Q+|`Qa p* j_BHRfS_M?ɎCl䏊 )Qrΐ-LwA-P`p@@@T@#SRW  `P @M-P@M 0@4 8 `@<00 ` d0Th0l04 8 <0 04 8 <0- ,00T0 00#{z $|(}OQ0P P0e0C⋬tP 04 [8 <(0 04 8 <,0/ .04$0 0$0(0,048< btPt_LT,{zr|0p}W  L pQ  0 >P)(*+ P  0T  p   0$(,A 0( t P$ @Ѝ R: P$@ $0S[00[" [P"4  0 [0$ 0$׫ [0 S R0 80 0 0hP 0 Q : $0 Q *P H⾤@P P 0`00@ 00$0@  %$04&' 8<40@  ! 04"# 8<00@  )(04*+ 8<<0@  04 8<80@00    $0(<(,0@00. /00P4D000@00     $0( 0H- H0L @0@00 P0[0`?`@`8`PPXP `@a `04b 8c <S0@0P _(U T0e0 d `,!$h0QdMR 0 00_`P 3 0!XD Dp@p00x1 00X- p `XFV 0 #{080090:0;0<0=0>0?0@00 p0@vX0@DLP0L0R8?0"<@0L0;80D000H040ދx;<c'DAf#ږ=Bwnb, 0S/P/ 0s00W- 1 ^ !(0S00 00 0$000$0 00$00000000///@-@PD@D@-@D@ *@-@D@Dp@-P@P Q _-00P D00@P D0 00 t0 p@P {D0\ 00 P0 L@PpoD08 00 ,0 pދ555,0P @-h/ދA-pP`A@.TT T <彟P a0DS@@PU_@R0@- 0207400>0020@d00 0@-PM `ᮟ@P0.SpETP@T5 Ѝ@-0h ^ @X P R<y |@T@P@Tpm\XM-M?`pP@> ?0?0F011JР ??R РT !?0?0F011HР?p?p/ b PРР U0  0 P 0 РK!`P@DQ P1`P@D @-\1-  \  P( L\! p@-P@ 000Sp@p@-(M@ jwP P{A AQ 0%S 02~> 0!2>401(Ѝ!8101@-p@`PP p 0 0p07/P U Ѝ@-p@`PP p 0 0p07/P{ U Ѝ@-P@  x0<0 P`d0 6/@e T@  P 0SA P&P0SAЍp8`@-P`K 0SZ  0<0 P@0 4/@9 >T RT T AD Ѝp@0 /P 8@-0P` 0 -  0<0 `@0 4/@ >T RT TA P 0 0 3/@P ЍpA0 {/8p@-0 Ps/@P $0 <0T03/@p8A-p`PW `@P`WЍ0<0 @04/@T0RS )P P尣0 //@ B‘0  @P80@-MpPn%WP@@ A 0S'0mP &AЍ'k`PP@P  `0   0 0`'0kP` A&AŽPV mV00w%Pr@P AMW0@-@< <;WP40( (3WP6&_lX@-  0j ЍuјM-p`M8 V:Q1 A -P0 00S 0S 00S0[ `t -PP0P @P  <0 N:P(UЍ`t֋0E-TMp( 00.@P Ԣ ATЍ䡟0(Pa@0 4/@T0@ 04/@T$03/@TPU H, 8P> ,00S:$1$!00'P &@P/@ '`} W(U(V  0  0 $ 003/@iC(Tw0 03/`r$ 03/[PD&&Ag$ 03/P*(☊Pt֋`naM-@`xM0@00B 00 S 0$ P 0,$0@00 R0 0S0S$ ,@P0"0 0$(/@P 00S A000P 000SUppUSpWpg[0 D UP4 !nPPXP4,P4 ,f(p S$Pp0(LPD0Ppn$ 0d!s040 0T 0P`0S S S0  P?Q0ꝙA-0S ` pQ 0Q@%  Q"  0BUP!m P0100 S 0 S  1 S:00mP 00 S2 S?>P@-0@SP 020C00SЍ0C0 M-p MB 030Qs` @P 0D Q0  S 0@S` Q0   C0R02 0*` R R 0 S 0 `00?o2 PuPS P @00U$` 0 C0R0 0  0PES @DuP a0S ݍP 7@-P P@P=0020C0 Ѝ0p@-P`@P@ pA-P@T0 S2 S0>T:\p`|`P  @M-PMQ  Q 0 !@P`40x00|00400000 Uh UX 0 SS Sc?U?SPU 0 p`P00dV40 0#* R2 R?0[* +0 S" S/  R [' S2 S?> S 0 P`p R2 R?0[* 00V0000@00D0 0o p  Q * 0 RP0 R RQU R" R/.R p0 R4  3`1:0 R4 `  R(   , ( W,  (p5( ,5 R ,  $ $  } !w 嶡R     ##00$`pp& 0ĦpS0`S$0 0p$`1P p 1P0S$0`0H p0p0000X0,0HL`rHL0?80H00#< 8 2# 080圪#"Q PP<0X0`<0p000` he 1P= H 1P2p0 0p0 00  $00 0 (00, `0 `P @0D`8* R2 R?0UL*0@0}HP0UTPЍH⹕<0,4 4 L!P0Xp0`00<008/ S  P R2 R?0S-0 S_ SRS_  0  S00 0 8D`@[,`P `@f0 S &81 0aV1pps'0H00L00%nHH0Q0p20W to y R2 R?0Sw ` PH*p 0[00:0!p PW00 0  0 0 S_ SRS_ 0@SP(  0!p P10 0  0 00  0Spp0U 0p0,0 S2 S 0>S#p` P0 S2 S 0>S 0 p2U2#:SZ0 S0 1 1U?#*TX֙M-M@PɛK? ? @ M F R* R:x嶛? @? SZ0 $0  0| P44$0 $ BR 0( ( Pp`FV 0 c  ?0?0@0M?? 0 | Р20 |Zhl0a` 0 P  0|P (  }U<Rm@- 0 Dx ЍM-hM00 00@<0\;D008008 0 b0D0D 80\0 00 2 0 0<0  T00 00T000<00 S<0000R0S \hЍ 0 0S 0/0<P0 T 32P0 PƓP0H0 0P00T00& 0 32P0P000004000,00(00$0H0 S$0s 40 ,(yP 0 \ <  |P┓@ 02P)@0D H9P0 0$ 0CPC p,0 #P, R0  R^*R1!\0`Se `0Vd0T \?@FP0\  (P\0Pvi``d@\Q R@@^^ 0E0@N@TOD0 CH00CS` 0`0@ S`C0_ 0P00T00 0 32P0%UQ 0@ PPC0 0C`T$0 s 00S08 0000$@V2000$@PC000000@ R0,0A״T``Faᨆ Q:PP| t6@p6 0df\0 ŠR 0  P4r$f0T M8 6 Pa @0\0505 010@o pf" QpGyPp̒PC d5@`5 0T`0 R 05 0VP0.0T 8 5 奒P @0`050Ԅ["ᕒP 4@4 t``p1x R 0 PP@0T 70 004 fP @015030A3S  0BqG0PL0JP \3@X3 0Ld0 R (3 0PD 0T 7 2 #P @0d050̂P!P 2@2 L\儂0 1pR X2 0P\p<0T K70 002 P @0150qZ(֑P !@!1L밁p R ` 0 YP @10150P1TL T 70 00(1 塑P @PaJ40 ,(2Px 8 `V2000,P40(@Vs 40 ,( Pf 00C 0B @ BS Q?ދ5 Ԛ6l5ћ6e5M-tqMD0P0` 0M@P (0S R6Ѝ贁X  00P0 D`F000000 00 c 0 P  P (   `6 0 c0 0ЍMp@-0Q01D 02 a31 A<202! 0 @P5 D` +0RyP`% S?#R!L0S0 0 `0Q 店5 0`0? 010-|A2x![P @p 600gpދ9ʜM-@MP`D H0 喑00M000 4P 厑@ }8 0/S SD0Pg /8\pP0 004@S m8p Cp 0/R 0S PK [R` ~< M0@0 `@00 0pA L`P< @0 $ [ [R+ R㈠ 0L0 80S6 @҉PL0000 4` 00<SI W 0S40D 000H 0R0R00 Pi5<0000 S S  S[5<2[0X*$ K0  ,`K  0 `p "[ R8Tٖ~D!400S0[0S *Ϗ`P `VK 0/S0@_O00K4 K5X7 UP ;R, 0 $0K 00 0 0`Fp $0 04ދ07@-@P0 8P 0 _@P _p Ѝ0ދ@-@00H0 PЍ0P TPPA-PpP`fPC@P P4 PЍP0 _P@ 44PP _'ދ0M-$rM0`0@0 _PPw0S !0R:  P U _  Ѝ- !0R*,000 p 3SE 2!P ; !200 0 p 0,408 uP 3: S0 S9C?o 0210 @H J D$ Fl HB1#01<0 001  ދ0@-`P0Q xp 0_0P@ 0S 0@0 Ѝ )P_rދE-MP@8p<`p \]Ѝ0H0p0`S 40P @0 00p`ދ0H-0 ?0?0@0MP?@x ?@X P 00 K0 HuP 46oP  RiP pm\7AA0M-HM0P0p  !PA 0 4<0D0 @P  0S #PU 40 @`<0DSN0SP0 00G @TtQp 0 00P 0 @P_0000 0.@PB@P 娔`V\Va 3Pg   `\PV00`LS0S> 0` 0*P4 00S0@P04@@~00P +@a;T   UR <@<@D< R:A U`0oP0@A h唐P@2HЍ2 ADAB&A@:@&Gq@t֋WPM-0P<1@P(@Ѝ0 00$ (0Q %  R@ @ p @p,pWO*0SS00  ,0D 3 0Qs0/o"X R,0<1K  0410p  0 GU0 .0`0  0 E00p0` ,1S,! S0,1<1S< ` 0P `VQ ` VQ  Q ` ` [o   9@Pd M-@PpK0`SP \S/S ~PЍP0S /S\S0S  ER R-P0$  $0000000S0SEP <CZ 1 ! P X  ߌP0 0 y~0@-`P4M@>@P zPP Pu1s1o4Ѝ0@@-`p@4M>PP @ ]P @]14Ѝ e@P R1 JP X@P 0 B100@M-HM@@hPW>0P 0 00O %P00G  10P0> 0 P A@HZ2+UP`U `P`@0Z !0`S0 P` 000^ 0@U 0??0 >P0000 0HЍ|P@Hi R" R/.T*0`P 0P0 Q 0PU  S0 h 00 00 000CP@0 S2 S?>T*`[0 0 P0 0 0  0@Z 0 P P0 S2 S?>P*0 `0 000/ 0 PU  0P@y0 S2 S?>Tp*`@A-P`@h]=@P P P }b(PP 5PP@ !000S @-@P@ /~E-MkMjoNOF@D0 ?@p    0@??=P P 01ЄPP P/؍kߍ0ZS 0SP P@A-@p `-P -=Q 00~d z@ v 00 0  0!pA-MjMjoNOF@D0 ?@  pD 0@??<P P 010 PSPЄOPP h/؍jߍ1 S01!80SPPP@p@-(0 0 @ R P pP@@P PU:PuPp@A-@PKoPG\GP@͞GP, 0 /S 0S/0P2 R/   )R R' R JR R DR0%0   JR R 0 DR0 0PR0 mR0/0  $R P\\/0/0 SP P0*///////////// 0(P R/0 S///@-\ 0  힊< Q@- @0  Q 0# 0AS 0AM-@xPU  P0 PP(`pPP 0S 0 (p6p@-0 0QUp Q00 Q0S`pZ@@Tp<0 @0t0@@cR40 80a@00@0pDp@-P@ 0000 00000000pp@-PPaK*N-P 9pFT*ps@-PQ@R 0SO 00`V DV@ VE )V, 0000000 0HV4`0V8&l0`H0PJV V0 000S0(0$9 00000000@0`0 00%0P0 m 0%@0DЍp0 00 JR: #R0K DRt 0P000000 0 0 0S4 00S$0 S(#< 0@PR> mR 0        00 @ 0 mnP0 0S0000000H0@0D     "$   0 @00 000000`0 00   @{      0 00"<05j00LM-`PxM@ OMP, R0u%%% p ,#     \( S$0 ,̠S(#<p   0@xЍ   * \ S0,̠S#< p  00S00(0h0S S  )_*@ )0Y l )0R⽏P R ]M-@PQ0M Q 8A Q QY  ]R- RI RV0 $0(00,00 4 8 < 0 0  0 0 0 4 8 < &  0`4 CRpC`P PEPEW`q 04 8 ,؄P000ЍPR 04 8 <$((,"(Ḅ 0BS0  0400 ᧄ0 4$ 50 0 $ 0 ( 04,8<X僄 `R00  R<<y `R00! oP0 $0Sp3 p#c`Pp \U`$  S 0P$R R# HD0|$SPt<P \70 P4S<0 ,P(N 0  4$< 0  4$_ > `P#s0%00|PU ` 0pXt0G~SP<#0Gu,R(0 0BS0    )0S ТaS0  `,(0 0 $0(0P ,ᢃ,0`(0 $0(00,00 4 8 < 0 0  0 0 0 4 8 < n n 0`4 CRpCc`P \PEPEW`p0A3`Pbs0 $ B~0 ҋP$dhF;\͟ĉHgsFTğ!ϟ6/ޟٟԟ䟊р'.gT3Fx:Z4;@-p @P `0 0 ",Ơ!P *p#6~P  0P ЍǠA- MP6@`T N`P5@ pT Ѝ0 W6P00!@0 pUp ~P 0< N0P000 5@NToRQ00P0S,p@-P0@SM X0> 0PS @`{P Ѝp0000$hP H0L0 H0 L /p@-@@PYP phPPpQPM- q(M P0`SP@`Q @=P`0ShP`dq@d[`P `7 00)ppV`1q3d5+:U-  d$`p ! H L48\1(8.0 SH00H0 PP PH0L 0 H0L p`*R q pPH0 L Q$00@P0 00p$hPH0`L0H00 S L05*(Ѝ@-Pp@PM P# P % 000 ` p>P` ܅ 0 0 0 P &P00 :Ѝ 㟅P s@-@R$ Q /@00 #f0LPsj%V 0 P 044 PP%! "` @00Ѝp ʑd}@-u6@67@-@0 0R S0P ?P [P *P7PU Ѝ0@P ]P@ -P@EOoB UUP ]P P@ ]0P0P  R@$@ U@-T@M0sЍ0 00( ⍉I NP 5a80M $0 000oЍ/86H֋,0M@000oЍ/86M-pPpp@T 0DS` 0 0``00 3/0 S4`46,60S/0S/-l 00CQP 0 0  ^*   0,6p@-@PQ#p46A-P@Ap`Ut ! 0 A-pP@sW !` 0S(0 T0X00 R!3:Q(Lp @ W(@DUD0 000(p$6p@-@P;  IpA-`p0VQ  WPPU Q$0@P&Q   E00 0 0 @0 @@"6@- Q ! , 0 0p@-P`UQ@@V@T A pp@-@P p@A-`HAQV`` ! P4"pP&! p"j,-! 0 PE("P Ѝ P ` P P 0 Q0%0"0%0 `%S3#SQ0C0 ;s0 S:P 00 0S0C 00 `00< 5@-p@-@Px\00Sp 0<  RU00T 0 00tp< 5@-[D0Q 8 Q210! V`Q< @-B(0 R  BK< @-2@ 0S@ $01#0S 5< 5@- 0 (< A-pp`@P W ! 0L Q 0S  , P@!< 5@-@Qlh0@< @-A-@p`QT VW@@ P(/P&A 0,0p 0  A5@-@QTL0 AP P@ 0 @@ 5@-Q !1$ P 0 @-@უ @-|Q0 40SAo@-@h`htp@-@\@?PPhPPPP`h^pp@-@PE  Spp@-@P:  Hpp@-@0P R!D@<ps@-@P`"P0S 0!`0`0 H`LP'Ѝpuv P!`P@-Q ! X0 >! p@-@(MT ! P jYRP !(Ѝp`P P! 000000 000000$0S0000>;U0 000000 @-p@-@T Q @0PURQ9 DP D0! P 0\ EQP A-p @P`P   xqPWPPU: /M-P@p P P P R0 S R: 0Q ` Z V4 X 0`S *T  P`U T|` 0 000T P``VP`:66s@-`@P0 00 ЍpA-(P@ U S 00  000 0`pP  P 0 0 0tP 0#10Ѝs@-`@P}0 00 ЍpA-@`PMP$ U GP  0P:pQЍ0S  0S @0 @@ p@-@P`>0  KpE-`@1V Q)  PP$@p R 0T@0  |P  P0 S@0S @DŒ0W Ѝ@-@ P 08 00S P Ѝ@Ѝ`A-@P0RP0`(pPW0 ` xp 0 V00S0S 0SP  `(M-`PP  ps:P$ @P%  00 0 0夀 @PP0@PU  oP  0P 00&`  000<P6A-@Ppc@T@U@Q@T !@`T @P&! W@  [M-p`P@ TU`V  oP 0S@0P PP@&aV  noP 0S ZT `@D Q`Tl   ^ QR !@0M-M PP p Q @P W`  @P 0S7Ѝ0S RV@  @P` &QW`00 S/ Z 0S   @000 00PU:Z* 0VS 0 `6/|Q&0 W Q UPQ `0p0 ;/UQ Q@ QM-`R@p Pa U 000 S  R% >P \ UR0 / 0Z!\1xP%& 0 ZS  R   Q 0 R R R0 0 0 0@0P 0U00A-P`p(,@QU ?oT20S !ЍT T TTT P :P! T 0TP PU 0 @R 0@-P1LM0@ 0uP LЍ00 R000S j0 0 PwQ0 P @ 00$-PP 000ep0  s T0\@ 00k0(03/Qc<0 x@04/H@80@-PM?@P M0000 Q0Q0S S :Ѝ0 80S 1803/Q @A-@p 000 0P !`V0S S a Ѝ00SU 0S 0SpWX00 0  <P 0 0$`PPUP2 SPU  巰o@0@- 00 Ѝt֋A-Pp0 0|@T ` 03/@T 03/@0  ЍM-MP^0P A0' 0 0`0|@nT [:A=TU 0S:AVp0F"p0Z!:2W [&@cЍ P    0 0Pp Z: R Q  |Pp X p W 0 1 0 Q @pM-` Pp@P0S :AЍ @P 0 0j>A BRQ @@0Q00 P0P @P 0V 0 @@9W 0RA-`@Pp QXo 0PPpQ 0R>QiPꯡp@-hPl@tp@s@-@P 000S US ЍpT 0S 0'S h`lPPO ۉp@-@Pj0 U wp@-`PM! @P  Q p 0W0@P@P 0PE    U0 =U Ѝ-@- ЍЍ/-@-) 6 ЍЍ/A-@Pp 0`@P  ]@P 07@-@"P 0 PL0 R , Ѝ0@<0  Ѝ0@ Ѝ0`M-pMP@ 0aP 4aP+ Psz d 0  00qaP+`V6 0 S`0#`V X 0 S0| 0TaP hOaP\300T3 0$@aP W hPhPPU&QЍXz  (` $ b2 (00 ,3 $? CAPP X10S 8`W h `+Rh PP EnHh1    [$ :h S  O!`_8`P (`Py $# 0$@S@ 0@@T"0 P {`Pa00(0 =P P QfUQ pP\  0 PO PP$ Ha䡊(nn顊8oo R4;4o忉E-@Ȁ(0p SP` 0T?Z M: R<0 Z: P5R @P@0@80 0(0P ЍE Ѝnn0@- @T Q 0 S@PЍ ~QaPCP Ѝ@U&M-@ MPQT`` A\ ЍPP R0 00@6T`p0SV0:A000| P0 Z0#03V0#S  hiPX  `p`p@-10S !Q<0SA` p`V P  xDiP `1` 0"PS:V P:  ,/iP5 1 !1001401801L0兂0 S!@zz7 0@00000rB| @$@(@,@0@4@<@hruP 0`P 0 8646 `@-P`}VU  ЍQ @0 p@T 00}:T 0S -P @  h0PP  00  P000T66A-pP A `P@T  hP  ;$Q  00SRAVЍ* 0@TP`0`F     `-@- ЍЍ/M- MPp@`H@P& W 0S*P    P0pq0rs0S Si0uvwt0 FP X0t0uvw h00CP00T0L000x01 0p0010  1h @PV>0S; p1V$0h1(0d1,0`100 0<00=080 >080 0D0D SH @V 1 W q R L  `   Ѝth0Tp0CP00P00S  h P `00P`Hl P t&r,`ՅӅ 5hi9E-@M 000S ЍT  0'S 0S\k0000 P R $!kP$P9P4@<@D<0S00SP`` @PV`Tp p P0Sh00 0P`P <@$`7-@-m  ЍЍ/ 0@-LM`0p    `0݀@P  !(LP (ⲌPP@LЍ P @Wa V@p 0S0S  fPO@0 4`F@@&G0s@-@000 PP Mj A`PU P&  fP!\F0<0D03/-Ѝp: @!T H$jQ 8jP ^вW8uM-MpP g `@ T, W P @ P  0R0 \0P  0DU 0 V: +fPU ЍV Z*0006`p@-0@ P`Pp0p@ M- M @PP Ѝ}` PuU ` bP0 R 03/QT 0S 0S`pT@0S0S piz 03/cP0TUPEP  ※g` 03/PKU@V 03/?00M-@P0M@ @ po D`P3vPP7 $@P#o$  @"&*(0;P&A%(p0 $,3/@ T $ 0 #6 *U 0p$00 03/0Ѝ \PQ W :A 8P,10 P0$ 00 @$04/@T ?$PP 0%VZ (0P&A(,0 @0$04/@T  D 0 0T(0 0$0000 t֋M-0M0P@ T0Sb 00_ gP[ 00SW 0S0$0 P0$ ;`P 0Ѝp( ,iT0@p,@(`PP 4PP00^:04T`0   G@P  pP \P P T0?R<:ha&,5hj `P0S} T0`0T 0$00M:Q0<0R:pP5Q0S Q00(`JR #0 % ! *Dg P( B[1R 2QL0005 2000 80X@Pg&a(00(0000!000N/ 0VB T   Y??㲊މ0 @(,000S0jaS ?P  0"&0$*jVVt10 00 1Q400>5 2000 80@P (00(0000l pR R0a0 00`F0(J@P 0  RP pRȠ"&p R .( @        \:g/0 0"&* a8P@㢊 \4;90E-CM`0p P00 @P0 PPP 0 Z@Cߍ@`A-PM@`UQ00V0Sw?o2X0Spp )cP2hp/`Pph0) S5Y:DP P0SC *0  ᦸ00 !P0P@S0 00@* Ѝ bP"@0Q +P0)S*0 * y* 0 0 0 !!2+! 8bP!Xā00! ! 0<|`@-P\@T P  TbP wU U <@0 8A-|@`pP 0F0C P P  R bP 0㓅#PU @ M-pP8M 8Ѝ0QS PX 0[0R0S0S u0S  0S 2{@0@ U[``P \ R  R"P`[ `!!X0 0 0``{PT 3sT `V0  0C0 Bxz@  B| @P@eT0Pp0 `0X0H  00康 00$0峷0  {:P P 0p 0H,000,0 {P00,000 00P`> pPE  E`|P:PL 0S<Te002 0PmP#SRV@R$0P V$0PY T ##H 0 RX  0@ zPG &V  "! V:( UbEfiVaƣHs@-@P`T !000 00 Ѝpp@-@P _p@M-Ha@Dp P@ UT:6 U&3 D0T$0@ PT($L @@P aP&T T4@0T8$L0@P|gz@T P  `PЍP Kᑥ!_@00C@0P@8@-@T !  A-M gXP Pod:AЍKkP NP `dAQu0a P Qd 0 ?@ 4OJ@0$F0J <1@\`Pv 4:d08d&AJHP 'L't|2/@M @P 00 P,@P .pdx .ph`c,@P Lcdmmm磊4bt֋ pɤ@-pMP` @ŵ0WVU AЍ0DS P 0 03?0:1S01QA3105:vP @c @ @P ch$ɤM-<38M@T+o8ЍMTbPb,pcP,0SZ P`@P{cU#OV1T2  " R  R R  R  R R   `@P2   0`50PN0 g@P0 R(.w 0 0!A@P@P2 -c&A1@8Ѝ=@@P,0[S 0@0`6PP,0;S@T801PRS 00C S!2#1T4`0@65P(0  0 `פP#RbSR0 0 tt0RP P HzZ0 0 @b8UbEfiVa$褊5< `UbEfiVa+9PGfGzGGGGG|8$t֋$54;Y@G`ѥ 譅Dlԯdx\Ѕ хX҅L@Ć̆Ԇ܆䆅솅HpDh(+ -; y0 0"0P$0! d^P 0 0S  $ wP !00 0 xP Cb0 00P 0S0P)0*0,0000*00!04+P@P{+0@0!0\@Pq@0!0xp@Ph@0!T`@P_)0@0!0@P@PR@0!P,@@P\0 @@`+xP@ 0#0!0 0H`@P\#3@hh#hs$ 0p#pS 0(0, 004 Q P@P @&QЍɎ PP( @FP @Q hWhppH @P  hz OsP@)PhPhh@P0S @PP  0RPQ H 0BS/$0@-A0`Q!V(P8@, ` pFW0`  B,H S$0S1# C  0M-P,4`@\rP 0 *QF*4Š SU*0sM@ pP$pP(@peW H$V\Q*Q#* Ġ4S"1L 0C P\3#Q3\$`8PV#pF(5`\`p\*Q* Ġ4S"1P!P1L 0C ^ @`P 0Ca*Q*4Sc*p3m`^*Q*4Š S*bP\*Q*` Ġ4eS"1L 0C X:W N^'`䠑펒Q\p*Q*P Ġ4U`S`"1L 0C ?V@F^} ^P|`nPE`A`\q*Q* Ġ4`S1L 0C `"PU_@ P0`0C*Qm*4S*p^*Q`*4S*P3#Q3PN0CSm p`s@P``0C*QB*4S:@P0C*Q4*4S0C @ N^ 0C*Q$*4Š SR03_2S:[ 0C NPMPE\*Q* Ġ4 CN PU0C2MP@u P 0S P00///0 S@/M-9 0  0P 0#0 0#0 0M (< H  % . n (  % , ǎ @ # @ " @b%@`XH@@ 0.00#0@<@`0H@@, .@n@`H@ @" ,Gǎ@@ #  " @b%@`G@@ 0.00#0$@< @ `G@@, .(@n$@)KDO@D @" ,,@ǎ(@(`HG@@ #  "0` ,Gb%@@ 0.00#04@<,@,pG@@, .8pFn@ @" ,<@ǎ #  " b%0,0 0#0=" !(h # ,LlɁ !  " ,b&0,0 0#$0 =" ! # ,lɁ !  "  b&0,0 0#0=" ! t # ,TlɁ !  ", 4b&0,0 0#0=" ! #.ട n  !  " ༴b& !, 4l΂00. !(400 ".l4n0 0,0#0P$4 !,4$l΃  . !$  # "$ b(0,.,30 0!,3lΎ00" 0# 0: .!#a  ,. x#  # " `ßb. 0!,H3ʂ00. !,3a0 0"0#04   " b- ,l˂ !p00 0#05   " ` b- ,$``l˂ !`@00 0#`0 5   " b- ,@l˂ !,@00 0#@05   "(@ b- ,hl˂ ! @H0 .000050000 0 0 00ЍxjVνp $|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆA- M@P D P0`' q0 P00 03/`VP ڪ  000 00 U$ U( X$ X( P %\(, ` 0P0000 D0CRs000S$X Ѝ 0@8+W]A-@p`P ᛪ 00 0PUT0P@0 @@00 00p@-`P@ Ⴊ000@TD0@000p@-@Pl0MpyUT@@ A W  0SA }Ѝ  厪E-Oo`P(pY1BZ@V@T @ Q(X) \ 03/E#0S0SUD10S @ W  D 0HL@D 0T L@2 ЍQs@P fPX:QPPW0 R*Q00 3/P00Q{7@-LPP @808 80@00@(P@ Ѝ0@E` M-`HM(< 00$0,000S 00C( BR 0(0 0400<08p0@0@ 0D00 8  3 ( P  D0"@ 0 $  @00,0000 S0 S0 e0 ,0X041!T15Stb s  D[ 8 K@8`\  ! R&R B B  S441T1P ;l ŒL00CPER    0< SRA[# K R   @ ̠ ㈀  ,S4441T1P ;n 004R,0CPEN H"BPE0X! 41 T1%R 1;`2 140  003=0 pR$1墅4T1X_+a" , 20 X41T1qP l ŒLHPER:A0$00 S$0S'-$- X104T1Q;`00PE@HQ41T1PlPEŒAL00P41T1Q lPEŒ@L00Q41T1PlPEŒAL00P41T1Q lPE@0ŒL0Q14T1X0`@0 @ CPEAR# R0b!0C#, #p,X41 T1Pn⎀N HPE0S p0pS00S-0S 000$0 0 S# CQ![#0K0 B$  P D: 0C Q@HPE   HЍX 401 T1%R7;`2 0,0R$11碅4T1X+c"[! #0K00 00000S 0 002C10pp BPE0S 004 0S=0 pH@ XPE` 41T1%R;a20HAXPE0 41T1%R a 0 0A0 PE H BRA$1PEࢅ4T1X+a" , 2?A;PE0B%0CX 41T1PE/0S PX"1042͊T1P;a00PEAH P41T1Q nPEq@0⎀N0 Q1p4T1X`PE@A00 X411T1Pc 2CrHPE0$0p>0$00 0C0 000 0400X04 T1$01H00(,00<0 0@@00D00 P40 0$S008p$0(H S*0<S*1R 1RH0 0p00 04000\0Pu, l0R3?  2/R 2/R /4R$ R s/// /03?*03?0CQ//03?'S<Ͽ Q 0 3?R  12/P//@-pA-PQp `p @X @ GnN0  GP@ _N@pM-@S`M 0S@XЍM  -P PQp[ FPFP r  W  0S ЍZPp 0S  P + PNPU 0XN ՑNP\9͟A-@P` pӥ00`0Vd` 000 0|pP 0  0p0 000000 000 0 0 0 000 0000+-jM-@P` ᆥ0p0V40 0` 000p30 -0 '0 !0 h0 X p0` `Vd 0 `0000诨ƀĨΨA-@Pp` 80 00`Vd ` 0<00 0 0 0 00000诨A-@Pp`4 00200`0Vd`& 000`0( l``0* T0000000`Y0000ߨM-8PpV@` Ϥ0000p0Wtp  00 0| 0 v 0 p V0 h ▐0 00d\0 TV 0000  Idƀ@-@P0@`P A PP&R:AX T@ T:A000 00o@Px  00l00 0\ t@P PeRЍpl 03/U{E` P#M-M@ P20 `Ra AR1S 0sP\4v 0T4$00 VPPEUpPT>^($ 2/Q/0A-0 P`P 0p 700G@S0 p @P 0S DP @@@ P  02/3? R@S@@-0Q Ѝ P@-0Q Ѝ Pp@-@`PPUp0U3?`03?0p7@-P@ P P@T @ Ѝ0P @0s@-Q`P0P@@ fP P PU000ЍpU 00CS0@@T@Ut@0@- 0P0S Ѝ0@-@0 P0SSЍp@-@P`0P5 2/ S0CQ U1Q 1UA0 :0QUe 0QS0!0S0  \Q VAp 0V0p /A-`pP@PP 0 3?2/ 0 3?2/ @- @0P  0  p@-`@P0P0P03?@0@3?S@/rIP @U FIp 0U@0@-@P@@-@P@A- pP`@P X  1IPV00Ѝ03?S P 03?S M-M05 P:@P`0H@00 T?0S7 0p PE /R0CWW00G`W wP  0[ 0/ P 0` T pW  UPE Ѝ @t t  A-pP@`Pt Ѝ0SQV0S q0Q?0Sqq 7@- 0@P P  Ѝ0 R0 B Ѝ0@P `P (0$0P////4[:Pp@-@PpP5?S $ 2/PU40p p p0@A  S " /A-@P4/P0@2S$P P i4/0@?S?0`0fV4/0@?S3?}4/0@?S?`PP/ R P/007;@ S:6;@ S/!0S  7+C BPRS08/7@-P@00SU Ѝ0P p@PEP P@P@@P00A0@S /0 R/R/<6P00a0@S @/0 R/R/<6@- "<0R80R4 r J Ѝk0 @- \ 0sC@p@0s@-P@`T ZTPЍpV 00.STT @0S@`V5P/s@-@`APT 3TpT @0S@VЍp0@- R; R30P\/0 R 0P S   ^ T P E 0  0\0 0\ 0S00P  0 R  00@ \ PP  T 0000 ^@@0\  0@@\P@9S  0 0P S   ^  P} z\  0R0 0D 0-(0LR0 4#00p A@-@  ~ЍM-@bMB0@ PČ TȌ ̌ $P0(<00@000 8000@@@Q0 p`$0P!`P` !@DPO/,! "@$ϟp' 0#'#<4q`qP`@$ "$XX"((\   \ `   H! XP0# /0?p 0 0(p ,0  `$O ,`L_! @$ϟP%  p'0#'#<4 q $q`     nP% @$%(($HP (T P N T  $ P!$ 0# ᣿0? 8000p 40 P( ,.PT%! .@`p'0#'̠Č#<40q 4qP (  , ( ]., !.((!H (L H \@L ,`0# /0?@ D0 08 <0 8!+h;ʄgrn<+kAك:Oy!~[6_\0t0P`0,x0%D0 H0`\0.t0+0&#< 4p tP $ *$*X X  `(0#ό0?\ X(\  @ P%p $!*! x | ( ( P% ȠȌ%Xt <t`@<+@T@!x pP$ p L@,!`p. "'\T",$8q$0 @eX  .@PEP0?[ C ?0% Hv.@5P@  0l.@K 0#EgܺvT2M- 0`M4 8 <3? 004 8 <3? 004 8 <3o 04 8 <3 04 8 <3? $004 8 <30 4 8 <3 04 8 <3! 04" 8# <3?% <0$04& 8' <3?) ,0(04* 8+ <3?- 80,04. 8/ <3?1 400042 83 <3?00405 46 87 <3?9 0804: 8; <3?= 0<04> 8? <3? 00@0 00000D00D \00@#0!?\  -  `!"@l  "D$P @-`A`$`.a$ b! a" @ @a,nQ"P@͌aA`P%PnA  @nA$]@l  n!!Me!?(,2/   H  T  X  @ @ HL H P $ \ @ \%a#"," PL!@P! X a a T  L@ P "  "| h!! T ``!`! @ @ " L "ϟ  Šf,, H@pƠa,@a,@@.( @ .%g#"," P@& l!"P Pl+" h^ &P.PPd..P b  b ^'PPe(nc&l&PP``! ` ``! mP$P`P%``UhS%\%`pVaQ% a[%$ Pl͟P `.`E`&gC$L$  `F eA$  eK$(@- @(  ,  Šf,, d. d. ,,'  ,  Š`,, Ơn, n,0l,& p%(a#","pp & l!" l+" P 4| ppe(ec&l&ppf ba& bk&`@`8{!pp(d ppf  f m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPn,0pc93#1#p04p0yx'+u'000p&0p0%p'a#","00 p& l!"ppl+" P 0pc93#1#p08p0yx'*u'00P1p 0p`5p'e3#<#``p6 b1#ppb;#0@0`pfic&a&p`13?01? 7R3?8 bx b0  00000#40000000 0#40 00001 00#4 00 00 01 00#400000100#4000 Ѝ0A-P0@`M00p0p 0h00d00`00\00T:`Ѝ`GV`U  f@C#EgܺvT2M-0P?p000%@g0"0%0W0Z0S`@ ( s@@D@p `$  ? ?@(Mos@Z7@-@P >13?01? 7R3?8 bx b<0  00000#40000000 0#40 00001 00#4 00 00 01 00#400000100#400000100#4000#0020 0#40 00'0020$0#40$00 Ѝ0h6A-P0@`phM`|`|p0at`tp0alpl`bpT: hЍ`GV`U   I@g jgrn<:ORQh[كM-PXML( @T% 0S0S08` S 00 000

>00&b$ 00Rl>5PE2:  30 0 0 P4 0W 0pGePUv0S` > 0SV$ 0   TeE7P0`0U 0S`0   TT`37P0`0U 0S v  0&$ 0   Te7P0`00; U 0@`S`0   Te7P`000 ' @0W1!Z R P  A R R 0 B0 ! q0   6@0 pG 0C @0S+0@0000;` W" K00 0S P 0@ R02@0505070S W0   60 pGS > 0 0 0p0(08`Sl0L00T0/>0T00 l0p0P0 60h000`d00h0 8 P6cPE0 h0h R/*TL 0SWz 0pGePP P{Pl6c0EaPCXWb pGePPR6cPEF40000S9 S>l0L0 0T0l00/T00pl0` 0P04ol0`P00X0X00l0d v0P0@4^00l1 WR8T0L0S W 0pGeP0&aPE R@ph0|  0h W pGePW pGePP6c0E cPC0 0 0p08`%RH.FfyHQӫ S=o `F \4p^ *p`CP\P0 C> \$* P4P PNQp`CP\P 0S0!%* 0 A0 PN`p Sp 0 P^ *p`CP\PUCUACUCQP0Q0 PQP00 CPAU `80PpP`tPpP8PPU8P P`SUP&dpPPU`0@, dP@(  FBP P   0 ^W]  pGeP6cPEP6bPE@? @<3~0H000H0S00X0P0S W5 0pGePW.  pGePS@  @ 6cPEP   0 ^W  pGeP6cPE@X46bPE40DH0H0S SED  D 6cPE ,00 0CD R400 0S  D0 BS @0B  00 C\N(05 B000000 R !40 P 1A@AS@0S00 00C 0000W  pGeP 0S @ 0  B  0S000S 0S=000W 0pGePU0  C0R00000 0C00S 240 S06?R 6000 00IP 0`0WX 0pGePU0S7P`( R$0#0( 00,0p0 `CV::Al000(0,0P00 PC0`B          RV  0C0 S7 140 0C?o R 233< `0,0L0S10 0S000BZ! pG l `V p 4l0`00( 0S000,0R,iR@- BlG Q0  A A@ $@(,  R/o "  b   Q  Q( $  R  /oa "!bE-p`$M@ P@ 8l  xp0 X 0R0 S$Ѝ Q 0 S: S Q/-CPC 0CA0 0 <0/-0 b0 32 000M- SpM#@     pC 0"10"1 0`"1 pG \0 pGk 0pGRS!^P*|@ \;xpu @ H4xpn @ 4-xpg  'xpa0 00CS p@ 0 0CZ # 2R`p@H p` 0 VX@@0W@T 0\PX 0 HPX 0 4PX 0  P Xd h0<R%`@ @DOoBRL0@ 0C?o02Q8   B/o"P00$ 0# R0SpЍ  \0A FH= H49 G 5 D\1 FH- H4) G %D\H4   0w-00 c 0< @-@ j jЍA-`p @R00S@P  @jWPV@P @W Pp@-RP@"0a00000T01 j00C0000000p jA-S  `VЍ00XP@ @ @DVp0 U:@E0 pp0V  A-@~00R0S@P U00 pEW 3 #~ R `G `@ U00MM-, 4p0 ARE3D:< @ L\*ЍMЍ/ `A@8 0 0 PD <0 0D S*H00D S:L0PJL C0R:  pG@ P0 00fMM-8`ApQH 6: @0D00CS*pЍMЍ/PQ1%:<@x@0 PD 0D S*L00D S:P0PJP C0R:  `F@ P0 00 &EpMM-0M\P` P0X@   D`,  0R  0 A^ 3Rp$ ' A R#:Z 0 J0$@0d00DS/*h00DS`3:d 0DpCl0l 0R,: dl00h00d0 0`00X00 !`0ЍMЍ/g Kd0 @$@P,0X0  ,$U0 E,$]p@-`P@>@&@pM-@ M  0厱 $(0 ( a0  p1 尰 P 0 Q 0P Q  RD 0 0cS0!`AVV P0040,0000,PS  0S0S 0 0$P ЍlP?oQ2 Q0Z01,P,0PZP!,0,PPCUPP0 4 M- M@`@Vp 0 00h0 0 0xpV3 Ѝ 00 Xh0 $0( PU+0   `PAU.0Ac@E@@T5@2:@K@T@D@T`0CP0@S @S[_oP%   U XS \!PF:` T  >  !2//o Rグ > ` X`0 \V AR:`   > Z 3 J0l,0"` 2A2 $$(,22& Bl,`  B l,` S [/b V 0`K@YWM-I`MPP @  @ !Ѝ:* B#%]+/%\`E PgV! 04 8 <@(0S 04 8 < s 00V003*G00000 cy@0 xp0P  FR0 40S S, 1R: B\ B 0S R0@0000xs0d00H0d0800Z\eL0Vpp00W S^80d @CxtpuW0 04 8 <&0S00SG0pt0x0| w@00pW:xw80C00L0@T0T0$04tJ*4444(5550 4,g00t0; 00h0:00l0 ;(0 0H D080SR444V 00S xpp0 0S; 0 |00xpP:%R<eV9 %R6 TP:AaV 0S 048<S 04 8<SU 0V ZP ^054e505:$R R$R `Q% :d%H 80@0P00 00 00 0C0080 ,0Z00S 00 qڠZT0 ZPpp d%P 0f? ).> * 0u *? +P Vf40<0004 0CSp0P:Z Z~RJ*R, P00C00; 00` x00 R@  R R#! 0 Q1#RD RAD0 DH$B<4p*%R 4 R S1$S(,"r S 0#WpR',WQ\ EpPh gY0Wp")0"+%0WpWz4`Qv:0Q#Q:0@@T#, ʋQ W襌@ @ Q<@Q3 S0  u@9W,uA쀈  ֵ'`O'=y5zNa(vSP*M )70⬊<R S  RDc=O'w녱y7S <0j< D0X Hxp@X RvG@5Su (Are(G R5 055 0C5xt:%xuh% %@0SD0 0<0@400S@0Z < 0`V@ RRp,Vo@ P@BG` $rx   3 # Q P0 ,hExppW,00@0d5S ,0S 5P0 %50 SQN %tu<00 ,eP50P5<04 @p00C00T0S@0,0D000B EWE@ R@| <0j< D0X Gxp@qX RmD000B * @D$B, 0T0R0P03S0(@ \",0  :4`% \襃#*\S:<0Z (Dd(<0Fu d:%xEh%RT ,0@(D u  < xE h%: R RA 0 D40HS$B  D$B, 0T0R0S~T 0 R1#Pv:< 0 p(@ Q ,00 *5 ulT` ,0@(D:d(d:%xEh%`< 4VVg0X;:` dlpX4:0X0j<0$0 `\05X 05 05t05p06"# 00H0 00#09xp\ `$ 5p05X 0P6l0X6p0`6R" 00H0000t9xp\ `$ 5p05X 06H0606h 0 0R!040Z9xpm0pCxw wL0SGpX `F0dE, P00C4 S:,0SR Ip4 <,c4pP0, 0CS:RW|  ,qcvP u<00 `,c15042535'5565u75 0#00,?0Lc#05985=e4:8;<<>e?en.b0`0?0c&1`5A@5e4BEe8Cx(. " |.s *" /  Ϡᓬ,#ฎp  "   Dp a Ϡ ` Æ , " "À<`P`&"<` o`/ "c,  "R%Ã00X \ 4_小0,`Q7*, Au 1uA\0A34,P:4XR@Ÿ ́!,!;4" " 0 0br܁<1D 0   !  !=2"!,0H 0P! !5:*!.0, Q "# 0 ">## 0 "048<S00@0C00@08 pCxw1H00CH0@080p)pp00SGp py7=O'y7gVgV/'cp@-@0 1P`PPpp@-@0 1P`qPPpE-P` 0DMSQp  @  @ @Dp @P@@e@ @P@@e@@R"@DЍT0$00(000003@P i0 PP 0C0PP 0S   Q R ,K@HHM((>a 01# 0 BR /      M-L  `P@C00pW* p `R`1ppP0P `U`f `f0P`@TЍpppGRZPUP@ `p@-@ BPTp`   BQV    Rp 2S0 " 2/2S0 " 2/ឭ0 tP/mPSP dP 0P//D n0@S 0 / / / / / /p@-P` Rp^"@@DT@ x   `  PPp@   R R R*\ Wp@-P2 E0CS 0@ 20p轭 @0S0/ 0 S00\0S / 00 -ddQ S0#$R0#R>2 -0A?o2 0D00W! 0@-QRQD0!6!Ơ! 5a0Q001c00000 03a 1001cQ00000M-p P@` Q`*M`` !bRR&8`""f &"e&b0  L!  e&b0  L `#bf! b0`00 L`L  L#GGŧM-`M`倠V Z `pP@ / S& r0Q-p@D) Z` JZ A ar <2! + 3,31+p@Dp p@DQ Z@D@D 0000P0@D: W Up5P R U0 3 5 ZPX PX  E R 0 Q ZDq @d @P@0  6 @R5 QZDq @d @P@ R5 U 5P0CP0 0SZ0@s0  Q Z Dr@`ЍR7 B5R5 ,00D  p9P0@W@/ /Wp@-00S0h 0s0xS  R @P`P@:Q`pR %W-\ @-`@- @0\ 0s0kS mS gS00iQ00 BR00W/ 0 /Xۋ @-$0/8o @-0/o @- 0/o @-0/4oP$0/A-@T`$`0P>3  @T  ЍM RP52> ` !B!b6; 00P 0UP5RX0W U ;A?o \20 S PE 40 0@S P,U  @-@P xt0S?\ X T00S80D 0@0<0<0噑 00 Ѝ|ԭĮxрtaXۋ@-xQ ЍP0 0R  #6 *00P +nˮ0@-`0P0p L*p @ 42P0  Ѝ@@ Ѝn@-0@xPp`0 0 p 00 E0 0CRQ  Ѝ@ ЍnM-0@ pPᲁ  0` A\ - TR 0M |@TN3#RZ  T  R00C0 0 N0D00pnnM-Da M0 0P0 0㶠 pz'0a  0Z2 0U [   00C@b@0T0T03S J pG[00# S@e @e00 00zp 0dP  0P Ѝ0@ 00@U@DnnM-P@ (M`Cp0S(Ѝ 000S  0 -( 0  d$` @[  oj(0 140(0([箊$8~M-p@M8`<PQ} \#0AS0 0 0 0@0PP 0 0 00 0@P00@UX0 P  JRP0 PH0PP@P 0 @PP00@ 0 ` 0 ` 0 @PP 0 `y00@ 0 @PP 0 `0 S |  PЍ0 S L 00@n0 S  0 S0 S 0  @PyP U  0 PPP~P_oR@dP PE_oR[ 0 001@2[ 0 0!00C0 ##W1M-P`0@p0 00 PЍ00 P M-P`p0@0 00  P 00 P ЍE-`p@PM UP Ѝ0  PPM-@`DrDT(Q(QPX Q QP@30AS 0 Q0 CQ2QQP  қP\ k: |N l `U 0 DDx 8N0(! 0?U@0 g? N0 谟0SU 0 S qN0 0  0  |0[p YNX2}P{]nԯoo0oIS|o0 l,Ѝp@6ЍpcScPQ/@-  @9M-@PpPp$P000 0 P0l `P  $`M)v0T00  PGZZHH&@-PP 0@@$0`  !L 0P 0SD !L 0P 0S90<00SFq H$ 0     ;  0 0 0 0 0  P q m j MV8 Ѝ M0 0 0 0 0 0 3/Ppp 0 0 0 0 0 H*$59b3bˊYuC0@-0'P 4#)P0S ЍQzw@-@PM`$`LPP T0 ! PЍ L1PPP,00!0 0!4 0 (@8 tL dL0 LA00PLP@T%PT00  P pU0 ptP uP P,0S 00S P᫞P `X0P @0H0 @ R@HHఊ-Y2`Wlr qr^ q@PlB0\K0"0 00 "0r S <11001 00R0001001嬁 1`F 1@1 00C2#! P'*V 'E|1 Z 1 0V *40CS0R4咜,(卜M0 P 僜停 0 @0 Rt 0 00 /r 0?s00CSQxMb66x`6އ66tӳ᳊IXۋ,@-2P /H0@-P/ 00S 00S  Pp P xsp00S:`PPT HD/ o=8o$ٴ4oo`P@-@$@0S D0 0<003/P0000A-XP`Vpp0P $@T  R 0<003/p`00@- 0 Xۋ0P D/$0@o//-<^ /%(-<^ /%(M-`LXMP,0P L 0@P 0  @P @$PD LC0ἀ0p0p yP @T@TXЍh @ƽP Ӿ ERPPp$paP0 %jE-pP0` `@<P3 0P/ GPP- H 00 0 0 0 0 0<0 0S  3/0S   ЍE/T  ~C H!P Ѝ@-P PM-鼣C0pS0000P 0P zp3l0PdS pQ*D!?080P0c `Q00弅 R0ᰀ020B02آ[ :P 2St .00Wt2`"xt0S h2 R 00# H Ɏ8 ĎW   2 B a2r  2 Z000!0!0!0!01 1 1!@ 1! E 1 1@D 11@1 1 @pB,t1 ЍMP  <"<0R80,R4r U a.  ct10\006 66'Y6m4oo8oF!ooMlxss{|6އ6ϵ䵊tŶ@-t/@l/P `PP T@(J%PT#ѶSp@-@b/P PpPpTdP 0@S )v0S $0 p0SѶSA-`0S@001/@./P f0T0P0S PP @IPP`@00@@pP Q@P @4U#ѶSQ 0"S B R00Q00S 0"SS00/0M-@PP@.PD T82`* ,#/((2b2%@HA+P0!@0`P! "#/$ R$% ( PcA , P^A 0 PYA 4 PTA0\q 8NA H0  B0S  04 8 <3?0h00p0PS00 00C젊  AC D0+|0|_0p 0l0 00 ЍMu)۶H춊 $ۋ Mb$op@-0 00Sgp@+|@| 0 0R 0 X0BPdA803B`(p@(  MbPM- dĄ0P 04 0$0$0 4 ,0 S$ L4PpD 0S p-Pp\-P =P O@P0Ѝ/H+ 00+P P 0@00#033U0 C 0S #00@S s001S0lӗ0000P3(WpP PP,P@㿗 3 # 3 00n 3 똲aB 2 +0@"@0p0 K"0?0S40L P2pp 2P +1BRpW  P !1R0!01,v!1R0!01 1?0!01 0l9<\q0S 10@`10P0p3/0S*0S S SA 0"@m R z,0, U 8@PPsW0?@0IXۋ(ۋ o#o>4?j8oX$ۋ0ۋ8ۋDyhyۋ0y4ۋ@ۋDۋ>ۋr&`^M- M@`VPPCSPDQPU0@S0S0S 0 0??<400$S Ѝ P 0-> 0 V -%? 0 㓠#   @CP 0 R- ? X?h3 R0 R 5RM0SP >0S  > 3>20 l@P 20S+0S ! >002  |2| ^,P l2 P X H2 uR 0 0 ЍM7 ЍM  Pa0  0>0SX q R RR R 㸱FP P1 PK 㖋41P E``pql@%5>+P0@000P1 3:?$0S4%04P> 8L>   D> @> 0 B`D0C `H&LcSc4osoa8o Xۋȷ淊$$ۋMb@-P!T0   @ R  //A-;P@ ~PP` P@` p9T /T UP;T͛@0@DF&M-0M T0`0T P0P@ P$pT80$<0 0p@pppp; P@ 0S0C 0 @0Ѝ00#s0A@$ 0@e - ( Z V``$0,#$,0( S(#<@0`0? 80%#l0Q@0;0@0=0l&-T80S07 pP$@0p`t0x0|0d0h0l0S0p4`0TӈP( #-@P 00#0 0(00$00 0Z@P#0$P(p,`0T0 P0p`0 } @{Sp@-P` q,@ l,0000 00pA-p`Pl@ 4;\0 T6o5_0p `P);B00 00000p @0ۋ݋M- `3Q@ p (0_0SP6; 0 GP` $03 00pP0    _08080_@8_P T8c@ T  6N}?A-P@pe-`*P:=000_0SM-0P0Mdp<`P? 0 L  0SC ~@P< 0 Lٱ  0S3 0S. l`P* La@T" $1 0\@P $ L1`V@0Ѝ 000 SX7 Xb X @`8P ,00 0L娱,0S@@ T0< R Q 2/[@ 2/P7 @L P ,00 0Ly,0S@@ ᒆT0< R Q 2/[  2/P @001<0 03/@Tt@0P0S 0L˜OT ]00u ,0 ( Ø0P0OcX3 (P.0<0S@ R 3/ R 0 3/qP T)>@0X<000S  3/P@ 0 { @'_]0ds@-P@ `UTU@@Ѝp \PP@``P@p@-P@0 00    p@-0@ S  0|00 S p@-j@PTA}O@Q Mk0S1@0 484 0 0_0P!/`b0<00S 3/P&p0 Y0P  , R dP:m0 Ѝp0M-@P|| 0h!PB \0P!0p8!W`6V 0 !0P  0 ܯP`` V VW t w3P ||ЍMl``ЍMЍ $SA~MUiz,lĉA-@`LPP)  +pDA@D?pPWЍ +0S"R 00Q +0@  + +P$@$@Q QL@  `0T:0D S@5@0:Pꍹp@-@PP2P >>0 &;Pp@ mpA-PP``@p P2>>p0 %;PAm@-4M@P`0 p 800 1U0 1P0:0 U :`j ! JP4ЍSU``Fp@-0@4S$ S ,S 0 (10HS S SP1P0Ha 6/U` ~p0 Hp@/s@-P0<00SO`޾P  < S TED 3/&p Ѝp@T:Tm@@Bй0P  P/ S  R @-@ 0 @@/A-pP `@P `9Qp0嘃#2 SЍ 2/  0V3?003?003?0@jM-0 S S `p@PQ0S P`8ጀ?s00XP0S7 pp`PG0HP8 0 0Rs0S0US0S,  ĩ@  0 SSZ S0 S#0 S ` RppDSP->0  Q1!0 0#1Z>0?칊+S7@-@ 0 <PU 00 5/P}_ Ѝ09SPU)0  P s@-0` @PႾP  0` Bz@oЍpM-0M ` 0@lPd|\ypTvPTPPP%@VC 0P0 0Ѝ00wrPP %㓃 P PUJ 0$P ~P$P$0ᡂ|!P @0;S000$P RS$x tPRP Z`P P00t;R0 rPp crPp h $}P$p$00DP]0 FE!L0qPp O $}P$p$00}P0 $ 0 ,00(H^7((N(qPp  $w}P$p $$0 ,00(/B7((0R0 ?`P(`.xP$Z}P$p$00$P0 0" z!(P(M P (0S p(UpPṕW00p '07Aᆉdžs{Չ͟@- 0@ P C 000Ѝ藺݋@-@ J4PЍ  0 8_+p@-Q`P M 0AS@ @PPU ?P?PP@ 0R@ ݍpp@-404P@T(@Pp@D||\|0  RS?/0\|M-p0,@P(04000P` 3yP 0<00S  3/P Ѝ0P$S00 S*0S )@Z<0 ZPЍM螸1aM-@XM@P< 0LpE`L嶯0  @XЍH0 .R0@/R 0S/@-0@0$$0@nAލ Ѝ@ Ѝ/7@-@HPH0P0<004 KP` D Ѝ0膉tр0@-M?@?@P0 ᕦP,ߍ0@-勩 pP 00 S/ P R00/0/p@-@@M0 `$0 p2G 0TPP @@ЍpT  @ dW @$ 05Wu@ 00U$PT@/iƅkl0M-M@Pp `0ƲP DЍ03 Z@PU 0SR [ ~ ~0S @P 0  PT 0QSm0P0S w~0 0d0( P PCA00@[0d00h0 & @T ᩮPV00@@Td@ @Ժ%>A-@p `P10U 000 0p`0  P1:HVP` U0 /0P0C0 рQ/M-p@`0A60@@T:A0G P 0P8/P 0 R EPET  Z0D&S@ЍPꫪM-Mdb@VR0P100MP, $ Q 00S0p( 00 P 0S*"( 0T @ T?*H 0!0K0 0S"040 ,?00 ,0 00.S 040 (0 !) 0ZP@ "P04P 0 p\S SPP0S0@$0`V  0=\(0CU 00L$0P`0  Bp0W    Bp`W`pC\WZ0``{캊tmM-S MP 0 0$Sq0{SP SkP@0@0S00a0 pp ![$: X1 800 S40a0S $9`J 0 00 pS J 0)p`@ P'0 HP 0v0 0CSl X X QT00 p10 1 Ѝ pҋtmg!{}qp@-@ P}`P P B`qVP |p Q00@0`0M-Pd`ddp00U0AT<0S 3/P0@pP֋nnՋ0 PA-`P QAa``@apP  @0  0 0R@-@M0@` t@@@pPP  }PP 0 4@@PP (|00PЍ@p@-@80PH%+P0 N+Pppxh@-``@PP   0##*P P: 0*Pr ЍpM-Pq@P@F0@3?S@@ P;p`,  ̌X0 P00S+@P( V#0 GP)@ 0 ?PI@ /P@` JV  0S 0S @ЍV `Vp 0  P0Sxp@- P@`P$H P8  4, Pp p@#(20A- M#00P@`V )`V}  )` P  ) Dd 0 )p<`WZ 0 HWW FopFwpW㨂037  |)  0FSX  Y) t V?136. ! 0)`4V (W,`!0})`LvV/ r0nwg `V  0[)P hR00 .PP0S ЍAS$7mg<JAh;`v,h<:!h;. !Ȼ Q^ۻM-XM$00Q00000( 0(0xS0(0 K,05 x0 v@P  XЍ0S (0@ 0T$ x,Y)@P\充@ | 8[05 H 0 q) @j 4PU ^/PW @ST {(T 4 { )Pf )P` )PZ- (`PT[S (`P` (PPPI (pPC (PP? (pP7 (PP3 (pP+ (PP`& `[``V T (T (($ @ P0 >@@`[PPL0H Q(P ?d|0P`S+ "P0$(P |0S! x@| P0RSP  [XT  3 #1Q  R @ 0G G0'|0P0S0P80.G0404 80R00S% 0KS"0V$<0z<0$P 0$0T  0 04EPTp$`pG) (@P`V  ,`[G0S SP 0 0p00S  (0S ,0 S0 0 (0 80 ဉP p5 <GjxhҼʜPo!h;,h<:mg<"!Dip@-PP& 00 0@S!(0 0$ R ($ 0%3/P3 T000`0dDdHL@T` $0(3/`p@$04@0S  @4 )@@@ S.@@ @ @(@,@0@8@<@l P L pp'(M-08MQ 0u0尶 0C406 P$0000606&匦|F00`4 8\<\`\`\~'d0` ?0ᦀa.` `\\p\`\`\`\t`\x`\|g&p` po`(`(` p\.`a` `\\`\ `\ `\t `\x `\|g&p``po`, `,`. `a``\\p\`\`\`\dp\hp\lv'd$p`p 0 .a 4$` ^x*@ N@^ L3` 0ğ0^H$0O@?0P兀oP媏ᅣ᫬S \`PP%V +ZP$`$i"g)`(' S#A@$0 "b& 1( `R% `.@_PO@$"Q<0 P% ``& 0A&" ,P@5# P ^ ?0ዿᥰ1[%0#P "B"1 @0 0,/ Ϡ,!0# @ @$$"1 0 0,B 4Ÿ4b,0#("0 #801."! 8Ѝ1!   .  !=2!"< 0 pl!`&0!%*5:!0 =y5zO'ֵNa'`녱y7[ީlycwy7gVgV/'E-@M`TP言 0- T TQG@ R90 00 00 P00@Ѝ0S% 0RS0X( 0@0R0 xp@ 0X : 0 0 (@P/A-`@P@PVVp1x#ȇT@DPE T@0P0`FM-`@PU<p pP P P1E-MP`  000Q0#s000"$#0r"4Ƞ40  r P p+TZpP@ Jp N}GpGWm@NXЍ@ U)PT0S I@CEԊ@-  ) o b j ] e Ѝ@-@0P( M$ $ X  ЍN|E@-M@P 0 00 000000:ЍUE-PLM`p0P! 0,g@P @0aQ  ,PuU@&<u@LЍPP 0 2/` ,P 0`V*` ,PXr@0<0hu ,P ,PQaТ8oed&A-@pP`P800S`3 W3 0S0 0S-0S0S0# `P BDJ__0_`   PPp_ (_P$_p `PiE- 0`0P {P 3è0S u$@Z p p 2P ᶨ0 0ES0*X0 00 Ѝ  P 0RWA-p`#PP'@@0@pW<0$ - R! ` `R  p R  $W 7/PP   0R"3/@03/PvE-(`pP@P Z 00 0ᄡ@P ᨇ 0, ЍE 0 mP Ѝ脾@- Mp`P @Ѝ@PP ʅPPu vxԞT@1t @4? 0004 08P] P~׾}@-<042/ 0$0 0 0Ѝ [E-p@ 0(P,`卞P  0!0q1P:00S D0 V@ % Ѝ@jZA-@P`pPP 00(0 0ЍM-8M0`0S0` P0Xp`\ (D`PP㤂@P ` <0<0@0 040408000X0(00,,0LPp H00D  0S0 Z 000+ , p P0D0*ᯞ& 0 404 ,R/Q  R$R00 0P}$0 Ptbpp H00 0S0R0S D00D000P 08Q D00D0$P U 08Q 00@Q D00D0Po 808 4 < @0 0 0,00 0S1 000S, 3/P( P00, 0 @0< ,P0P0 D0"0U Z0 0Q!Q%0500N<0yp@-h@P ` 00020000@0060S0 00003/`p@Ջ op@-`n@PQ/`0``\P %V 3030 0 0 0p{Wh|(T{P$ 0 000p0S #6 :"&p 0$ 0@000S p#6:'v 0$pb&l&xЍ0P`0P0S P$T  0@TU.x0QTPUT0U@@pp@T`p@e0P SSPP0x 1T@ @00@0P @ BPP@ppP@pT0 p$P Ơ 0'ʌXR" X(,(, X [ $ P0S00  0S $P0 0 000k@PLP@T P  0pP 0 Xa>0LRPH: 00.U ?L4  0 RCSD o*` V?&c?o0#R9 00! !0S0. 0pT,0T00 S 1 #R:M`BQ[q V:aV`S*+P0R!:0,00P0h000,0L PhҳxpPL[ `P K0 020 0k20 0#1 ? 0#1?sp: 1(0?cS010!^0S-P`Jp$(AK%!f4崵r Afq{0pG 0Q $T/100V000  0000 4400S8S<#̠R@RD"̠ 0 QEP0 Q00 `0 Z (0 d00?o0#0Ks0j0R,0 H?0S00 $0BxpP-Rq `08``<` `#l`@``D``"l`  00S Q  QS PXЍ QP0:A vTUVx PE`0DZ 40UW*0$00 00000000 100200 C$0?0R    44 R0 4  430 0 00 RZ Ÿ$̂q  QtQhrPR!R",p`P  p `  P  0 0  R/ H$P P R R",   0 P  0  P[ $0 0$00 # 00000K`,P*0(0 0 000 0S( 0( !4200 0qpQdQXrRR!",p`P p ` P   p`P p`P  0 X 0 000GPRM-PNM2`0 P PP@Q! ( 8Hp HP U 0H  0 !@S0T,1. (PkT!0㨀  (1'  R3# H  {뀰KP@PETQ(0 (10(1@ ,1 S?0 0;(( 0#(0 0001 S 0 *@) `H_{0!Ġ!Ƞ!" P"", p0,!p0@ 03/Nߍ0 0 S  3 #00H0 0 @D*{ ``@-0_0_ 0 0prm蠆@-0_0_)0(0p^m蠆M-`PMpY@Z 8E ee @Ѝ A  BP  TT    0 0 0     8 ` RL%` d R@%d h R4%h \ R(%\ l R%l p R%p  R% x R$x  R$  R$ | R$| t R$t  R$  R$  R$  R$  R$  R$  PRp$ l$X  rq rq Ep䀄$p[, 'Q3 [p" k K78 ! 00 0S0 0 Q/: 0. hBV0  I rqp䀄  R0 R#: R0  0 0  S *0S 008 JP\00% p 000TQd*Se\pWpZ:^"1p  $ R0,00IP {pp  $ R 0,004P {p(D0D0H0H0L0L040400S`p V0*. 0ႭP00000`p0\0C0Q♾▾$ |%8  !P!x!!!! " 3dT Z!Š0@-p`@0 0PP& 0!@P 0v P 01QT @0@ 00 Ѝ@4OPU*jZp@-P`@PpOPp0 <0p@0/M-(M0P0$ >P! 0000 <003/PP `T8 U`H80S 3/00<0 0S  3/U P 00S07 R?'s0  R/ r $/r R 0@$/r EPP \Q P R R[ $ R@EU/S0S 0 Č0Ͽ$/\r @E $ R $R R RQ p$ $Q $ R-  R}8v Ry  $&$ Zp fP  %0E0 $000 4?90T0S 0SX0SX X' p3`V 0 $0 4?s00000/ 4?s00r 06/ $2$ 0R 2 0S     04S/0r 0 R ƅ 0ƅƕ0ƕ    v P G v10PS11   SN0 4?s0SGpGSDS00 $h/r R0SL10S<` V01`0 04 $/r  B?  s0q6/P|f W p!00` VlF"0 S1:f,G ^ Y000 (Ѝ@66gŠ8o40$ۋ$,{Š oXۋ>ۋDۋTۋۋً@-PD0 $0 @-@P4 D01 0<00S, H 0R  fP! 00000 0 0<003/P&p 0Ѝ@  Ѝ@ЍŠŠŠŠp@-9@PP pP kP fP ݶ0Sz 0000qt0o`0 R H0 D00S 4000 pŠOSÊXۋ@-PP P @$p@-\P0S @L0L ?00D0D @@0@<0@80@40?00J@p@6$ۋ,406M-[ؘPK*OBD:`pEAણ d 5Q 0QW 0pG@m1 @E$01@QA-P`p"U@P@E" 600 0R0C R /@ Q/0S0/p@-@T 4P`V 0004/`ppM-(M 0000AL `rPG@P$  B 02s0H R$Q0  010U`0 ij00 0PQ 0j0C0CWF W _(Ѝ r! @D Sr S0S#̠RR"̠  QP$0  jj0 #"P010P01  0P Q 00T:0?oL0#0Ns00BgH0B 00B 0 10M-p0BS@P` B + L HGH@ T0#03P0SoVPV - 'p@-@PpPUp$0Sp40S p $04(3/$0 (3/00pA-?P?`p R8@\0 7C X@!`$*6L Ń ;,à#? S?0 00S0 S*#?0006C Q1:7C Q?03:#S?0Q/ R/P006@ \03S/P± @5@0C6;00P 7 000/PQ7@- 0@SP  Ѝ000S ,7rp?PEU 0 BQ/ R/P006@ \03S/P000/ P-P=#=0µP6P=ౣ=0µ ?0<<@Ɍ 0 00?0<<0? 0 0000@- @ Êp@-@P`P ?(, 0 #6 *SCp@9P Q 0 S ^0 0uK6M-@p`0P R U8 @X\R/R   \Q/Q  QP 0U@0@@00P S@ .S0S .S0S ᵹ @UP 000 S .S @㓉M-P0SpA S S0!}0`S@  0 S C0bp  P`000S S S !R0wp% R1 R :00Wp pp00q0@pS00 060 0Wr000s00 040 0Wt00000 020p@-@PpP@`@P T`L0H VTP0 HPLPy]@ 0 PPq]H`L`p@k]A-@`pPTU \P 0\  R  R7/P0 0@0 S0R @-@pP lM`<1WH0 0$`V 0S$0 S(#< 0lЍ  "r !#4"P40P80Q4 0Q8!00V0||0tt    = lЍ@50lЍ@w=Ԋދg jgrn<:ORQhك[Ê @-0 Č0\4 <g! P BQ [5ÊTÊ0@Sp@-PU@~P@0U @4@e03/@Tp/phi㓉M-0@S0M@0Ѝ`VPX@P @V4 0pX 0SV/ 0V04 V-D   06[(ڽ DPu p<0P0jgV  V Ÿ 000O"峽X Rg$0 ,00(@(?(,\ !ȽT@gP>gH @s(gÊÊgvaÊрÊH~^&`P0 000C,0P/ R/(W@W(W@-0  ;ЍՊE-`pMV@&0 -R =:PP@,@ 3?;;30 000SP/0/s0S@/@-PM-(M, Pp  9cP<<n@(Ѝ U``'?S`V[@P `0 @0gPO 0 `0C03@ 0gP?  - )70301l0'3200HW400S.H0??%0?? 0$1SsP 0 000 P$10$1 kZiZgZ`@V 0` #  $ 0b$ P@o$   0  AQ 00#$ 0 p    0  P0`0#0t"P T_Ċ@M-`P@P$10C$1}0@ p0W 000$1S @κZ *,t@YYYĊp@-0`_0P_p@00_ 0 0P` tp@d0 1 _ _00 V1P_*0P}=Pp꠆Ċ0<0(0S//A-P@,@D,0SD0,@p4<`<`F<0S D0A<0<`Ct0AQ /R  H/ R   R   /0 0r _ / 00 p_/@-0@ fP000Ѝ@-0@ [P000Ѝ03010/M-`P b@P  aP x0]Ѝ 0#1 0 00CZ01p3? s71[wP U 00<P@  s01P 'PPwp PĊp@-L@@p9 PPp a@ p`V(p@c @PpʹŊM-`M 0 0[ D@P80,G@PLm@0SSt@g@0SP`vVMXXŴ´PPㆠP`PUʈ @P @@0S ;P` `:?o2PppW8 [P@`ЍM],Jp E@@Z KP0S}P xP`ЍᑡPP<P@X8 ,`0P4pE@,@堠PP  u5iP=፳pP" ,ሳGPp Jᢳ  B RX 0S,apP @`0 pH@tPP P,‹@`kPZ u=P @Y @00S;S&XpP+ @  X.0 ;R00X 0 X p@P@@WXW@ P@W380n4P rq0000qp0 P  P*    Q @D   ϱ0 0谀 g.  00pW0SLP<ꭅPP˅P 勍P ʅPP @ ṅPF 0,0`ᝌឌ ,0  0p1 ,XH,ZP@T@a`]0PT0HL0D0e\0f 0@X`0 p8|傸 p |Ŋр#Ŋ-ŊŊAŊXŊ~ŊŊŊttNaƊꑊ)ƊM-@pP0$0_0\_ W2$0S 0S 3/PO$0S 0S 3/PB``R `V@ Pd W*PU `PE$0S 0S 3/$0S 0S  3/P%!4  s000s0_P 202s0_& 0_ 2PUMdmWP# *P W*P UPPy W*ZPPU MwƊƊƊOƊƊ@- )P Ѝ0<00S /%/0<00S /%/0<0 0S//P@-@P&p@ 塷Ɗp@-@P`Pp 0<0@$ ^ 0T  p@/@ Tp@0/`0 0 NJ20/Pp@-P$P0 @<`Pp0S  1010U 0!p3/P pp@-P@`V @p `@-❌P ЍЍ@- 00 嚂P p Ѝ@-@  0 P 0S0 3?2/ Ѝ@-@Pp 0h` p 0  Ѝ@Xp@-@P 0th p@L@-p@-餋P <0 4 S0<0C0/40S0<0C0/@-M~@Pp`P ЍDP ,P,PE,0S t0t p00Cl C2 S Q P 0034000 00@lҋ6H76hҋi}r|p@-P@Pp00S HPpp@-@Pp@p@-@͵P=fYPƵ}PYPpfpA-P@$0`SP TATpCP TT0`@-}? h00Č 00 0ZЍ 00P/@-d0h00Čqr 00 #0 ZЍE-AM?`?`@ Pa_P:` 3 `p?p <_P& G_P`Z` S`  S``f , 0:P pAߍ < S`NJp@-@0ghMK?00  00 0 0PCZP C @t06t0l06l0Ѝp0@-CMy@0|PPT h墵Cߍ0S0<00S ,3/PT(( ⎵@0֭~рRp@-@Pp@C _P \CP p/NJp@-0@SP R0Sp000`f!D 0    0 pp@-@P0 P0  C000p@M-@T`0 0 pS 0CPU0USS `V S0P00S@|SP P  QM-#3*P`p 0 ኽ,  R@P T㔰0-SW0f pǻ@ @T 0K PT U0#02SЍW 0P@ĉs@-S [ Ѝ ᑭ@-S o Ѝ Ⴍ@-S o Ѝ sp@-`Pՙ@PL唴@pPPU0 0P{̉E-RM `Ѝ@ 11P1p(?ow20S  i RG dQ`Di@73PPp0T3s T!>UQP ZPT00P0p T0< T83? 00R  02 PZPX0 ⊊`P  44 `ω4NJ;NJDĉs~ω։@-@}0S0 P 0p@-MP@!bP"^`P 0|P 0S0 3?2/!0 $0Qi 'P 徳Ѝp @ P0P TT PP害00$ 0P7e堳 pHHBNJaNJ00 00 )RR00bR00S/p@-` @ PUPpP *P @p@-@@Pp@4lPPpb Ppp@0jA-@PAUOpP ?}P`P| PcPPqPRc00 |P0 hPjx^^M-@M 0qP 0#{P  0d#|P @0 dP@`P  v#|PP #{P PV  v:GOЍ}P"y}0P0Ptl"P 0 p1~PL"P 0 p(~P0徬 2"~P]PPE0 S . ! C}pP03?0!0}P03?02dPFd!0zP/  0 0 0 0 |P1 03?0 0 8l0 }Ps0; 0  0 0}PeP00 0t J}P  PRH 0}PJ`H [WtNJbt낉NJjNaꑊƊM-`@Pp48_p_Vp`_p_ pVapp_0_  #< <",t0 p0P` 0E%DaUJ   0 yP ЍMٱ0 P*p`0_ _  0S p1XW 0g  7?W?o0 02pc_T 08CTr0_P2 @0 jP Ѝ$NJA-@`pP$`0 D "$ __U wpp_p_0 0@- 101@|M-̀0pW- P ArP`+` 0 @ 0凼t ᛭@P  T0`P0PL0H0 哰@0ЍM$ЍMЍ$ۋ4A-@ᬀPU`0VP  kPpt(  Bd T T:(00T*8DQ $ `6@NJȊȊȊ~M-0H@MpP` 00 吣P000,0, R" 00 00H0SD0S "0Sΰ00, H0400W80L\<pFQ0VH 00RD0STQoHPUrP0#S6LPP400 <0P 80:0 <0Pm<"R$^BSS1R*0? P_@QP:P`p Pd@ 0b 0 0@P`  8`"(`"$`""`"!` pf01 0谿 0ɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[$90ૅ:h9څ@ۅۅt|ÀˀӀۀ〉뀉$+29@HPX @>@ pyNNNĉ瀊R1=C.)Dv1'HĶav1'HĶa  To????QRVReR{byzPPPɊPPPPPPPPPPP{PQPPPPPP|9@ $1-161̀R&R?рDQ瀊 M  (0@ @     0 @            (@@   0              ( 0@    !"#%')+/3;CSc @    "%)/;S      !#'+3Cc 0      @     =}???= } ?} ?  = }(%D[fieeefwge1eeeKgfcfee9f?fefeffei2i2 i2%i2*id2/i424i29i1>i1Ci1Hit1NiP1Ti1Zi0`i`0fi$0li/ri|/xi@/~i.i.iP.i,.i.i-ix-i<-i,i,i,i|,iX,i4,i,i+i+i+it+i,+i*i*jH*j*j)j)jX) j()&j(,j(2jD(8j(>j'Dj'Jj0'Pj&Vj&\jL&bj&hj%nj%"e2RHUNJNy}C7/r1CM &qLFܻՇ stp9DKP/;U'&LHt7&x/iHB.׫VjbZHڣykI)OGI8z!A ,i˲:=Egeo@>@mJl$m0VL?ir;1?ir;~b3>O -;6PߥR1=C.)D4ubwF%wt8i9ir;wt8i9ir;QǤ#>LIdcI'hUh=OtUR1h(Ou2%-'?M,򌛼!H!(-'?MNφf~*@.!Ê"[NYd9ir;(s*K>;Gہ5'?Ms愣J(b@IJ|0}yz8(Hm@ @ )vv'@BΩ੊&7J_q˪6xл້Zcgm@x}uu@x}e j!8Pˊˊˊ+RM<BIPX  @ @    @DEp0~;~\G~\T~p`~l~x~~~L~~~8~~~$~<9XĬPx~~x`w ~ Naby3v~  ~ ~~Ɋ~~~~~~`AM3iǁ󟝸\ M}-"3Dh&3v=rGy=iG}䢸;Mt?mWC 3KOOyD<#*=(d=TJxo8]*:2OA%2 Ÿ<~;G<<ϸAzԻ׸=u .HC7Q^-Ḋ(s*K>;x& P'((@( #( J `)u &GF46W`ppp@@@@@@@@@;Zx0N`vD䱃hԆWKؕ$Ī\,|gx^g{| HxQ\O\+P\BR\,pL v"wGwlwhhxhZhZ$ЄTxdKxKKKĮ ;~=mm}}JWy6߉PQN(u'NN_NNhNLNLNIɊwwwwwwww wwww xxxx&x,x4xGKрр xyCya+y3yDyLybyiyvyy yy yy&yy%z zIɊ#z1z7z HzRzizrzzzJzzz#zz{ { {({:{C{\{g{|{{{{{{{{{{ ||(|2|I|U|n|x||||| ||!||"'}2}$Q}[}'{}}(}})}}*}}+ ~~,)~/~-B~K~.Z~g~рр}xˊ@79l<0$ '-1mncrc32cxxhash64 sha256 blake2 +<9-NE0h909#'8}<}111111)1 11 :&;&e&f&c&`&" %%%B&@&j&k&<&%%!< %!!!!!"!%% #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %1y3!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@ !1Aa  0@`@@A@!  @a`10  @$LQQQQWnnnn nnnnSJf|[ CGZ֛֧8`{BootOrder1234567BootCurrentBoot####SecureBootSetupModeAuditModeDeployedModeVendorKeysPlatformLangCodesPlatformLangOsIndicationsSupportedBootNextPKKEKdbdbxdbtdbr<NULL> `zS})As+frw1 #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O >vy<<     ttttt 6RitttZ_dtotq16$1OU11111)111111x& -2$ipaddrBestBetterGoodDegradedU-Boot*XHCI Host Controlleru-boot*EHCI Host Controller* ueE +,;=[]  fdt_get_dma_range__of_translate_addressfdt_fixup_memory_bankseeprom_rw_blockdo_gptpca953x_read_single__put_mtd_devicezstd_decompressbtrfs_lookup_path__btrfs_map_blockv7_outer_cache_inval_rangedo_bootvx_fdtxhci_ctrl_txbtrfs_decompressbtrfs_next_sibling_tree_blockfree_extent_buffer_finalbtrfs_read_fs_rootbtrfs_find_last_rootefi_free_poolefi_runtime_relocateallocate_partition_ehci_create_int_queueinitcall_run_finitcall_run_rusb_setup_descriptormvneta_txq_initphy_device_createata_scsiop_inquiryxhci_get_endpoint_intervalxhci_setup_addressable_virt_devpca953x_write_singleadd_mtd_devicemvneta_setup_txqsxhci_address_devicefs_devreadleaf_space_usedxhci_get_input_control_ctxrecord_transfer_resultfree_extent_buffer_internalmvneta_rxq_initefi_free_pagesahci_port_start_xhci_alloc_devicexhci_scratchpad_allocabort_tdbtrfs_leaf_free_spacemvneta_setup_rxqsbtrfs_search_slotxhci_update_hub_devicexhci_alloc_container_ctxreset_epxhci_configure_endpointsxhci_mallocxhci_bulk_txxhci_wait_for_eventfdt_find_or_add_subnodexhci_segment_allocxhci_ring_allocxhci_queue_commandbtrfs_free_extent_statexhci_ring_freexhci_inval_cachexhci_flush_cache(((((AAAAAABBBBBB[.128,.192,.256] enc key iv src dst len - CBC encrypt block of data $len bytes long at address $src using a key at address $key with initialization vector at address $iv. Store the result at address $dst. The $len size must be multiple of 16 bytes. The $key and $iv must be 16 bytes long. aes [.128,.192,.256] dec key iv src dst len - CBC decrypt block of data $len bytes long at address $src using a key at address $key with initialization vector at address $iv. Store the result at address $dst. The $len size must be multiple of 16 bytes. The $key and $iv must be 16 bytes long.Resetting CPU ... PXEEFI bootmgr flow(%0*x) %0*x reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: CACHE: Misaligned operation at range [%08lx, %08lx] %-30sRTEMS! FIT images not supported for '%s' - must reset board to recover! ## Transferring control to RTEMS (at address %08lx) ... %s: %s mvebu-resetmvebu-sysreset%%.%ds marvell,armada-370-pciemarvell,pcie-portCannot disable PCIe port %d DT node! Cannot find PCIe port %d DT node! (empty, defaults to 1600K) %.5s (empty, defaults to 0) %s: has to be 2 characters %s: invalid setting, supported values are: %.5s%sInvalid data for field %s Plan 9confaddr## Transferring control to Plan 9 (at address %08lx) ... ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) filesizeQNX## Transferring control to EFI (at address %08lx) ... Base path too long (%s%s) Retrieving file: %s Expected string literal: %.*s fallbackInvalid option Unexpected value '%s' Expected string: %.*s bootm_lowbootm_mapsizebootm_sizepart_%xwhole%s.%sextlinux/extlinux.conflabelpxefile_addr_r/EFI/BOOT/BOOTARM.EFIfdt_addr_rtftpPXEClient:Arch:%05x:UNDI:003000bootp_vcibootp_archkernel_addr_rbootfileNet%x:%xCannot boot EFI app on media '%s' #size-cells/aliasesethernetethaddreth%daddrlocal-mac-addressERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x (fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request mcu_56Error: VHV gpio lookup failed Error: VHV gpio request failed Error: VHV gpio enable failed Error: VHV gpio disable failed Cannot add window '%x:%x', conflicts with another window i2c@11000->i2cmux@70->i2c@0Cannot get I2C bus %s: uclass_get_device_by_name failed: %i Cannot get %s I2C chip: i2c_get_chip failed: %i MCUserial#%016llXEEPROMcannot read EEPROM: %d bad EEPROM magic number (%08x, should be %08x) firstbad %s EEPROM CRC (stored %08x, computed %08x) secondethernet2phy-handleatmel,atsha204aCannot find ATSHA204A node! Cannot disable ATSHA204A node! Cannot find ATSHA204A on I2C bus! %08X%08XERROR: %s image overlaps OS image (OS=%lx..%lx) Expected include path: %.*s Couldn't retrieve %s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s pxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%sNetBSD## Transferring control to NetBSD stage-2 loader (at address %08lx) ... XIPLoadingUnknown Image %s %s Uncompressing %sUnimplemented compression type %d %d Bytes = %4d-%02d-%02d %2d:%02d:%02d UTC %sImage Name: %.*s %sCreated: %sImage Type: Unknown OSUnknown ArchitectureUnknown Compression%s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x .sib%.*s.%s.bootdev%.*s.blkHunting with: %s dhcpUnknown uclass '%s' in label No bootdevs for '%s' fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not set bootargs %s. 2025.10-OpenWrt-r32933-4ccb782af7u-boot,versionWARNING: could not set u-boot,version %s. device_typeWARNING: could not set %s %s. regCannot increase FDT size! marvell,armada-380-ahciCannot disable SATA DT node! Cannot find SATA DT node! %s: Bad cell count for %s The address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %d./bootmlocalcmdNo kernel given, skipping %s Skipping %s for failure retrieving kernel malloc fail (FIT address) ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s fdtfilemalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT Skipping fdtdir %s for failure retrieving dts fdt_addrfdtcontroladdrSetting use of fallback Selected fallback option, but not set Error parsing config file pxe_label_overrideMissing override pxe label: %s Missing default: %s ERROR: - must RESET the board to recover. image is not a fdtfdt_highFailed to reserve memory for fdt at %#llx Failed to allocate memory for Device Tree relocation device tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failedOK no-mapfdt_root: %s serial-numberWARNING: could not set serial-number %s. ERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed /chosenu-boot,bootconfskip_board_fixupskip all board fdt fixup ERROR: board-specific fdt fixup failed: %s ERROR: fdt fixup event failed: %d Failed to reserve memory for the fdt at %#llx - must RESET the board to recover. FDT creation failed!FDT and ATAGS support not compiled in Using standard DTB !!! WARNING !!! Using legacy DTB ## ERROR: %s : %s /memory## WARNING: fixup memory failed! ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated verifyWrong Image Type for %s command ## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... Unsupported Architecture 0x%x ERROR %dE: can't get kernel image! Can't get image type! Can't get image compression! Can't get image OS! Can't get image ARCH! Can't get image load address! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Can't get entry point property! Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover Unable to allocate memory %#lx for loading OS initrd_highin-place initrd alloc failed ramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) Resetting the board... u-boot,efi-bootmgrbootmeth_efi_mgru-boot,distro-efibootmeth_efiu-boot,extlinux-pxebootmeth_pxeu-boot,extlinuxbootmeth_extlinuxu-boot,boot-stdbootstd_drvloadaddrMagic constantRAM size in GBWi-Fi RegionDDR speedUse old DDR trainingExtended reserved fieldsExtended CRC32 checksumatmel,atsha204marvell,armada-370-xp-system-controllermarvell,armada-375-system-controllermarvell,armada-380-system-controllermarvell,armada-390-system-controllermvebu-system-controllerdefault/boot/Invalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-VaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImagekernelKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot Imagefdt_legacylegacy Image with Flat Device Tree spkgimageRenesas SPKG ImagesfsplStarFive SPL Imagetfa-bl31TFA BL31 Imagestm32imagev2STMicroelectronics STM32 Image V2.0menutitlepromptlocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseednoneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedlz4lz4 compressedzstdzstd compressedInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdoseEnea OSEplan9rtemsTrusted Execution Environmentu-bootU-BootvxworksVxWorksqnxopensbiRISC-V OpenSBIEFI FirmwareELF ImageUSER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32%-12s= 0x%0*lx Driver Compatible %-20.20s%-20.20s %s Driver Address %-25.25s %p Supported filesystems%c %s: flushhits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u vbe,sizeMissing vbe,size propertyvbe,size %#x exceeds max size %#xCannot find random-number device (err=%d)Failed to read random-number device (err=%d)compatiblevbe,Unknown request: %sFailed to process VBE request %s (err=%d) vbe,errorvbe,errnumvbe,requiredCannot handle required request: %s Version: %s Vernum: %x/%xarea-startarea-sizeversion-offsetversion-sizestate-offsetstate-sizeskip-offsetvbevbe_simplefwupdcur-versioncur-vernumU-Boot bootloader-version## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX Trying to execute a command out of order fdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%s%-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands arm-openwrt-linux-muslgnueabi-gcc (OpenWrt GCC 14.3.0 r32933-4ccb782af7) 14.3.0 GNU ld (GNU Binutils) 2.44 aes.192aes.256enc-nDriver uid uclass Devices %-25.25s %-3.3d %-20.20s %-51.51s%-25.25s Flags not supported: enable CONFIG_BOOTSTD_FULL ** Booting bootflow '%s' with %s Boot failed (err=%d) boot_paramsDRAM bank-> start%-12s= 0x%.*llx -> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit eth%iaddrcurrent eth = %s %-12s= (not set) %-12s= %pM ipaddr%dIP addr = %s fdt_bloblmb_dump_all: reserveddevicetree = %s serial addr width shift clockarch_numberTLB addrirq_spsp start Early malloc usage: %x / %x changed to max of %u entries of %u blocks each No UEFI binary known at %s zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] Failed to allocate memory for the image at %#llx bootzID %llu gen %llu path %.*s BTRFS: failed to list subvolume: %d OFFInstruction Cache is %s List of available devices |-- %s (%s%s) | |-- %s -e-sUnknown parameter: %s Class Seq Probed Driver Name ----------------------------------------------------------- cyclic_demoRegistered function "%s" to be executed all %dms function: %s, cpu-time: %lld us, frequency: %lld.%02d times/s %s: Cannot find udev for a bus %d printupdateCan't get eeprom device: %s EEPROM @0x%lX %s: addr 0x%08lx off 0x%04lx count %ld ... Invalid ELF image Automatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified host:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... usage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** No current device Interface: %s Device %d: No valid FAT fs found Filesystem: FAT%d "%s" ** Unable to create link %s -> %s ** -yReading bank %u: Word 0x%.8x: %.8xreadmReading bank %u len %u to 0x%lx cmpComparing bank %u: Value 0x%.8x:0x%.8x passed senseSensing bank %u: progProgramming bank %u word 0x%.8x to 0x%.8x... Warning: Programming fuses is an irreversible operation! This may brick your system. Use this command only if you are sure of what you are doing! Really perform this fuse programming? y Y yes YES Fuse programming aborted Overriding bank %u word 0x%.8x with 0x%.8x... Bank %s: %s%d: %s: %d [%c]%s%s-aGPIO device %s probe error %i Command '%s' failed: Error %d GPIO: '%s' not found cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %u) value is unknown (ret=%d) Warning: no access to GPIO output value Warning: value of pin is still %d unknown Cannot find RTC: err=%d Reset RTC... ## Failed to set date after RTC reset ## Bad date format ## Set date failed: err=%d ## Get date failed Date: %4d-%02d-%02d (%sday) Time: %2d:%02d:%02d timestamp/imagescompressionUnsupported %s address size data-positiondata-offsetdata-size/configurationsAutomatic boot of image at addr 0x%08lX ... ERRORinf no %s devices available IDE device %d: no %s partition table available Device %d: unknown device ... is now current device %s device %d not available %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s erase %s erase: device %d block # %lu, count %lu ... %ld blocks erased: %s Working FDT set to %lx fdtaddrControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s New length 0x%X < existing length 0x%X, aborting. No FDT memory address configured. Please configure the FDT address via "fdt addr

" command. Aborting! mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s boaFailed to update board information in FDT: %s Can't get hash value propertyCorrupted or truncated treeUnsupported hash algorithmBad hash value lenBad hash valueCan't get hash algo propertyCan't get image data/sizeerror! %s in '%s' image node hashalgouboot-ignore-skipped + error! %s for '%s' hash node in '%s' image node ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC FIT image found Bad FIT image format! description%sFIT description: unavailable %sCreated: Can't find images parent node '%s' (%s) %s Image %u (%s) %s Default Configuration: '%s' %s Configuration %u (%s) %s Description: %s Kernel: %s Init Ramdisk: %s %s Firmware: %s %s FDT: %s %s FPGA: %s %s Loadables: loadables## Checking hash(es) for FIT Image at %08lx ... Hash(es) for Image %u (%s): Bad hash in FIT image! Unknown image format! ## Executing script at %08lx Bad magic number Bad header crc Bad data crc Bad image type Empty Script Could not find config %s Could not find script in %s No FIT subimage unit name Can't find '%s' FIT subimage Not a image image Bad Data Hash Could not find script subimage data Wrong image format for "source" command Data (writethrough) Cache is %s query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsfuseFuse sub-systemread [] - read 1 or 'cnt' fuse words, starting at 'word' fuse cmp - compare 'hexval' to fuse at 'word' fuse readm [] - read 1 or 'cnt' fuse words, starting at 'word' into memory at 'addr' fuse sense [] - sense 1 or 'cnt' fuse words, starting at 'word' fuse prog [-y] [...] - program 1 or several fuse words, starting at 'word' (PERMANENT) fuse override [...] - override 1 or several fuse words, starting at 'word' mvrename/move a file/directory [] - renames/moves a file/directory in 'dev' on 'interface' from 'old_path' to 'new_path'fstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type delete a file [] - delete a file with the name 'filename' on device type 'interface' instance 'dev'.create a directory [] - Create a directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'.list files in a directory (default /) [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start.determine a file's size - Find file 'filename' from 'dev' on 'interface' determine its size, and store in the 'filesize' variable.flattened device tree utility commandsfatmkdir [] - create a directory in 'dev' on 'interface'fatrm [] - delete a file from 'dev' on 'interface'fatwritewrite file into a dos filesystem [ []] - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsize - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2ls [directory] - list files from 'dev' on 'interface' in a 'directory'ext4lsext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4sizeexitexit scriptbootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s) EEPROM sub-systemlist eeprom read [device_specifier] addr off cnt eeprom write [device_specifier] addr off cnt - read/write `cnt' bytes from `devaddr` EEPROM at offset `off' eeprom print [device_specifier] - Print layout fields and their data in human readable format eeprom update [device_specifier] field_name field_value - Update a specific eeprom field with new data. The new data must be written in the same human readable format as shown by the print command. DEVICE SPECIFIER - the eeprom device can be specified [dev_name] - by device name (devices can listed with the eeprom list command) [[bus] devaddr] - or by I2C bus and I2C device address If no device specifier is given, the first driver-model found device is used.echo args to console[-n] [args..] - echo args to console; -n suppresses newlinecyclicCyclicDriver model low level accessget/set/reset date & time[MMDDhhmm[[CC]YY][.ss]] date reset - without arguments: print date & time - with numeric argument: set the system date & time - with 'reset' argument: reset the RTCconinfoprint console devices and informationdcacheenable or disable data cache[on, off, flush] - enable, disable, or flush data (writethrough) cacheicacheenable or disable instruction cache[on, off, flush] - enable, disable, or flush instruction cachebtrsubvollist subvolumes of a BTRFS filesystem - List subvolumes of a BTRFS filesystem.boot Linux zImage image from memorybootefiBoots an EFI payload from memoryblkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries bdinfoprint Board Info structuresourcerun script from memorybootflowBoot flowsaesAES 128/192/256 operationsprint monitor, compiler and linker versionpanicPanic with optional message[message]helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'alias for 'help'iminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)boot default, i.e., run 'bootcmd'bootdboot application image from memorystart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsfwupd,vbe-simpleinputoutputunusedunknownfuncfatext4btrfsunsupportedtotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structcompatdevresdriversstaticuclassSunMonTuesWednesThursFriSaturstdinstdoutstderrshowconfigureseparatefitembedbloblistloadoscmdlinebdtprepfakeaslr-moveaslr-randefi-runtime-randrandom-randmd5sha1sha256crc16-ccittcrc32No I2C bus selected %2u %2u-%2u = %5u %s0x%08x: %02x - 0x%012llx-0x%012llx : "%s" Base Address: 0x%08lx Valid chip addresses: %02XBus %d: %s (active %d) %02x: %s, offset len %x, flags %x Current bus is %d Setting bus to %d Failure changing bus number (%d) Invalid bus %d: err=%d Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Error: Not supported by the driver Unknown operator '%s' Invalid data width specifier Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX Unknown errorloadxy_timeout %s Uart## Total Size = 0x%08x = %d Bytes ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... %08lx: %0*lxbyte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Invalid address/size Refusing to do empty test Testing %08lx ... %08lx: Iteration: %6d FAILURE (data line): expected %08lx, actual %08lx FAILURE (data line): Is %08lx, should be %08lx FAILURE: Address bit stuck high @ 0x%.8lx: expected 0x%.8lx, actual 0x%.8lx FAILURE: Address bit stuck low or shorted @ 0x%.8lx: expected 0x%.8lx, actual 0x%.8lx FAILURE (read/write) @ 0x%.8lx: expected 0x%.8lx, actual 0x%.8lx) FAILURE (read/write): @ 0x%.8lx: expected 0x%.8lx, actual 0x%.8lx) FAILURE: 0x%08lx != 0x%08lx (delta=0x%08lx -> bit %ld) at offset 0x%08lx Tested %d iteration(s) with %lu errors. The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data %08x %04x %02x ? HDXFDX100fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 1000BT statusPHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T 1000BASE-X PHY AN duplexPHY duplexPHY AN adv duplex read failed, assuming half duplex PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %sMII devices: '%s' Current device: '%s' PHY does not have extended functions No MDIO bus found %x - %s <--> %s Reading from bus %s PHY at address %x: Error %d.%d - 0x%x Unknown modeYesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s Rd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: HC WP Group Size: User Capacity: WRREL Boot Capacity: RPMB Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state No MMC device available MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s MMC write: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks written: %s MMC erase: dev # %d, block # %d, count %d ... %d blocks erased: %s get mmc type error! #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device SD doesn't support partitioning userenhwrrelgpPartition configuration: User Enhanced Start: User Enhanced Size: No enhanced user data area User partition write reliability: %s GP%i Capacity: No GP%i partition GP%i write reliability: %s Partitioning successful, power-cycle to make effective no mmc device at slot %x OK, force rescanset dsr %s It is not an eMMC device boot areas protected MTD device %s not found, ret %ld unavailableList of MTD devices: * %s - device: %s - parent: %s - driver: %s - path: %s - type: ROM NOR flash Data flash UBI volume MLC NAND flash Unknown - block size: 0x%x bytes - min I/O: 0x%x bytes - OOB size: %u bytes - OOB available: %u bytes - ECC strength: %u bits - ECC step size: %u bytes - bitflip threshold: %u bits No MTD device found Only NAND-based devices can have bad blocks MTD device %s bad blocks list: 0x%08llx ReadingWriting [raw] [oob] [dontskipff]readingwritingReadWrite.raw.oob.benchmark.dontskipffOffset not aligned with a page (0x%x) Size not on a page boundary (0x%x), rounding to 0x%llx Could not map/allocate the user buffer %s %lld byte(s) (%d page(s)) at offset 0x%08llx%s%s%s %s %lld byte(s) at offset 0x%08llx Failure while %s at offset 0x%llx %s speed: %lukiB/s Dump %d data bytes from 0x%08llx: Dump %d OOB bytes from page at 0x%08llx: Dump %lld data bytes from 0x%llx: %s on %s failed with error %d .dontskipbadOffset not aligned with a block (0x%x) Size not a multiple of a block (0x%x) Erasing 0x%08llx ... 0x%08llx (%d eraseblock(s)) Failed to get bad block at 0x%08llx Skipping bad block at 0x%08llx ping failed; host %s is not alive host %s is alive activeeth%d : %s %pM %s Could not find device %s Driver does not implement stats dump! %s: %llu ## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed %s=%s ## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined edit: setenvSaving Environment to %s... not possible not initialized Failed (%d) ## Resetting to default environment ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated -bootableUnknown option %s %s%x0x%xSupported partition tables** Bad device specification %s %s ** Unknown partition type '%s' Bus '%s' is not a PCI controller Buses %02x-%02x SizePhys startBus start# %-18s %-18s %-18s %s Flags%d %#018llx %#018llx %#018llx mem Error %s the chip: %d %04x:CRC32 for %08lx ... %08lx ==> rootpathdnsip %s =%*s%#.*lx class code = 0x%.2x (%s) unknown header Scanning PCI devices on bus %d BusDevFun VendorId DeviceId Device Class Sub-Class _____________________________________________________________ %02x.%02x.%02x 0x%.4lx 0x%.4lx %-23s 0x%.2lx Found PCI device %02x.%02x.%02x: I/OMEMPrefetchableNo such bus No such device CardBus doesn't support BARs unknown header type ID Base Size Width Type %d %#018llx %#018llx %d %s %s Zero length ??? list and access PCI Configuration Spacedisk partition related commandsuuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition table part list [flags] - set environment variable to the list of partitions flags can be -bootable (list only bootable partitions) part start - set environment variable to the start of the partition (in blocks) part can be either partition number or partition name part size - set environment variable to the size of the partition (in blocks) part can be either partition number or partition name part number - set environment variable to the partition number using the partition name part must be specified as partition name part set type - set partition type for a device part types - list supported partition table typesenvironment handling commandssaveenvsave environment variables to persistent storageeditenvedit environment variablename - edit environment variable 'name'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'NET sub-systemlist - list available devices stats - dump statistics for specified device pingsend ICMP ECHO_REQUEST to network hostpingAddressboot image via network using DHCP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpputTFTP put command, for uploading files to a serverAddress Size [[hostIPaddr:]filename]tftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocolMTD utilsMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc erase partname mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc hwpartition - does hardware partitioning arguments (sizes in 512-byte blocks): USER - <{on|off}> : sets user data area attributes GP - <{gp1|gp2|gp3|gp4}> <{on|off}> : general purpose partition MODE - <{check|set|complete}> : mode, complete set partitioning completed WARNING: Partitioning is a write-once setting once it is set to complete. Power cycling is required to initialize partitions after set to complete. mmc setdsr - set DSR register value mmcinfodisplay MMC info- display info of the current MMC devicesleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)MDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. master/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enableMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.randomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]mtestsimple RAM read/write test[start [end [pattern [iterations]]]]loopinfinite loop on address range[.b, .w, .l] address number_of_objectsprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'memory copy[.b, .w, .l] source target countmemory compare[.b, .w, .l] addr1 addr2 countmwmemory write (fill)[.b, .w, .l] address value [count]nmmemory modify (constant address)[.b, .w, .l] addressmmmemory modify (auto-incrementing address)memory display[.b, .w, .l] address [# of objects]loadbload binary file over serial line (kermit mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)load binary file over serial line (ymodem mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2compute hash message digestalgorithm address count [[*]hash_dest] - compute message digest [save to env var / *address]I2C sub-systemprefetchsysmemreadonlysecondary statusprimary bus numberCardBus numbersubordinate bus numberCardBus latency timerCardBus memory base 0CardBus memory limit 0CardBus memory base 1CardBus memory limit 1CardBus IO base 0CardBus IO base high 0CardBus IO limit 0CardBus IO limit high 0CardBus IO base 1CardBus IO base high 1CardBus IO limit 1CardBus IO limit high 1interrupt lineinterrupt pinbridge controlsubvendor IDsubdevice IDPC Card 16bit base addressbase address 1secondary bus numbersecondary latency timerIO baseIO limitprefetch memory baseprefetch memory limitprefetch memory base upperprefetch memory limit upperIO base upper 16 bitsIO limit upper 16 bitsexpansion ROM base addressbase address 2base address 3base address 4base address 5cardBus CIS pointersub system vendor IDsub system IDmin Grantmax Latencysub class codeprogramming interfacecache linelatency timeheader typeBISTbase address 0command register IDrevision IDdeleteeditexportimportrunexistsstatswphwpartitionsetdsrMMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registerhalfworddouble wordBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file-lt-gt-eq==-ne!=<>-ge>=-le<=probeolenSee InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudioNo device set, use 'wdt dev' first Human Interface, Subclass: NoneKeyboardMouseMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk onlyDevice "%s" not supported by U-Boot image Device "%s" is inactive syntax error Can't get the pin-controller: %s! Pin-controller device is not set! dev: %s Can't get the watchdog timer: %s No watchdog timer device set! Ops get_pins_count not supported by %s Ops get_pin_name error (%d) by %s Ops get_pin_muxing error (%d) by %s in %s %-*s: %-*s pin-controller device not selected %s not found | %-*.*s| %-*.*s| %s ParentDriver-ipv6Config file '%s' found Config file not found Invalid pxefile address: %s ** Abort Reading RNG failed RNG #%d - %s No RNG device %s%.8x: %s Cannot find SATA device %d (err=%d) Cannot remove SATA device '%s' (err=%d) yesnodetaBlk device %d: Optional Admin Command Support: Namespace Management/Attachment: %s Firmware Commit/Image download: %s Format NVM: %s Security Send/Receive: %s Blk device %d: Optional NVM Command Support: Reservation: %s Save/Select field in the Set/Get features: %s Write Zeroes: %s Dataset Management: %s Write Uncorrectable: %s Blk device %d: Format NVM Attributes: Support Cryptographic Erase: %s Support erase a particular namespace: %s Support format a particular namespace: %s Blk device %d: LBA Format Support: LBA Format %d Support: (current) Metadata Size: %d LBA Data Size: %d Relative Performance: %s Blk device %d: End-to-End DataProtect Capabilities: As last eight bytes: %s As first eight bytes: %s Support Type3: %s Support Type2: %s Support Type1: %s Blk device %d: Metadata capabilities: As part of a separate buffer: %s As part of an extended data LBA: %s Failed to probe SPI Flash Erasing %d bytes (%d blocks) at offset 0 ...Error! Done! Writing %d bytes from 0x%lx to offset 0 ... Reset SCSI Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** Fit image detected... ** Unknown image type ** Bad FIT image format ERROR : xmalloc failed %d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d Failed to get partition driver count Error insufficient memory gpt_partition_listHex conversion error on %c Invalid bitlen %d generic_%d:%dspi_generic_drvError %d during SPI transaction -pSpecify a filename or set the ${bootfile} environment variable ext2anyInvalid filesystem: %s Error reading config file time: %lu minutes, %lu.%03lu seconds Error compiling regex: %s Starting watchdog timer not supported. Starting watchdog timer failed (%d) Stopping watchdog timer not supported. Stopping watchdog timer failed (%d) Expiring watchdog timer not supported. Expiring watchdog timer failed (%d) Uncompressed size: %ld = %#lX String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dms12 Mb/s+- %s (%s, %dmA) %s %s %s %s scanning usb for storage devices... %d Storage Device(s) found Error: SATA device not found Error: SATA 0 not found Error: usb_init failed Error: USB storage device not found Error: USB 0 not found starting USB... resetting USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. storNo storage devices, perhaps not 'usb start'ed..? '%s' is not a number %s: %s dev %d NOT available repairRepairing GPT: Writing GPT: No partition list provided Partition list incomplete No partition list provided - only basic check More partitions than allowed! Partition name: %s does not match %s! Partition %s size: %llu does not match %llu! Partition %s start: %llu does not match %llu! Verify GPT: gpt_partition_addrgpt_partition_sizegpt_partition_entrygpt_partition_namegpt_partition_bootableenumerateguidsuccess! No SD/MMC/eMMC card found %s(%d) init failed Error - failed to obtain block descriptor Error - written %#lx blocks Error: MMC 0 not found u-boot-with-spl.kwbError: Unknown destination "%s" Error: Unknown source "%s" Burning U-Boot image "%s" from "%s" to "%s" Error: Read not supported on device "%s" Error: Failed to read file %s from %s Error: Invalid A38x image (header version 0x%x unknown)! Error: Bad A38x image header checksum. 0x%x != 0x%x Error: Bad A38x image blocksize. Error: Bad A38x image data checksum. 0x%08x != 0x%08x Image checksum...OK! Error: Image header verification failed Error: unknown boot device in image header: 0x%x Error: image meant to be booted from "%s", not "%s"! Error: cannot read OTP secure bits Error: secure boot is enabled in OTP but image does not have secure boot header! Error: boot source is set to "%s" in OTP but image is for "%s"! Error: Image boot mode verification failed Error: Write not supported on device %s ERROR : xrealloc failed %s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS\$'";&|#;$&|exit not allowed from main input shell. Resetting watchdog timer not supported. Resetting watchdog timer failed (%d) Cannot probe SATA device %d (err=%d) No SATA device found! Cannot scan SATA device %d (err=%d) mallocWrittenFailed to initialize SPI flash at %u:%u (error %d) No SPI flash selected. Please run `sf probe' mtdparts support missing. Offset exceeds device limit Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx ERROR: attempting %s past flash size (%#x) ERROR: flash area is locked Updating, %zu%% %lu B/sSPI flash failed in %s step %zu bytes written, %zu bytes skipped in %ld.%lds, speed %ld B/s ERROR: trying to overwrite reserved memory... SF: %zu bytes @ %#x %s: ERROR %d SF: %zu bytes @ %#x Erased: protectstart sector is not a valid number len is not a valid number unlock## error: substitution buffer overflow ## Error: variable "%s" not defined ## error: subst buffer overflow: have %d, need %d ## error: pattern buffer overflow: have %d, need %d fmtgsubCould not set var invalid op ## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part ## Copying '%s' subimage from FIT image at %08lx ... Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... Image too large: increase CONFIG_SYS_XIMG_LEN GUNZIP ERROR - image not loaded ZSTD ERROR %d - image not loaded fileaddr${%*s showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'bubtBurn a u-boot image to flash[file-name] [destination [source]] -file-name The image file name to burn. Default = u-boot-with-spl.kwb -destination Flash to burn to [spi, nand, mmc, sata]. Default = spi -source The source to load image from [tftp, usb, mmc, sata]. Default = tftp Examples: bubt - Burn flash-image.bin from tftp to active boot device bubt flash-image-new.bin nand - Burn flash-image-new.bin from tftp to NAND flash bubt backup-flash-image.bin mmc usb - Burn backup-flash-image.bin from usb to MMC gptGUID Partition Table - GUID partition table restoration and validity check Restore or verify GPT information on a device connected to interface Example usage: gpt repair mmc 0 - repair the GPT on the device gpt write mmc 0 $partitions - write the GPT to device gpt verify mmc 0 $partitions - verify the GPT on device against $partitions gpt setenv mmc 0 $name - setup environment variables for partition $name: gpt_partition_addr, gpt_partition_size, gpt_partition_name, gpt_partition_entry, gpt_partition_bootable gpt enumerate mmc 0 - store list of partitions to gpt_partition_list environment variable gpt guid - print disk GUID gpt guid - set environment variable to disk GUID Example usage: gpt guid mmc 0 gpt guid mmc 0 varname imxtractextract a part of a multi-imagefsuuidLook up a filesystem UUID : - print filesystem UUID fsuuid : - set environment variable to filesystem UUID USB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'usbbootboot from USB deviceloadAddr dev:partlzmadeclzma uncompress a memory regionsrcaddr dstaddr [dstsize]Watchdog sub-systemtruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]run commands and summarize execution timecommand [args...] sysbootcommand to get and boot from syslinux files[-p] [addr] [filename] - load and parse syslinux menu file 'filename' from ext2, fat or any filesystem on 'dev' on 'interface' to address 'addr'sspiSPI utility command[:][.][@] - Send and receive bits - Identifies the SPI bus - Identifies the chip select - Identifies the SPI mode to use - Identifies the SPI bus frequency in Hz - Number of bits to send (base 10) - Hexadecimal string that gets sentsetexprset environment variable as the result of eval expression[.b, .w, .l, .s] name [*]value1 [*]value2 - set environment variable 'name' to the result of the evaluated expression specified by . can be &, |, ^, +, -, *, /, % (for strings only + is supported) size argument is only meaningful if value1 and/or value2 are memory addresses (*) setexpr[.b, .w, .l] name [*]value - load a value into a variable setexpr name gsub r s [t] - For each substring matching the regular expression in the string , substitute the string . The result is assigned to . If is not supplied, use the old value of . If no substring matching is found in , assign to . setexpr name sub r s [t] - Just like gsub(), but replace only the first matching substringsha1sumcompute SHA1 message digestaddress count [[*]sum] - compute SHA1 message digest [save to sum]SCSI sub-systemreset - reset SCSI controller scsi info - show available SCSI devices scsi scan - (re-)scan SCSI bus scsi device [dev] - show or set current device scsi part [dev] - print partition table of one or all SCSI devices scsi read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' scsi write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr' scsi erase blk# cnt - erase `cnt' blocks starting at block `blk#'scsibootboot from SCSI devicesfSPI flash sub-systemNVM Express sub-systemscan - scan NVMe devices nvme detail - show details of current NVMe device nvme info - show all available NVMe devices nvme device [dev] - show or set current NVMe device nvme part [dev] - print partition table of one or all NVMe devices nvme read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' nvme write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'SATA sub systeminit - init SATA sub system sata stop [dev] - disable SATA sub system or device sata info - show available SATA devices sata device [dev] - show or set current device sata part [dev] - print partition table sata read addr blk# cnt sata write addr blk# cntprint bytes from the hardware random number generatorlist - list all probed rng devices rng [dev [n]] - print n random bytes (max 64) read from dev get and boot from pxe filesget [-ipv6] - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] [-ipv6] - boot from the pxe file at pxefile_addr_r pinmuxshow pin-controller muxinglist - list UCLASS_PINCTRL devices pinmux dev [pincontroller-name] - select pin-controller device pinmux status [-a | pin-name] - print pin-controller muxing [for all | for pin-name] thenelifelseforwhileuntildonenandpex1.5 Mb/s480 Mb/s5 Gb/sexpire-o-z=~get Did not get interrupt on CBI alloc space exhausted ptr %lx limit %x Reserved fields (%d bytes) Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry NULL device name! No such device: %s %s is not a known ethernet PHY extended status read failed, assuming no 1000BASE-X unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) selecting invalid interface %dcmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. usb_storage_blkusb_bootdev%s: invalid max packet size Enter choice: pre-reloc realloc() is not supportedusb_ignorelistusb_ignorelist parse error in "%s" unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) usb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times cyclic function %s took too long: %lldus vs %dus max No valid device tree binary found at %p fdtdec_setup%s(): initcall %s() failed (unknown)%s(): event %d/%s failed initf_dmenv_initbaudrateserial_initSoC: MV78230-MV78260-MV78460-MV88F6720-MV88F6810-MV88F6820-MV88F6828-98DX3236-98DX3336-98DX4251-Unknown-A0B0?? (%x)Z1A1 at %d MHz DRAM: (total (%d MHz, %d-bit, 2T, 3T, ECCECC not enabled)Unknown hash algorithm '%s' HASH_MAX_DIGEST_SIZE exceeded %s for %08lx ... %08lx ==> %s - %s Usage: %s - No additional help available. xtrace+Unknown command '%s' - try 'help' initr_dmUnable to init LMB initr_lmbinitr_dm_devicesCore: %d devices, %d uclasses, devicetree: %sserial_initializeWarning: Device tree includes old 'u-boot,dm-' tags: please fix by 2023.07! WDT: Not starting %s WDT: Failed to start %s ERROR: Failed to register WaitForKey event ERROR: Failed to register console event ERROR: Failed to set console timer ERROR: Out of memory EFI protocol GUID missing for driver '%s' Failed to add EFI driver %s MMC: efi_init_early%s - probe failed: %d load-environmentbad CRCLoading Environment from %s... modelModel: %s STM32GD32MKL (with peripheral resets) MCU type: %s MCU version: %s Memory config from EEPROM read failed! Falling back to default 1 GiB! RAM size: %i MiB Board version: %s Serial Number: %s ECDSA Public Key: %s Disabling MCU watchdog... omnia_mcu_write failed: %i EEPROM regdomain read failed. Regdomain set to %s regdomainbootcmd_rescueomnia_mcu_read failed: %i, reset status unknown! Setting DDR speed to 1333H in EEPROM as requested by reset button... 1333Hwas already set cannot write EEPROM: %d omnia_resetboot_targetsRESET button was pressed, overwriting boot_targets! Net: ethprimeeth%d: %s [PRIME]HUSH_VERSION0.01No valid hush parser to use, cli will not initialized! prebootbootdelaykernel-offsetkernaddrrootdisk-offsetrootaddr/configbootsecure## Error: Secure boot command not specified ## Error: "%s" returned (code %d) Hit any key to stop autoboot: %2d  0 Hit any key to stop autoboot: %1dProblem Perform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedpoweroffPerform POWEROFF of the devicerun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'usb-mass-storageusb_mass_storageusb_hubdistro_bootcmdFATFAT32 Extd Boot** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %3d %-10lu %-10lu %08x-%02x %02x%s%s Part Start Sector Num Sectors UUID Type ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s %-10.10s %3d [ %c ] %-20.20s | `-- |-- (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available Whole Diskhdusbdmmcsd%s%c%d%08x-%02x(none)reg-names## Unknown partition table type %x Partition Map for %s device %d -- Partition Type: %s (out of memory) uclass %d: %s %-3i %c %s @ %08lx, seq %dclock-frequencyclock-divclock-multngpiosmvebu%d_u-boot,i2c-offset-lencell-indexu-boot,i2c-slave-addru-boot,i2c-transaction-bytes->i2c_mux_bus_drv#clock-cellsassigned-clock-parentsassigned-clocksCannot enable parent %s assigned-clock-rates** Bad HW partition specification %s %s ** bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") %s:%dblk_partitioni2c-parentpoweroff ... #reset-cellsresetsbootstdbootmeth_fixed-linklittle-endianbig-endiannative-endianbootph-allbootph-some-rambootph-pre-rambootph-pre-sramu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplu-boot,dm-vplu-boot,efi-partition-entries-offsetphy-modephy-connection-type%s: %s: error: gpio %s%d not reserved get_value#gpio-cellsSystem reset not supported on this platform resetting ... %s %s: Unsupported now udevice *)(NULL%s %s: %s error %s %s: Max support %d pins now %s %s: Error reading output register %s %s: Error reading direction register %s@%x_gpio@%x_%s %s: Error writing invert register generic_%xi2c_generic_chip_drvMMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Part Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %pUl guid: %pUl maxim,max7356maxim,max7357maxim,max7358maxim,max7367maxim,max7368maxim,max7369nxp,pca9543nxp,pca9544nxp,pca9545nxp,pca9546nxp,pca9547nxp,pca9548nxp,pca9646nxp,pca9847pca954xi2c_muxmarvell,mv64xxx-i2cmarvell,mv78230-i2callwinner,sun4i-a10-i2callwinner,sun6i-a31-i2ci2c_mvtwsimarvell,orion-gpiogpio_mvebunxp,pca9505nxp,pca9534nxp,pca9535nxp,pca9536nxp,pca9537nxp,pca9538nxp,pca9539nxp,pca9554nxp,pca9555nxp,pca9556nxp,pca9557nxp,pca9574nxp,pca9575nxp,pca9698nxp,pcal6408nxp,pcal6416nxp,pcal6524maxim,max7310maxim,max7312maxim,max7313maxim,max7315ti,pca6107ti,tca6408ti,tca6416ti,tca6424ti,tca9539ti,tca9554onsemi,pca9654exar,xra1202pca953xsysconsimple_busmiscfixed-factor-clockfixed_factor_clockfixed-clockfixed_clockISODOSinternalrev-miirev-rmiirgmii-idrgmii-rxidrgmii-txidrtbismiixlgmiimocaqsgmiitrgmii100base-x1000base-x2500base-xrxaui10gbase-r25gbase-rusxgmii10gbase-krqusgmii1000base-kxroot_driver/clocks/firmware/reserved-memorynvmxipefiloadervirtiopvblockblkmaprkmtdubiError when deleting partition "%s" (%d) Removing MTD device #%d (%s) with use count %d Reset %#x never completed mmc_blkmmc_bootdeveMMC >= 4.4 required for enhanced user data area Card does not support partitioning Card does not define HC WP group size User data enhanced area not HC WP group size aligned GP%i partition not HC WP group-size aligned Card does not support enhanced attribute Total enhanced size exceeds maximum (%#x > %#x) Card does not support host controlled partition write reliability settings Card already partitioned MMC: no card present vmmc-supplyvqmmc-supplyCard did not respond to voltage select! : %d mmc%d busy timeout increasing to: %u ms Timeout for status update: %08x %08x Transfer data timeout mv_sdhcap-sd-highspeed%s %s: Invalid "bus-width" value %u! cap-mmc-highspeedsd-uhs-sdr12sd-uhs-sdr25sd-uhs-sdr50sd-uhs-sdr104sd-uhs-ddr50mmc-ddr-1_8vmmc-ddr-1_2vmmc-hs200-1_8vmmc-hs200-1_2vmmc-hs400-1_8vmmc-hs400-1_2vmmc-hs400-enhanced-strobeno-mmc-hs400non-removablecd-invertedbroken-cdno-1-8-vsdhci-caps-masksdhci-capsHardware doesn't specify base clock frequency cd-gpiosAligned buffer alloc failed MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed eMMC%s: %d (%s)drivers/mtd/mtdcore.cBUG at %s:%d/%s()! BUG!%s: unlock failed, writes may not work SF: Failed to set up slave Warning: MTD name "%s" is not unique! mtdids"%s" partitions still in use, can't delete them Minimum partition size 4kiB, %lldB requested No closing ')' found in partition name Empty partition name No partitions allowed after a fill-up Unexpected character '%c' in mtdparts 0x%08llx@0x%08llxspi_flash@%d:%djedec_spi_norInvalid bus %d (err=%d) %s %s: Invalid chip select %d:%d (err=%d) %s %s: Erase operation failed. %s %s: Program operation failed. %s %s: Attempted to modify a protected sector. %s %s: flash operation timed out %s %s: Macronix Quad bit not set %s %s: Failed to enable octal DTR mode unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode: %d Man %06x Snr %04x%04x%c%c%c%c%c%cjedec,spi-norspi_flashMTDmarvell,armada-380-sdhciu-boot,bootdev-mmc%s %s: bad rx status %08x (buffer oversize), size=%d %s %s: bad rx status %08x (crc error), size=%d %s %s: bad rx status %08x (overrun error), size=%d %s %s: bad rx status %08x (max frame length error), size=%d %s %s: bad rx status %08x (resource error), size=%d PCI: Device '%s' on unprobed bus '%s' reset-assert-usreset-deassert-usreset-delay-usreset-post-delay-us%s %s: SMI busy timeout mv88e6xxx-mdio-%dXSMI bus read not valid dm_eth_phy_connect failed %s: No link. %s %s: can't init eth hal %s %s: can't power up port drivers/net/mvneta.cWARNING at %s:%d/%s()! %s %s: %s: can't create rxq=%d %s %s: %s: can't create txq=%d timeout: packet not sent gpio-rangesmarvell,armada-3700-netamarvell,armada-ac5-netadma-rangesFound dma-ranges in root node, shouldn't happen sfptx-disable-gpiophy-reset-gpiosERROR: no/invalid property! ERROR: no/invalid speed given in fixed-link node! full-duplexasym-pauseu-boot,skip-auto-config-until-relocpciVVVV,DDDDCannot find PCI driver marvell,pcie-lanepcie%d.%dnum-lanes%s: property "reg" is invalid %s: cannot get tgt/attr for mem window %s: cannot get tgt/attr for IO window assigned-addresses%s: property "assigned-addresses" not found %s: unable to assign mbus window for mem %s: unable to assign mbus window for io %s: cannot get reset controller: %d %s: cannot request reset controller: %d %s: cannot enable PCIe port: %d regulator-min-microvoltregulator-max-microvoltregulator-init-microvoltregulator-min-microampregulator-max-microampregulator-ramp-delayregulator-force-boot-offregulator-state-memregulator-off-in-suspendregulator-suspend-microvoltgpio-controllerpinconfigWarning: Changing mpp%u function from %s to gpio... regulator-always-onregulator-boot-onregulator-name%s %s: '%s' has nonunique value: '%s %s %s: Failed to read switch ID: %d %s %s: Mismatched PHY mode %s on port %d! %s %s: Missing SMI address mv88e6xxx_mdio%s %s: failed to bind %s: %d %s %s: failed to probe %s: %d ncipncoutportncinport(null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d phy_aneg_timeout%s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done Waiting for PHY realtime link%s: unable to request reset-gpios: %d %s: unable to add mbus window for mem at %08x+%08x %s: unable to add mbus window for IO at %08x+%08x %s: Link up %s: Link down PCI: Failed autoconfig bar %x pci_bridge_drvpci_generic_drvu-boot,pci-pre-relocpci_%x:%x.%xpci,no-autoconfigPCI Autoconfig: %02x.%02x.%02x: Downstream link non-functional PCI Autoconfig: %02x.%02x.%02x: Retrying with speed restricted to 2.5GT/s... PCI Autoconfig: %02x.%02x.%02x: Succeeded! PCI Autoconfig: %02x.%02x.%02x: Failed! Build before PCI Rev2.0Network controllerDisplay controllerMultimedia deviceMemory controllerBridge deviceSimple comm. controllerBase system peripheralInput deviceDocking stationProcessorSerial bus controllerIntelligent controllerSatellite controllerCryptographic deviceDSPDoes not fit any classMass storage controller%s %s: unrecognized JEDEC id bytes: %02x, %02x, %02x m25p,fast-readSF: Detected %s with page size , erase size , total pinctrl-namespinctrl-%d%s %s: could not find pctldev stdout-pathNo serial driver foundregulatormarvell,mv88f6810-pinctrlmarvell,mv88f6820-pinctrlmarvell,mv88f6828-pinctrlarmada-38x-pinctrlpcie0rstouti2c1sdaspi1cs0sd0pcie1clkreqsckpcie2misoua1rxdtxdmdcdramdeccerrmosics1sata0prsntsata1ge0txerrtdmaudiobclkptpevreqsdidtxsdotrigdrxextclksata2sata3fsynclrclkvttctrlpclkmclkrefclk_out1clk_out0cs2rb1ua0ad7ge1rxctlcs3burst/lastrb0rxd3ad6rxd2rxd1ad4rxclkad8ad1ad3txctlwe0txd3ale1txd2oetxd1ale0txd0ad5spi0txclkoutreadyad2ad0rxd0bootcstxclkrxerrmdio slavemdc slavewe1pcie3ad15ad14ad13ad12ad11ad10ad9crsi2c0marvell,armada-xp-pciemarvell,kirkwood-pciepcie_mvebu_baseFixed PHYMarvell 88E1011SMarvell 88E1111SMarvell 88E1118Marvell 88E1118RMarvell 88E1145Marvell 88E1149SMarvell 88E1240Marvell 88E151xMarvell 88E1310Marvell 88E1121RMarvell 88E1680marvell,armada-370-netamarvell,armada-xp-netamvnetamarvell,orion-mdiomarvell,xmdiomvmdiomarvell,mv88e6085mv88e6xxxeth_phy_genericeth_phy_generic_drvmpp0mpp1mpp2mpp3mpp4mpp5mpp6mpp7mpp8mpp9mpp10mpp11mpp12mpp13mpp14mpp15mpp16mpp17mpp18mpp19mpp20mpp21mpp22mpp23mpp24mpp25mpp26mpp27mpp28mpp29mpp30mpp31mpp32mpp33mpp34mpp35mpp36mpp37mpp38mpp39mpp40mpp41mpp42mpp43mpp44mpp45mpp46mpp47mpp48mpp49mpp50mpp51mpp52mpp53mpp54mpp55mpp56mpp57mpp58mpp59pcie_mvebuGeneric PHYmx25l2005amx25l4005amx25l8005mx25l1606emx25l3205dmx25l6405dmx25u2033emx25u1635emx25u3235fmx25u6435fmx25l12805dmx25u12835fmx25u51245gmx25l12855emx25l25635emx25u25635fmx25v8035fmx25r1635fmx25l25655emx66l51235lmx66u51235fmx25u51245fmx66u1g45gmx66u2g45gmx66l1g45gmx66l2g45gmx25l1633emx25r6435fmx66uw2g345gx0mx66lm1g45gmx25lm51245gmx25lw51245gmx25lm25645gmx66uw2g345gmx66um1g45gmx66uw1g45gmx25uw51245gmx25uw51345gmx25um25645gmx25uw25645gmx25um25345gmx25uw25345gmx25uw12845gmx25uw12345gmx25uw6445gmx25uw6345gs25sl032ps25sl064ps25fl256s0s25fl256s1s25fl512ss25fs064ss25fs128ss25fs256ss25fs512ss25fl512s_256ks25fl512s_64ks25fl512s_512ks70fs01gs_256ks25sl12800s25sl12801s25fl128ss25fl129p0s25fl129p1s25sl008as25sl016as25sl032as25sl064as25fl116ks25fl164ks25fl208ks25fl064ls25fl128ls25fl256ls25hl512ts25hl01gts25hl02gts25hs512ts25hs01gts25hs02gts25fs256tw25p80w25p16w25p32w25x05w25x40w25x16w25x32w25q20clw25q20bww25q20eww25q32w25q16dww25q32dww25q16jvw25q32jvw25q32jwmw25q256jwmw25x64w25q64dww25q64jvw25q128fww25q128jvw25q128jww25q256fww25q256jww25q512jvw25q512nwqw25q512nwmw25q512jvqw25q01jvw25q01jvfimw25q02jvw25q80w25q80blw25q16clw25q32bvw25q64cvw25q128w25q256w25m512jww25m512jvw25h02jvw77q51nwmcu_%s %s: Cannot set speed (err=%d) %s %s: Cannot set mode (err=%d) *** spi_xfer: Time out during SPI transfer ## Baudrate %d bps not supported ## Baudrate may not be deleted spi-max-frequencyusb,device-classusb,interface-classreg-offsetreg-shiftreg-io-widthspi-cpolspi-cphaspi-cs-highspi-3wirespi-half-duplexspi-tx-bus-widthspi-tx-bus-width %d not supported spi-rx-bus-widthspi-rx-bus-width %d not supported ahci_scsiout of buffer pointers (%zu bytes left) nvme#%d%s: No memory for ataid[port] ATA scsi_ahci: Error: buffer too small. scsi_ahci: SCSI READ CAPACITY10 command failure. No ATA info! Please run SCSI command INQUIRY first! scsi_ahci: SCSI READ CAPACITY16 command failure. No ATA info! Please run SCSI command INQUIRY first! Unsupport SCSI command 0x%02x 64bit ncq ilck stag pm clo nz only pmp fbss pio slum part ccc ems sxs apst nvmp boh controller reset failed (0x%x) Target spinup took %d ms. AHCI %02x%02x.%02x%02x %u slots %u ports %s Gbps 0x%x impl %s mode SATAflags: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s No Link on this port! %s: No mem for table! Can not start port %d SATA link %d timeout. timeout-sechw_margin_msu-boot,noautostartu-boot,autostartpagesizefixed-partitionsturris-omnia-mcu-gpioError: turris_omnia_mcu CMD_GET_STATUS_WORD failed: %d Error: turris_omnia_mcu CMD_GET_FEATURES failed: %d turris-omnia-mcu-sysresetturris-omnia-mcu-trngrtc-soc%s: io address missing fixedclock-namesTimeout poll on interrupt endpoint non-bulk pipe (type=%lu)non-interrupt pipe (type=%lu)drivers/usb/host/xhci.cVirt dev for slot[%d] already allocated Failed to allocate virtual device Could not allocate xHCI USB device data structures %s %s: Invalid cs %d (err=%d) tick-timerERROR: status = %x, phase = %d, head = %d Error: malloc prp_pool fail 0x%.4xError: %s: Controller not ready! Error: %s: Out of memory! nvme-blknvme_bootdevbootdev: returning err=%d Failed to probe '%s': err=%dE Failed to init PCI (%dE) scanning bus for devices... Unbinding from %s failed (%dE) Rescanning SATA bus for devices... Scanning %s failed (%dE) unable to unbind devices (%dE) id%dlun%dscsi_blkscsi_bootdevevery %ldmsWDT: Started %s with%s servicing %s (%ds timeout) Bus %s: Port not available. Bus %s: probe failed, error %d companionFailed to get companion (ret=%d) Bus %s: No USB Device found %d USB Device(s) found No USB controllers found Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) generic_bus_%x_dev_%xusb_dev_generic_drvEHCI fail timeout STS_ASS reset marvell,armada-3700-ehcimarvell,ac5-ehciEHCI fail to reset USB EHCI %x.%02x Error: Cannot find high speed parent of usb-1 device unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error Host not halted after %u microseconds. Evaluate ContextConfigure EndpointERROR: %s command returned completion code %d. non-control pipe (type=%lu)The request port(%d) exceeds maximum port number unknown value DT_STRING %x unknown value %x unknown feature %x Unknown request drivers/usb/host/xhci-mem.cSetup ERROR: address device command for slot %d. Device not responding to set address. ERROR: Incompatible devicefor address device command. ERROR: unexpected command completion code 0x%x. Failed to configure xHCI endpoint drivers/usb/host/xhci-ring.cmarvell,orion-ehciehci_mvebuu-boot,bootdev-usbmarvell,armada-380-wdtorion_wdtwatchdogu-boot,bootdev-scsimarvell,armada-380-rtcrtc-armada38xcznic,turris-omnia-mcui2c-eepromatmel,24c01atmel,24c01aatmel,24c02atmel,24c04atmel,24c08atmel,24c08aatmel,24c16aatmel,24mac402atmel,24c32atmel,24c32d-wlatmel,24c64atmel,24c128atmel,24c256atmel,24c512st,24256e-wli2c_eeprommarvell,armada-3700-ahcimarvell,armada-8k-ahcicavium,octeon-7130-ahcigeneric-ahciahci_genericu-boot,bootdev-satasata_bootdevahci-pciahci_pciu-boot,bootdev-nvmemarvell,orion-timermarvell,armada-370-timermarvell,armada-xp-timerorion_timermarvell,orion-spimarvell,armada-375-spimarvell,armada-380-spimarvell,armada-xp-spimvebu_spins16550ns16550aingenic,jz4780-uartnvidia,tegra20-uartsnps,dw-apb-uartintel,xscale-uartns16550_serial i2c_eeprom_partition1.5fs/btrfs/extent-io.cenv_buf [%u bytes] too small for value of "%s" ^%s$eth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,\.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" BTRFS: dirty eb leak (aborted trans): start %llu len %u %s: Unsupported compression in extent: %i fs/btrfs/ctree.cleaf free space ret %d, leaf data size %u, used %d nritems %d BTRFS: Couldn't map the block %llu BTRFS: devid %llu is missing BTRFS: read failed on devid %llu physical %llu vbus-supplyFailed to turn ON the VBUS regulator MVEBU XHCI INIT controller @ 0x%llx Register %x NbrPorts %d Starting the controller USB XHCI %x.%02x WARN urb submitted to disabled ep WARN waiting for error on ep to be cleared WARN endpoint is halted ERROR unknown endpoint state for ep Unexpected XHCI event TRB, skipping... (%08x %08x %08x %08x) XHCI timeout on event type %d... Resetting EP %d... abort_td: Expected a TRB_TRANSFER TRB first missing environment variable: %s *** Warning - %s, using default environment spi_flash_probe_bus_cs() failedErasing SPI flash...Writing to SPI flash...malloc() failedspi_flash_read() failedCannot import environment: errno = %d import failed## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' Could not find "%s" partition Couldn't find partition %s %s ** Reading file would overwrite reserved memory ** ** Unable to write file %s ** %s/ %s %8lld %s %d file(s), %d dir(s) %llu bytes written in %lu ms (** Unable to create a directory "%s" ** Cannot lookup ino %llu Ino %llu does not exist BTRFS: Extent for symlink %llu must be INLINE type! BTRFS: Extent for symlink %llu must not be compressed! BTRFS: Symlink %llu extent data too large (%llu)! No mapping for %llu-%llu Invalid mapping for %llu-%llu, got %llu-%llu invalid number of items %llu leaf is not a leaf %llu leaf free space incorrect %llu %d leaf parent key incorrect %llu bad key ordering %d %d incorrect offsets %u %u bad item end %u wanted %u slot end outside of leaf %llu > %llu BTRFS: tree block bytenr %llu is not aligned to sectorsize %u parent transid verify failed on %llu wanted %llu found %llu Ignoring transid failure Couldn't map the block %Lu checksum verify failed on %llu found %08X wanted %08X bad tree block %llu, fsid mismatch, want=%s, have=%s bytenr mismatch, want=%llu, have=%llu bad level, %u > %d invalid nr_items: %u Csum didn't match BTRFS: child eb corrupted: parent bytenr=%llu item=%d parent level=%d child level=%d BTRFS: Cannot lookup file %s BTRFS: Not a regular file: %s BTRFS: Failed to get inode size: %s BTRFS: An error occurred while reading file %s fs/btrfs/root-tree.cfs/btrfs/disk-io.cBTRFS: Can't find root %llu BTRFS: Can't find inode %llu %.3s %.3s %.2d %.2d:%.2d:%.2d %d BTRFS: Can't alloc memory for symlink %llu BTRFS: Failed to read symlink %llu <%s> ?%3u? %4llu,%5llu %10llu %24.24s %.*s -> %sCannot lookup path %s BTRFS: Not a directory: %s BTRFS: An error occurred while listing directory %s BTRFS: unsupported checksum algorithm %u BTRFS: superblock checksum mismatch BTRFS: tree_root level too big: %d >= %d BTRFS: chunk_root level too big: %d >= %d BTRFS: log_root level too big: %d >= %d BTRFS: tree_root block unaligned: %llu BTRFS: chunk_root block unaligned: %llu BTRFS: log_root block unaligned: %llu BTRFS: nodesize too small: %u < 4096 BTRFS: nodesize unaligned: %u BTRFS: sectorsize too small: %u < 4096 BTRFS: sectorsize unaligned: %u BTRFS: invalid total_bytes 0 BTRFS: invalid bytes_used %llu BTRFS: invalid stripesize %u BTRFS: dev_item UUID does not match fsid: %s != %s BTRFS: suspicious number of devices: %llu BTRFS: number of devices is 0 BTRFS: system chunk array too big %u > %u BTRFS: system chunk array too small %u < %zu BTRFS: superblock checksum matches but it has invalid members Superblocktry btrfsck --repair -s ie, 0,1,2MetadataBTRFS: invalid chunk item size, have %u expect [%zu, %zu) BTRFS: invalid num_stripes, have %u expect non-zero BTRFS: invalid chunk item size, have %u expect %lu BTRFS: invalid chunk logical %llu BTRFS: invalid chunk sectorsize %llu BTRFS: invalid chunk length %llu BTRFS: invalid chunk stripe length: %llu BTRFS: invalid chunk type %llu BTRFS: unrecognized chunk type: %llu BTRFS: missing chunk type flag: %llu BTRFS: conflicting chunk type detected: %llu BTRFS: invalid num_stripes: %u BTRFS: Invalid num_stripes:sub_stripes %u:%u for profile %llu BTRFS: %s checksums match, but it has an invalid chunk, %s warning, device %llu is missing BTRFS: failed to add chunk map start=%llu len=%llu: %d (%m) BTRFS: adding devid %llu gen %llu but found an existing device gen %llu Failed to allocate memory for fs_info no device found for devid %llu, skip it ERROR: Filesystem UUID change in progress couldn't open because of unsupported option features (%llx). ERROR: nodesize %u too small to read superblock ERROR: invalid number of stripes %u in sys_array at offset %u ERROR: unexpected item type %u in sys_array at offset %u ERROR: sys_array too short to read %u bytes at offset %u BTRFS: Seed device is not yet supported BTRFS: cannot read chunk root Couldn't read chunk tree csumBTRFS: could not setup %s tree Couldn't read tree root SPIFlashmarvell,armada3700-xhcimarvell,armada-380-xhcimarvell,armada-8k-xhcixhci_mvebuDIRCHRBLKFIFSCKSYM<>:"/\|?*error: overflow occurs Error: writing directory entry Cannot free EFI memory pool efiblk#%defi_blkefi_disk addEvent registration for efi_disk add failed efi_disk delEvent registration for efi_disk del failed EFI block driverDM_TAG_EFI not found /EFI/BOOT/%s%s %d:%u%s %d1234567FAT sector size mismatch (fs=%u, dev=%lu) FAT cluster size not set FAT cluster size too big (cs=%u, max=%u) %02X%02X-%02X%02XInvalid FAT entry: %#08x Error get-and-setting cluster Error: no space left: %llu ** Invalid Block Device Descriptor (NULL) ** Read outside partition %lu ** %s read error ** ** %s read error - block * %s read error - last part invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** fs uses incompatible features: %08x, ignoring Failed to iterate over directory %s ** File not found %s ** UInvalid load option for %ls Loading %ls '%ls' failed Booting: Label: %ls Device path: %pD Unloading image failed Invalid FAT entry Error reading cluster %.*s.%.3s~%dFAT: illegal filename (%s) %s: doesn't exist (%d) Error: writing contents Error: flush fat buffer %s: already exists . .. Error: out of memory Error: cannot remove root Error: directory is not empty: %d delete boot option(%ls) failed invalid image type: %u Partition %d: invalid GUID %s StaticDHCPMemoryMapped(0x%x,0x%llx,0x%llx)VenHw(%pUlCtrl(0x%0x)Acpi(PNP%04X,%d)Ata(%d,%d,%d)Scsi(%u,%u)Uart(%lld,%d,%c,USB(0x%x,0x%x)MAC(IPv4(%pI4,TCP,UDP,,%pI4,%pI4UsbClass(0x%x,0x%x,0x%x,0x%x,0x%x)Sata(0x%x,0x%x,0x%x)NVMe(0x%x,%s%02xUri(%s(%u)HD(%d,MBR,0x%08x,0x%llx,0x%llx)HD(%d,GPT,%pUl,0x%llx,0x%llx)HD(%d,0x%02x,0,0x%llx,0x%llx)CDROM(%u,0x%llx,0x%llx)VenMedia(%pUl%lsDNEOMSReserved memory mapping failed addr %llx size %llx [%u;%u;%um[%d;%dH[?25%cethact EFI: Watchdog timeout %s/%sboardver%s/%s%s%s%s.dtb%s: illegal free 0x%llx, 0x%zx %s: illegal free 0x%p EFI application exitedHandle %p has protocols installed. Unable to delete Httphttp://MemhostfsDisk %s not ready Adding block device %s failed, r = %lu Adding partition for %s failed failed to set watchdog timer ## Application failed, r = %lu ## %ls bad file path! ERROR: Failure to install protocols for loaded image Not a PE-COFF file Invalid number of sections: %d Invalid optional header magic %x Unknown Relocation off %x type %x Machine type 0x%04x is not supported Cannot persist EFI variables without system partition ubootefi.varFailed to persist EFI variables need device tree invalid $fdt_addr or $fdtcontroladdr invalid device tree Unable to free up existing FDT memory region Failed to reserve space for FDT failed to process device tree kaslr-seedError deleting %s rng-seedfailed to install device tree 78Failed to load EFI variables Invalid EFI variables file Failed to set EFI variable %ls ERROR: Secure state transition failed en-USEFI: cannot initialize platform language settings Failed to install ECPT Missing RNG device for EFI_RNG_PROTOCOL Cannot install EFI_RNG_PROTOCOL ERROR: Failed to register network event ERROR: Failed to set network timer ERROR: Failure to add protocol No SMBIOS tables to install ERROR: Failed to register watchdog event Error: Cannot initialize UEFI sub-system, r = %lu BootNext must be 16-bit integer Loading from BootNext failed, falling back to BootOrder Deleting BootNext failed BootOrder not defined EFI boot manager: Cannot load any image Can't find %pD specified in Boot#### Can't read fdt Booting %pD Loading image failed Uninstalling protocol interfaces failed /./../dtb/dtb/current/dtbs_SM3_Failed to write SMBIOS table Can't find initrd specified in Boot#### 10/01/2025manufacturerproductasset-tagchassis-locationsocket-designskufamilyinstalling EFI_LOAD_FILE2_PROTOCOL failed Creating event failed %d.%d.%d.%dlinux,phandle#address-cellsbaseboardFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGSbioschassisprocessorunknown compression methodincorrect header checkunknown header flags setinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid distance too far backinvalid distance codeinvalid literal/length codeincorrect data checkincorrect length check%s: zstd_init_dctx() failed %s: failed to detect compressed size: %d %s: failed to decompress: %d Error: Bad gzipped data Error: gunzip out of data in header Error: inflateInit2() returned %d Error: inflate() returned %d RE is too long (code overflow)RE is too long (data overflow)Jump offset is too big okay### ERROR ### Please RESET the board ### device-nameNo closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\Could not read count from timer (err %d) bootpretransmitperiodinit%u Bytes%s%lu.%ld %ciB%s done LMB Map notify failure %lu %s.count = %#x %s[%d] [%#llx-%#llx], %#llx bytes, flags: invalid %#x unknown cmd (%d) at %d Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root PathNIS Domain NameError: Failed to allocate pxelinux_configfile *** Unhandled DHCP Option in OFFER/ACK: %d TFTP server died %s; starting again %s %s: Failed to register fixed-link for CPU port Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s No valid MAC address found. %s %s: couldn't allocate mii_bus %s %s: couldn't get reset-gpios: %d mdio_register: non unique device name '%s' %s %s: Packets cannot be steered to ports ethernet-ports%s %s: ports node is missing under DSA device! %s %s: invalid number of ports (%d) %s %s: master eth node missing! %s %s: CPU port node not valid! %s@%ddsa-port Error: eth device name "%s" has a space! eth_bootdev%s.%dmarvell,U-Boot.armv7pxeuuidInvalid pxeuuid: %s ## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx octetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation Failed## Warning: gatewayip needed but not set Retry count exceededT blksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again TFTP error: '%s' (%d) Not retrying... *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set fromtftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device TFTP %s server %pI4; our IP address is %pI4; sending through gateway %pI4Filename '%s'.Save address: 0x%lx Save size: 0x%lx Saving: *Load address: 0x%lx Loading: *ethrotatebootpretryperiodbootpretransmitperiodmaxBOOTP broadcast %d Retry time exceeded; starting again ARP Retry count exceeded; starting again Abort Bytes transferred = %u (%x hex) DHCP client bound to address %pI4 (%lu ms) autoloadCannot autoload with TFTPGET DHCP: INVALID STATE invalid dir item size BTRFS: %s: Name too long at "%.*s" Invalid port number %d timeout exit! groupsfunctionu-boot,bootdev-ethdsanvlanphyphy-devicembrmsftraidswaplvmu-boot-envcros-kerncros-rootcros-fwcros-rsrvEFI System Partitionno-overwriteno-notify%s %s algo: key-name-hintinvalid/unsupported (required)padding%s %s padding: %s %s %s value: %s Timestamp: dm_pci_bus_to_phys: invalid physical address Status Error: %#08x Timeout waiting card ready CD001EL TORITO SPECIFICATIONuuid_disk=;name=,start=0x,size=0x,uuid=,uuid_diskError: is the partitions string NULL-terminated? Wrong uuid format for partition %d Scanning bus %s failed, error %d %s.%s%dfs/btrfs/volumes.cMissing bootstd device Env export buffer too small: %lu, but need %lu ${...}HashsignatureSign%s Created: %s Type: %s %s Compression: %s %s Data Start: %s Data Size: %s Architecture: %s %s OS: %s %s Load Address: %s Load Address: 0x%08lx %s Entry Point: Unknown Phase## Loading %s (%s) from FIT Image at %08lx ... Bad FIT %s image format! (err=%d) Could not find configuration node Using '%s' configuration Could not find subimage node type '%s' Trying '%s' %s subimage Verifying Hash Integrity ... No %s %s %s Image Could not find %s subimage data! Can't get %s subimage load address! Error: %s overwritten Loading %s from 0x%08lx to 0x%08lx Error decompressing %s WARNING: 'compression' nodes for ramdisks are deprecated, please fix your .its file! Subimage data is not a FDT No such field '%s' %s%daddr%saddr01-%02x-%02x-%02x-%02x-%02x-%02xset_dir_flagsUnable to update property %s:%s, err=%s Can't find node with compatible "%s": %s Can't generate phandle: %s Can't set phandle %u: %s device '%s' failed to unbind disabled%s: %s: %s %04X.callbacks.flagshimport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %pM%s: readonly variablelist passed to list_sort() too long for efficiency U-Boot phaseSPL Phasedefault-arm-mvebu-turris_omniadefault-arm-mvebudefault-armEHCI failed: timeout when disabling periodic list EHCI failed: timeout when enabling periodic list memory allocation error while creating partitions for "%s" mtd: partition "%s" is out of reach -- disabled mtd: partition "%s" extends beyond the end of device "%s" -- size truncated to %#llx drivers/mtd/mtdpart.cmtd: partition "%s" doesn't start on an erase block boundary -- force read-only mtd: partition "%s" doesn't end on an erase block -- force read-only bad length %d < %d ICMP Host Redirect to %pI4 eth%dmacskipethmacskip Error: %s address %pM illegal value Warning: %s failed to set MAC address netretryonceUNKNOWN(%04x,%04x)Unknown csum type %d invalid dir item name len: %u invalid dir item name + data len: %u + %u Can't set block device ** No boot file defined ** Failed to load '%s' %llu bytes read in %lu ms## Error: illegal character '=' in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue EHCI failed to shut down host controller. marvell,reg-initPHY reset timed out mtdpartsmtdparts=Wrong mtdparts: %s MTD name too long: %s Could not find a valid device for %s Not enough space to save partitions meta-data Partition size must be a multiple of %d Could not parse device %s Failed parsing MTD partitions from mtdparts! read-onlyFailed parsing MTD %s OF partitions! Timeout waiting for cmd & data inhibit Error while setting tap delay Error configuring dll Error while configuring dll Internal clock never stabilised. Error enabling VMMC supply : %d set_valuecannot reset port %i!? *?[\ %02lx %04lx%s %s: dm_rng_read failed: %d WARNING: could not set kaslr-seed %s. partition@%llxFailed fixing SPI NOR partitions! Cannot add window '%04x:%04x', conflicts with another window UEFI image [0x%p:0x%p] pc=0x%zx '%pD'## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... Ramdisk image is corrupt or invalid RD## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwrittenconfig with overlays but CONFIG_OF_LIBFDT_OVERLAY not set ## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeCould not find a valid device tree FDTThe given image format is not supported (corrupt?) Loadable(s) is corrupt or invalid bootmethusb-hubfixed_rate_raw_clocknopsimple-bussimple-mfdi2c_generici2c-chippci-bridgepci_genericpci-genericspi_genericsata_blkusb_dev_generic  [:] [:] [] - boot EFI payload bootefi bootmgr [fdt address] - load and boot EFI payload based on BootOrder/BootXXXX variables. If specified, the device tree located at gets exposed as EFI configuration table. scan - boot first available bootflow [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead For the new multi component uImage format (FIT) addresses must be extended to include component or configuration unit name: addr: - direct component image specification addr# - configuration specification Use iminfo command to get the list of existing component images and configurations. Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OS[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead '@ F@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?demo - register cyclic demo function cyclic list - list cyclic functions SunMonTueWedThuFriSatbootcmd=run distro_bootcmdbootdelay=3baudrate=115200ethprime=eth2loadaddr=0x800000arch=armcpu=armv7board=turris_omniaboard_name=turris_omniavendor=CZ.NICsoc=mvebuusb_ignorelist=mtdids=mtdparts=fdt_high=0x10000000initrd_high=0x10000000kernel_addr_r=0x1000000fdt_addr_r=0x2000000ramdisk_addr_r=0x2200000scriptaddr=0x1800000pxefile_addr_r=0x1900000fdtfile=armada-385-turris-omnia.dtbconsole=ttyS0,115200bootcmd_rescue=i2c dev 2; i2c mw 0x2a.1 0x3 0x1c 1; i2c mw 0x2a.1 0x4 0x1c 1; mw.l 0x01000000 0x00ff000c; i2c write 0x01000000 0x2a.1 0x5 4 -s; setenv bootargs "earlyprintk console=ttyS0,115200 omniarescue=$omnia_reset rescue_mode=$omnia_reset"; sf probe; sf read 0x1000000 0x100000 0x700000; lzmadec 0x1000000 0x1700000; if gpio input gpio@71_4; then bootm 0x1700000#sfp; else bootm 0x1700000; fi; bootz 0x1000000mmc_boot=if mmc dev ${devnum}; then devtype=mmc; run scan_dev_for_boot_part; fiboot_pci_enum=pci enumboot_net_usb_start=usb startusb_boot=usb start; if usb dev ${devnum}; then devtype=usb; run scan_dev_for_boot_part; fisata_boot=if sata dev ${devnum}; then devtype=sata; run scan_dev_for_boot_part; fiscsi_init=if ${scsi_need_init}; then scsi_need_init=false; scsi scan; fiscsi_boot=run boot_pci_enum; run scsi_init; if scsi dev ${devnum}; then devtype=scsi; run scan_dev_for_boot_part; finvme_init=if ${nvme_need_init}; then setenv nvme_need_init false; nvme scan; finvme_boot=run boot_pci_enum; run nvme_init; if nvme dev ${devnum}; then devtype=nvme; run scan_dev_for_boot_part; fiboot_efi_bootmgr=if fdt addr -q ${fdt_addr_r}; then bootefi bootmgr ${fdt_addr_r};else bootefi bootmgr;fiboot_efi_binary=load ${devtype} ${devnum}:${distro_bootpart} ${kernel_addr_r} efi/boot/bootarm.efi; if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r};else bootefi ${kernel_addr_r} ${fdtcontroladdr};fiload_efi_dtb=load ${devtype} ${devnum}:${distro_bootpart} ${fdt_addr_r} ${prefix}${efi_fdtfile}efi_dtb_prefixes=/ /dtb/ /dtb/current/scan_dev_for_efi=setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; for prefix in ${efi_dtb_prefixes}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${efi_fdtfile}; then run load_efi_dtb; fi;done;run boot_efi_bootmgr;if test -e ${devtype} ${devnum}:${distro_bootpart} efi/boot/bootarm.efi; then echo Found EFI removable media binary efi/boot/bootarm.efi; run boot_efi_binary; echo EFI LOAD FAILED: continuing...; fi; setenv efi_fdtfileboot_prefixes=/ /boot/boot_scripts=boot.scr.uimg boot.scrboot_script_dhcp=boot.scr.uimgboot_targets=mmc0 nvme0 scsi0 usb0 pxe dhcp boot_syslinux_conf=extlinux/extlinux.confboot_extlinux=sysboot ${devtype} ${devnum}:${distro_bootpart} any ${scriptaddr} ${prefix}${boot_syslinux_conf}scan_dev_for_extlinux=if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${boot_syslinux_conf}; then echo Found ${prefix}${boot_syslinux_conf}; run boot_extlinux; echo EXTLINUX FAILED: continuing...; fiboot_a_script=load ${devtype} ${devnum}:${distro_bootpart} ${scriptaddr} ${prefix}${script}; source ${scriptaddr}scan_dev_for_scripts=for script in ${boot_scripts}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${script}; then echo Found U-Boot script ${prefix}${script}; run boot_a_script; echo SCRIPT FAILED: continuing...; fi; donescan_dev_for_boot=echo Scanning ${devtype} ${devnum}:${distro_bootpart}...; for prefix in ${boot_prefixes}; do run scan_dev_for_extlinux; run scan_dev_for_scripts; done;run scan_dev_for_efi;scan_dev_for_boot_part=part list ${devtype} ${devnum} -bootable devplist; env exists devplist || setenv devplist 1; for distro_bootpart in ${devplist}; do if fstype ${devtype} ${devnum}:${distro_bootpart} bootfstype; then part uuid ${devtype} ${devnum}:${distro_bootpart} distro_bootpart_uuid ; run scan_dev_for_boot; fi; done; setenv devplistbootcmd_mmc0=devnum=0; run mmc_bootbootcmd_nvme0=devnum=0; run nvme_bootbootcmd_scsi0=devnum=0; run scsi_bootbootcmd_usb0=devnum=0; run usb_bootbootcmd_pxe=run boot_net_usb_start; run boot_pci_enum; dhcp; if pxe get; then pxe boot; fibootcmd_dhcp=devtype=dhcp; run boot_net_usb_start; run boot_pci_enum; if dhcp ${scriptaddr} ${boot_script_dhcp}; then source ${scriptaddr}; fi;setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; setenv efi_old_vci ${bootp_vci};setenv efi_old_arch ${bootp_arch};setenv bootp_vci PXEClient:Arch:00010:UNDI:003000;setenv bootp_arch 0xa;if dhcp ${kernel_addr_r}; then tftpboot ${fdt_addr_r} dtb/${efi_fdtfile};if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r}; else bootefi ${kernel_addr_r} ${fdtcontroladdr};fi;fi;setenv bootp_vci ${efi_old_vci};setenv bootp_arch ${efi_old_arch};setenv efi_fdtfile;setenv efi_old_arch;setenv efi_old_vci;distro_bootcmd=scsi_need_init=; setenv nvme_need_init; for target in ${boot_targets}; do run bootcmd_${target}; done-///)/+_cg kt!%60123456789ABCDEFcompat Dump list of drivers with compatibility strings dm devres Dump list of device resources for each device dm drivers Dump list of drivers with uclass and instances dm static Dump list of drivers with static platform data dm tree [-s][-e][name] Dump tree of driver model devices (-s=sort) dm uclass [-e][name] Dump list of instances for each uclass$9/13;579 !(5AN[fs~."*&'hUh=OtUR1h(+.ܾ1 в% (H_7arocsdxbimdefault [-k] [-f] -a - [forcibly] reset default environment env default [-k] [-f] var [...] - [forcibly] reset variable(s) to their default values "-k": keep variables not defined in default environment env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...]  addr [-c] [-q] [] - Set the [control] fdt location to fdt boardsetup - Do board-specific set up fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.  *0.&&&& [0123456789abcdefbus [muxtype:muxaddr:muxchannel] - show I2C bus info i2c crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length [-s] - write memory to I2C; the -s option selects bulk write in a single transaction i2c flags chip [flags] - set or get chip flags i2c olen chip [offset_length] - set or get chip offset length i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speed+,<=>:;"/\|?*[] )addr part [dest] - extract from legacy image at and copy to addr uname [dest] - extract subimage from FIT image at and copy to R j068@|9/4CDT{2#=L BN.f($v[Im%rdhԤ\]elpHP^FWث XE,?k:AOgst"57unGq)ʼnobV>Ky xZݨ31Y'_`QJ -zɜ;M* [ []] mtd dump[.raw][.oob] [ []] mtd write[.raw][.oob][.dontskipff] [ []] mtd erase[.dontskipbad] [ []] Specific functions: mtd bad With: : NAND partition/chip name (or corresponding DM device name or OF path) : user address from/to which data will be retrieved/stored : offset in in bytes (default: start of the part) * must be block-aligned for erase * must be page-aligned otherwise : length of the operation in bytes (default: the entire device) * must be a multiple of a block for erase * must be a multiple of a page otherwise (special case: default is a page with dump) The .dontskipff option forces writing empty pages, don't use it if unsure. #(-27fHa5WiَU(ߌ BhA-Tprobe [[bus:]cs] [hz] [mode] - init flash device on given SPI bus and chip select sf read addr offset|partition len - read `len' bytes starting at `offset' or from start of mtd `partition'to memory at `addr' sf write addr offset|partition len - write `len' bytes from memory at `addr' to flash at `offset' or to start of mtd `partition' sf erase offset|partition [+]len - erase `len' bytes from `offset' or from start of mtd `partition' `+len' round up `len' to block size sf update addr offset|partition len - erase and write `len' bytes from memory at `addr' to flash at `offset' or to start of mtd `partition' sf protect lock/unlock sector len - protect/unprotect 'len' bytes starting at address 'sector'[][:[]|#[]] - Run script starting at addr - A FIT config name or subimage name may be specified with : or # (like bootm). If the image or config name is omitted, the default is used.    !R\248>Ž ;] - get/set current watchdog device wdt start [flags] - start watchdog timer wdt stop - stop watchdog timer wdt reset - reset watchdog timer wdt expire [flags] - expire watchdog timer immediately ޑ`VMﲎA_E#Su=Ll~hQb*F07 /$NX46ܴ[v}R^@yԍgrO톚fx%K]?!pcwB &þ5.UzȺ2DT; k(dt HC91ՋnIجGoJ\8Wsˡ>a |q̐ji:'+"ҩ3-<ɇPY eׄЂ)Z{m, TP}bE@ g[jZAO\4sS? Re^( 6=&i͟t.-Ma{>qh,`FKJk*UDHuc0mL5/9WG+f~)7,%ٮMD_Vi`{r !(3:╜Ӥ|ungXQJC4=&/ 蟖GNU\cjqx+"90 .'<5BKPYfot}18#*ypkb]TOF ,':1XSNEtbi{pmfW\AJ#(5>ǮFMP[ja|w29$/=6+  ensxIB_TƯGLQZk`}v 38%.<7*! doryHC^U -&;0YRODu~chzqlgV]@K")4? 49.#her\QFK󸵢kfq|_REH7:- m`wzYTCN1<+& 2?(%nctyZW@M >3$)boxuV[LAal{vUXOB =0'*gj}pS^ID;6!, 85"/di~sP]JG86$*p~lbHFTZʐ񫥷;5') KEWYs}oaMCQ_u{ig=3!/ vxjdN@R\>0",AO]Sywek1?-# ztfhBL^P 2<. Ɯ 4:(&|r`nDJXV79+%GI[UqcmZX'1 p56,3+$4/Iz,P-+8z&pvh5>vv|vh5>vv4lv&5T?vh5>x][Ddd|et|0xiXkxt zaQV[[WH>Լ04>4༉5685 2H^ u$(,.024682:J<Y=g>v@BD "$ &#(>,Z0p28J<Y=g> $(,.0J<Y=>?+ : P [ htywL6wрр L6PxррL6vррL6LrррL6xрр ,6uрр ,6 @рр~L6vрр L6uррL6uрр`L6ppррL6qрр`,6HaррdL6ldррL`L6ldррL`L6ldррL`NL6lррL`mщ,6cррL`kL6,Tррd,6TррL6d_ррL6hUррNL6pVрр ͉,6Sрр",6WррiL6Xрр`,6YррL6YррL6^рр@ˊ,6(рр༉,6ррi,6рр,6ррk,6Dрр),6`рр,6\рр,6hррr,6ррd,64ррL6ррQ,6ррx,6рр[^,6pррhʼn,6ррu|0801 u1 1 1 _= &f 1 tftpusb`ʁmmc``sataɁ8spi\nand9MKZ>ixy1 1W`,6|ррi,6ррdž,6 рр ,6рр[^,6рр=1,6XррM1,6Lрр&,6䣁ррi,6рр`,6̠ррPʼn,6ܟррX X ` ` h h p p x x !!!!!!!! ! !(!(!0!0!8!8!@!@!H!H!P!P!X!X!`!`!h!h!p!p!x!x!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!"""""""" " "("("0"0"8"8"@"@"H"H"P"P"X"X"`"`"h"h"p"p"x"x"""""""""""""""""""""""""""""""""######## # #(#(#0#0#8#8#@#@#H#H#P#P#X#X#`#`#h#h#p#p#x#x#################################$$$$$$$$ $ $($($0$0$8$8$@$@$H$H$P$P$`$`$@!Lم0DةDHڅ4Hܧ8h< xxxxxxx (with peripheral resets)mN$$d $,8H <[eeeeeeeg[eeeeeeeeefee[eeefee[eŊeeeeeeee[eeheeeeegee[eeeeeeeeef[eeeefeffefff[eef(ffefff[f!ff%feef)f[eef.ff2fek[9fe?fefEffKfefee[eeeQffYff^fefee[eeee9fe?fe[cfgfeeee[cfpfeeee[eeee9fe?fe[eeeQfeeeyfig1}f[eefŊif[eefffefif1f[eefffŊegif[eefffefi=͊k ,6țc͊,6܎#QL6XˀXw ,6乀5Ҋ,6L6 *֍,6,0,6р1i,60[g༉,6 잀l6EՊ쳀,6߀մ,6 ҵ/i,6߉#8 \l6^ ,6|:O݉L6v݉݉|@4~,6ŀ:L ,6U݉@,6EрL6΀&N,6΀£bL6΀k[,6΀£7L6΀# ,6ș#H,6 πPs:L6΀BiѪ,6π£תʨ,6ЀhӨ+,6Ѐ֡1L6΀L6pЀɊL6O+,6р2L,6ԑ р,6Hρ L6Ӏ ,6`Ѻ[L6lۀHd! ,6ρ%:,6TC_ ,60ĸ三K,6l,6p$HW ,6`^,6L6 ,6р&!L6΀;L6%L6L6% DL6%P,6,6π£裉",6<""k,6,Veh,6$F&M,6:ͨ,6Ѐh{),6:,W,6\S /WL6,T_pN l6o?,61E`Q,6ҀTq,6Hb,6dW߉f߉,6:,6ܩ+,,6" ,6 ~)ىIى,6ى(߉,6o߉߉0 ,6t0)04@L6T=@рމ ,6uމމ|@v,6ءi//ʼn ,60FрgL6H8n[^L6 ??,6Ѐ֡䡉KuL6./ ,6 @\@@|@y,6--~L6LЀs݉L6v{݉р},6@))+,6+"Ӊ L6u݉މ|@%L6%4&+,6+T),6̲\)x)q ,6yᆉL6d΀ ,6ML6 $,6$$#,6##[ ,67#Q#,6莁#M,6Uд L6軁Z##" ,6Й"},6 ˁxs",6{"",6̢hр} @l6"]  p4Vqm4pe\<8%vI`GU9v4uudTv8[v\4|M8(Hˊ*)p슇Wј't}xl[|&\3 ^6i* MhT(xRMw\<K3 (Ҁ8hP"p~8|!TDL!I9$XE7K7 (X Utp+Ll(+AOvIOd׋h$o_EQJh, >|*U^gxXsx ww0a^y6hE 8Ċ h), pDT nX!P4$!P,:*w9$!3w!݋}# 2#}#% 8#JM3#($TK:%TDx%aW%%aY%gIPԢi^[mN ~j T% ˊ\*~l*T݋9x|*Bx*pۋYMo4u~I9# $t3!uy"9ui!3>`lۋy@? @D?P83(?˗?h4 L 8F̉Gn!b͇Ql܂olgvl ̇vl<̇{ D@ $ L va8MDǂPM@W@D"L"-tD3N4gZZyyyj|yg` A`Ãt|yg Aăt|ygAǃtȃ|yg@Aǃtȃ|yWh Aȃ|yh A8Ƀʃ|yh ADʃt|y'h0A|ƒt|yGhAʃt|y7h AŃt|yƒƒhhA˃|y0/w< i[oˊ>G<f$Ƈԅu'h*8b)ɇ߇([3L0ՂՂK7<L~8ˊ9\K:hExćdMI<WJ4,NLˊNPGUW<؃<ˊYi^[D4e\,eeجh8[^gKuiʸ~j<}mƀnYMoT >s<,, T $ˊuWtP"RMwxg^yB}\}<Z@ $ˊ@<lZD@ $@D},XtUU0 Pp   d $(,048D H L P T X \ ` Pl  $(,048<@DH| $(Dx|(,0ptx<@DHLPT,04     l!p!t!"""#%%4&&''' '''<(@(D(***++////0000 2223333333333555556p6777777888 ;;;;;`;;;<@<x<<=h>l>p>t>x>>>A\A(BBBBB EEEEE E$E FFFF F$FFFFFFlGpGHHLHdIIhJlJDKHKOOOOOOOOlPpPtP|RRRRRUUUUUUUUUU V$VlV,X0X4X8X8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>>>TMNNbbbbbbbbbbbbccwwwwwwyyLz{ {X{8|0h؂8h 芇TX䑇葇䘇x@xdhlptxX@DHL$(,048$̰pȲ̲вԲزtx|(,8<@DHL $(,048<@DHLPTX\ććć ćććććtćƇƇƇƇƇƇƇƇƇƇƇƇƇƇɇɇɇɇɇɇɇɇɇɇɇɇɇ$ˇ(ˇ,ˇ0ˇ4ˇ8ˇ̇ṖṪ͇̇4·ччччч҇Շևև|؇؇؇؇؇؇؇lۇpۇtۇxۇ|ۇۇۇۇۇۇۇۇۇۇۇۇۇۇۇۇۇۇۇۇۇۇۇx܇|܇݇݇݇݇݇݇݇݇݇݇<އއއއއ߇߇߇ ߇$߇(߇,߇0߇߇߇  $(,048<@DHLPTX\\`dhlptx|Tphlptx|  $(,048<@DHLPTXlptx|@DLPTX\`dhptx|<@DHLPX48<@DHLPTX\`dhlptx| |<@, 0   D L (,04$`T\P#T#X#\#`#d#h#l#p#t#x#|######## %%%D%\&`&&))))),-------$.l/p/t/x/|/l1p1025555777777778888H990::$<(<,<0<<<<<???????@@@ @@@@@ @$@(@,@4@8@<@@@D@H@L@FFFFFFFFFFFFFFFFFFFFFFFFFFFF(H,HdQRR(S,S0SSUUUU U$U(U@V@W XXYYYYYZZZ_(a,a0a4aa$b`bdb,c0cc dddjjj jjjjj j$jkk|oooooooooqqq|ttt8uuuuu0vl|p|t|x|||ĒȒp̙Йԙؙܙ䙈虈왈  $(,048 $(,048<@DHLPTX\`dhldhlptx|@(LpT,04ȼ̼мԼؼ $(LˆPˆ(ÈĈňLjLjΈΈΈΈψψψ ψψψψψ ψ$ψ(ψ,ψ0ψ4ψ8ψ<ψ@ψ|шшшшшL҈҈\ֈ`ֈdֈhֈlֈxوڈڈڈڈۈ݈݈݈݈ވPTX\`dhP<@D  $(,04\h   $(,04<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\tx|   $(,048<@DHLPTXptx|             $ ( , 0 4 8 < @ D H L P T X \ ` d h l t x                        (,48@DLPX\dhpt| $(04<@HLTX`dlpx|  $,08<DL`h@HLPdx|8Th8<HLPTX\`dtx| \`dhlptx8<@DHLPTX\`dhlptx| $4<L\lptx|ptx| (08@HPX`hpx0H`x `hpx(,048<@PX`ptx|   $ , 4 < D T X \ d l                  !! !!!!$!(!,!0!4!8!> >>>>$>(>0>4><>@>H>L>T>X>`>d>l>p>x>|>>>>>>>>>>>>>>>>>>>>>>??(?,?8?>>>>> >$>,>4>8><>@>H>P>T>X>\>d>l>p>t>x>>>>>>>>>>>>>>>>>>>>>>>>?? ???? ?(?0?4?8? disableddevbus-cs1!marvell,mvebu-devbus = disableddevbus-cs2!marvell,mvebu-devbus ; disableddevbus-cs3!marvell,mvebu-devbus  7 disabledinternal-regs !simple-bussdramc@1400#!marvell,armada-xp-sdram-controllercache-controller@8000!arm,pl310-cache8Lscu@c000!arm,cortex-a9-scuXtimer@c200!arm,cortex-a9-global-timer  Z timer@c600!arm,cortex-a9-twd-timer  Z interrupt-controller@d000!arm,cortex-a9-gicevi2c@11000+!marvell,mv78230-a0-i2cmarvell,mv64xxx-i2c  Zokaydefaulti2cmux@70 !nxp,pca9547pi2c@0mcu@2a!cznic,turris-omnia-mcu*led-controller@2b!cznic,turris-omnia-leds+okaymulti-led@0  indicatormulti-led@1  indicatormulti-led@2 wlanmulti-led@3 wlanmulti-led@4 wlanmulti-led@5 wanmulti-led@6 lanmulti-led@7 lanmulti-led@8 lanmulti-led@9  lanmulti-led@a  lanmulti-led@b  powereeprom@54 !atmel,24c64Ti2c@1i2c@2i2c@3i2c@4(i2c@5crypto@64!atmel,atsha204adi2c@6i2c@7gpio@71 !nxp,pca9538qdefaultZ)i2c@11100+!marvell,mv78230-a0-i2cmarvell,mv64xxx-i2c  Z disabledserial@12000!!marvell,armada-38x-uartns16550a  Z okaydefaultserial@12100!!marvell,armada-38x-uartns16550a! Z okaydefault pinctrl@18000 !marvell,mv88f6820-pinctrl ge-rgmii-pins-0Dmpp6mpp7mpp8mpp9mpp10mpp11mpp12mpp13mpp14mpp15mpp16mpp17ge0 ge-rgmii-pins-1Hmpp21mpp27mpp28mpp29mpp30mpp31mpp32mpp37mpp38mpp39mpp40mpp41ge1i2c-pins-0 mpp2mpp3i2c0mdio-pins mpp4mpp5geref-clk-pins-0mpp45refref-clk-pins-1mpp46refspi-pins-0mpp22mpp23mpp24mpp25spi0!spi-pins-1mpp56mpp57mpp58mpp59spi1nand-pinsNmpp22mpp34mpp23mpp33mpp38mpp28mpp40mpp42mpp35mpp36mpp25mpp30mpp32devnand-rbmpp41nanduart-pins-0 mpp0mpp1ua0uart-pins-1 mpp19mpp20ua1 sdhci-pins<mpp48mpp49mpp50mpp52mpp53mpp54mpp55mpp57mpp58mpp59sd0 sata-pins-0mpp20sata0sata-pins-1mpp19sata1sata-pins-2mpp47sata2sata-pins-3mpp44sata3pcawan-pinsmpp46gpioswint-pinsmpp45gpiospi0cs0-pinsmpp25spi0"spi0cs2-pinsmpp26spi0gpio@18100+!marvell,armada-370-gpiomarvell,orion-gpio@ gpiopwm) 0 <ve0Z5678gpio@18140+!marvell,armada-370-gpiomarvell,orion-gpio@@ gpiopwm)0 <ve0Z:;<=system-controller@18200M!marvell,armada-380-system-controllermarvell,armada-370-xp-system-controllerG$clock-gating-control@18220 !marvell,armada-380-gating-clock T phy@18300!marvell,armada-380-comphy comphyconf`phy@0aphy@1aphy@2aphy@3aphy@4aphy@5amvebu-sar@18600!marvell,armada-380-core-clockTmbus-controller@20000!marvell,mbus-controller Pinterrupt-controller@20a00 !marvell,mpic pXevl Ztimer@203001!marvell,armada-380-timermarvell,armada-xp-timer0@0Pu      {nbclkfixedwatchdog@20300!marvell,armada-380-wdt4`   {nbclkfixed u@ cpurst@20800!marvell,armada-370-cpu-resetmpcore-soc-ctrl@20d20#!marvell,armada-380-mpcore-soc-ctrl lcoherency-fabric@21010$!marvell,armada-380-coherency-fabricpmsu@22000!marvell,armada-380-pmsu ethernet@70000!marvell,armada-370-neta@u &Hokaydefault rgmiifixed-linkethernet@30000!marvell,armada-370-neta@u  okaydefaultrgmiifixed-linkethernet@34000!marvell,armada-370-neta@@u  okaysgmiiusb@58000!marvell,orion-ehci Z okayxor@60800)!marvell,armada-380-xormarvell,orion-xor  okayxor00 Zxor01 Zxor@60900)!marvell,armada-380-xormarvell,orion-xor   okayxor10 ZAxor11 ZBmdio@72004!marvell,orion-mdio  defaultokayethernet-phy@1!ethernet-phy-ieee802.3-c22 Iswitch@10default!marvell,mv88e6085&Z portsports@01lan0 internalports@11lan1 internalports@21lan2 internalports@31lan3 internalports@41lan4 internalports@51cpu7 rgmii-idfixed-linkmdioethernet-phy@0ethernet-phy@1ethernet-phy@2ethernet-phy@3ethernet-phy@4crypto@90000!marvell,armada-38x-crypto regsZ    {cesa0cesa1cesaz0cesaz1@Urtc@a3800!marvell,armada-380-rtc 8   rtcrtc-soc Zsata@a8000!marvell,armada-380-ahci  Z okaybm@c8000!marvell,armada-380-neta-bm  nokaysata@e0000!marvell,armada-380-ahci  Z  disabledclock@e4250!!marvell,armada-380-corediv-clockBP T{nandthermal@e8078!marvell,armada380-thermal@x@pokaynand-controller@d0000"!marvell,armada370-nand-controller T ZT disabledsdhci@d8000!marvell,armada-380-sdhcisdhcimbusconf-sdio3  T Z okaydefault usb3@f0000!marvell,armada-380-xhci@@@ Z okayusb3@f8000!marvell,armada-380-xhci@@ Z okaysa-sram0 !mmio-sram   sa-sram1 !mmio-sram   bm-bppi !mmio-sram   okayspi@10600)!marvell,armada-380-spimarvell,orion-spi P Zokaydefault!"flash@0!!spansion,s25fl164kjedec,spi-norbZpartitions!fixed-partitionspartition@01U-Bootpartition@100000p1Rescue systempartition@f0000 1u-boot-envspi@10680)!marvell,armada-380-spimarvell,orion-spi P Z? disabledpcie!marvell,armada-370-pcieokaypciPȂ  @@  pcie@1,0pci #intxue@Ȃ3`F####Tf  x$okay'interrupt-controllerve#pcie@2,0pci #intxu!e@Ȃ3`F%%%%Tf  x$okay'interrupt-controllerve%pcie@3,0pci@ #intxuFe@Ȃ3`F&&&&Tf  x$okay'interrupt-controllerve&pcie@4,0pci  #intxuGe@Ȃ3`F''''Tf  x$ disabledinterrupt-controllerve'clocksmainpll !fixed-clockT;oscillator !fixed-clockT}x@ cpusmarvell,armada-380-smpcpu@0cpu!arm,cortex-a9cpu@1cpu!arm,cortex-a9chosen /soc/internal-regs/serial@12000memorymemory@sfp!sff,sfp( ) ) ) )  )  disabled #address-cells#size-cellsmodelcompatiblegpio0gpio1serial0serial1ethernet0ethernet1ethernet2i2c0i2c1spi0interrupts-extendedcontrollerinterrupt-parentpcie-mem-aperturepcie-io-aperturerangesbootph-allregclocksstatuscache-unifiedcache-levelarm,double-linefill-incrarm,double-linefill-wraparm,double-linefillprefetch-datainterrupts#interrupt-cellsinterrupt-controllerphandlepinctrl-namespinctrl-0gpio-controller#gpio-cellscolorfunctionfunction-enumeratorreg-shiftreg-io-widthmarvell,pinsmarvell,functionreg-namesngpiosgpio-ranges#pwm-cells#reset-cells#clock-cells#phy-cellsmsi-controllerclock-namestx-csum-limitphy-modebuffer-managerbm,pool-longbm,pool-shortspeedfull-duplexphy-handlephyssfpdmacap,memcpydmacap,xordmacap,memsetmarvell,reg-initdsa,memberlabelethernetmarvell,crypto-sramsmarvell,crypto-sram-sizeinternal-memclock-output-namesmrvl,clk-delay-cyclesbus-widthno-1-8-vnon-removableno-memory-wccell-indexspi-max-frequencydevice_typemsi-parentbus-rangeassigned-addressesinterrupt-namesinterrupt-map-maskinterrupt-mapmarvell,pcie-portmarvell,pcie-laneresetsslot-power-limit-milliwattclock-frequencyenable-methodstdout-pathi2c-bustx-fault-gpiostx-disable-gpiosrate-select0-gpioslos-gpiosmod-def0-gpiosmaximum-power-milliwatt0