07070101AE1CFF000041ED0000000000000000000000106A426C2800000000000000FE0000000000000000000000000000000200000000.07070101AE3947000081ED0000000000000000000000016A426C2800000114000000FE0000000000000000000000000000000500000000init#!/bin/sh # Copyright (C) 2006 OpenWrt.org export INITRAMFS=1 # switch to tmpfs to allow run daemons in jail on initramfs boot DIRS=$(echo *) NEW_ROOT=/new_root mkdir -p $NEW_ROOT mount -t tmpfs tmpfs $NEW_ROOT cp -pr $DIRS $NEW_ROOT exec switch_root $NEW_ROOT /sbin/init 07070101AE1D14000041ED0000000000000000000000076A426C2800000000000000FE0000000000000000000000000000000400000000usr07070101AE1D19000041ED0000000000000000000000066A426C2800000000000000FE0000000000000000000000000000000800000000usr/lib07070101AE20230000A1FF0000000000000000000000016A426C2800000009000000FE0000000000000000000000000000001000000000usr/lib/libz.solibz.so.107070101AE22FC0000A1FF0000000000000000000000016A426C2800000014000000FE0000000000000000000000000000001700000000usr/lib/libnftables.solibnftables.so.1.1.007070101AE20240000A1FF0000000000000000000000016A426C280000000D000000FE0000000000000000000000000000001200000000usr/lib/libz.so.1libz.so.1.3.107070101AE22FE000081ED0000000000000000000000016A426C28000AFB27000000FE0000000000000000000000000000001D00000000usr/lib/libnftables.so.1.1.0ELF4t4 (p888pPPP# # % 5 5 hhhHHQtdRtd% 5 5 xx z &4< 5 5 'l   Igppp ppp#poHoooHooDg;8A?0B%K$DJh2QILG):kFM.|vib#tDtE c3}`*XlC] z:UA@xIuH/ fNj41yer[}h~dp8qHR{_acnXP0("\pWde&fO,+'=^w>Z-r7 /T!o1K3mi(j){x$ m@659<`"VYo Y|'ySz]=s?_Bq+V6W-Q %L.OM495F !b,n*&v ZSU[Nw  G7 2R#gE><PTJlC;a\^sku~  (= x ) i(= ' ( ( ) )  ) _ e: > )= ) ( ) L_ [1Y wi( 3( MG(  ( ;Y} dyv \( q) Nv p|`P@0x B $ OqWp`8P@0   W%3p`9P@0" ~^_` p` P@}0 = oIA1 p`P~@0 *t A  EpD`/Pl@10j VNu'  bpV `P @ 0 R\ ~ #   p:`QP\@0\ "    p`PE @m0J fhG w?dp`P@|0 l(` W )[p`PX@A0  * ?p~p "p `Px@e0O eo 11"p`ZP@0k @ ]s *  v2 p `BP @0 . gmpl`!P;@K01 U:& e1 pW`(P@0}   4"   p`Pv@0 IL?B\1p `6P@0 R D  X  p`P@0  g +Xp`yP@0  1 p:?p`P@0   )N6 MpG`P @0 _ ?[B p``P@04 " j  }g1p` P@0  _init_fini__cxa_finalize__deregister_frame_info__register_frame_infonftnl_rule_get_u32nftnl_rule_get_strstrcmp__assert_failstrlen__stack_chk_guard__stack_chk_failnftnl_udata_put_u32nftnl_udata_typenftnl_udata_lenmemsetgetnameinfontohsfopensscanfopendirreaddirclosedir__stat_time64stderrmemcpystrnlensysconfnftnl_rule_allocnftnl_rule_set_strnftnl_rule_set_u64nftnl_rule_list_allocnftnl_nlmsg_build_hdrnftnl_rule_nlmsg_build_payloadnftnl_rule_freenftnl_rule_list_free__errno_locationnftnl_rule_list_foreachnftnl_chain_get_strnftnl_chain_get_u32nftnl_chain_list_delnftnl_chain_freenftnl_set_get_strnftnl_set_get_u32nftnl_set_list_delnftnl_set_freenftnl_obj_get_strnftnl_obj_get_u32nftnl_obj_list_delnftnl_obj_freenftnl_flowtable_get_u32nftnl_flowtable_get_strnftnl_flowtable_list_delnftnl_flowtable_freenftnl_udata_getnftnl_udata_parsenftnl_udata_get_u32fgetsfclose__udivdi3__umoddi3strncatvasprintfnftnl_table_list_allocnftnl_table_allocnftnl_table_set_u32nftnl_table_set_strnftnl_table_nlmsg_build_payloadnftnl_table_freenftnl_table_list_foreachnftnl_table_list_freenftnl_set_allocnftnl_set_set_strnftnl_set_nlmsg_build_payloadnftnl_set_list_allocnftnl_set_list_freenftnl_chain_list_freenftnl_obj_allocnftnl_obj_set_strnftnl_obj_set_u32nftnl_obj_nlmsg_build_payloadnftnl_obj_list_allocnftnl_obj_list_freenftnl_flowtable_allocnftnl_flowtable_set_strnftnl_flowtable_nlmsg_build_payloadnftnl_flowtable_list_allocnftnl_flowtable_list_freenftnl_set_list_foreachnftnl_chain_list_foreachnftnl_flowtable_list_foreachnftnl_obj_list_foreachstrtoullatoistrtoulinet_ptongetaddrinfogai_strerrorfreeaddrinfostrtoumaxgetprotobynamehtonsstrchrnulnftnl_expr_fprintffputcfputs__time64nftnl_udata_nest_startnftnl_udata_nest_endmnl_attr_get_typemnl_attr_type_validmnl_attr_validatemnl_nlmsg_get_payloadmnl_attr_parsemnl_attr_get_strfopencookiemnl_socket_openmnl_socket_bindmnl_socket_get_portidmnl_nlmsg_put_headermnl_nlmsg_put_extra_headermnl_socket_sendtomnl_socket_recvfrommnl_cb_runmnl_socket_closenft_ctx_add_varstrchrnft_ctx_clear_varsnft_ctx_add_include_pathrealpathnft_ctx_clear_include_pathsnft_ctx_newstdoutmnl_socket_get_fdfcntlmnl_socket_setsockoptnft_ctx_buffer_outputnft_ctx_unbuffer_outputnft_ctx_buffer_errornft_ctx_unbuffer_errornft_ctx_get_output_bufferfflushnft_ctx_get_error_buffernft_ctx_freegetpagesizenftnl_batch_allocnftnl_batch_buffernftnl_batch_beginnftnl_batch_endnftnl_batch_buffer_lennftnl_batch_iovec_lengetsockoptnftnl_batch_iovecsendmsgnftnl_rule_set_u32mnl_attr_put_strzmnl_attr_put_u64mnl_attr_nest_startnftnl_expr_foreachmnl_attr_nest_endnftnl_chain_allocnftnl_chain_set_u32htonlmnl_attr_put_u32nftnl_chain_nlmsg_build_payloadnftnl_set_set_u32nftnl_set_set_u64nftnl_flowtable_set_u32nftnl_set_elems_nlmsg_build_payloadnftnl_chain_set_strnftnl_chain_set_u64nftnl_batch_free__select_time64mnl_nlmsg_fprintfmnl_cb_run2mallocstrncmpstrtolgetpwuidgetpwnamgetgrgidgetgrnam__localtime64_r__gmtime64_rstrftimestrptime__timegm_time64mnl_nlmsg_sizemnl_nlmsg_get_payload_lenmnl_attr_get_u32nftnl_expr_build_payloadnftnl_rule_del_exprnftnl_expr_freenftnl_rule_nlmsg_parsenftnl_rule_list_add_tailnftnl_chain_nlmsg_parsenftnl_chain_list_add_tailnftnl_table_nlmsg_parsenftnl_table_list_add_tailnftnl_set_nlmsg_parsenftnl_set_list_add_tailnftnl_obj_nlmsg_parsenftnl_obj_list_add_tailnftnl_set_elems_nlmsg_parsenftnl_flowtable_nlmsg_parsenftnl_flowtable_list_add_tailnft_ctx_set_outputferrornft_ctx_set_errornft_ctx_get_dry_runnft_ctx_set_dry_runnft_ctx_get_optimizenft_ctx_set_optimizenft_ctx_input_get_flagsnft_ctx_input_set_flagsnft_ctx_output_get_flagsnft_ctx_output_set_flagsnft_ctx_output_get_debugnft_ctx_output_set_debugnftnl_batch_updatenftnl_chain_list_allocnftnl_udata_buf_allocnftnl_udata_put_strznftnl_udata_buf_datanftnl_udata_buf_lennftnl_obj_set_datanftnl_udata_buf_freenftnl_obj_set_u64nftnl_obj_set_u8nftnl_obj_set_u16nftnl_obj_fprintfnftnl_tunnel_opts_allocnftnl_tunnel_opt_allocnftnl_tunnel_opt_setnftnl_tunnel_opts_addnft_run_cmd_from_buffernft_run_cmd_from_filenamedirnamentohlmnl_attr_parse_nestedmnl_attr_get_u8nftnl_trace_get_u32nftnl_trace_is_setnftnl_trace_get_strnftnl_trace_get_datanftnl_obj_getmemcmpnftnl_tunnel_opt_get_typenftnl_tunnel_opt_get_flagsnftnl_tunnel_opt_get_u32nftnl_tunnel_opt_get_u8nftnl_tunnel_opt_get_u16nftnl_tunnel_opt_get_datanftnl_expr_get_u32nftnl_expr_get_strnftnl_expr_get_u64nftnl_expr_is_setnftnl_expr_get_u16nftnl_expr_get_u8nftnl_trace_get_u16abortnftnl_table_get_u32nftnl_table_get_strnftnl_table_get_u64nftnl_table_is_setnftnl_table_get_datanftnl_set_elem_is_setnftnl_set_elem_getnftnl_set_elem_get_u32nftnl_set_elem_get_u64nftnl_set_elem_expr_foreachnftnl_set_elem_get_strnftnl_set_elem_fprintfexitnftnl_expr_allocnftnl_set_elem_allocnftnl_set_elem_setnftnl_set_elem_set_u64nftnl_set_elem_add_exprnftnl_set_elem_set_u32nftnl_chain_get_u64nftnl_chain_is_setnftnl_chain_get_s32qsortnftnl_chain_get_datanftnl_chain_getnftnl_set_is_setnftnl_set_get_datanftnl_set_getnftnl_set_get_u64nftnl_set_expr_foreachnftnl_obj_get_u64nftnl_obj_is_setnftnl_obj_get_datanftnl_obj_get_u16nftnl_obj_get_u8nftnl_obj_tunnel_opts_foreachnftnl_set_elems_iter_createnftnl_set_elems_iter_nextnftnl_set_elems_iter_destroynftnl_trace_allocnftnl_trace_nlmsg_parsenftnl_trace_freenftnl_trace_get_u64mnl_nlmsg_get_payload_offsetmnl_nlmsg_get_payload_tailmnl_attr_okmnl_attr_nextnftnl_flowtable_get_u64nftnl_rule_get_u64json_object_getjson_object_iterjson_object_iter_valuejson_object_iter_nextjson_integerjson_object_set_newjson_arraynftnl_expr_getnftnl_expr_expr_foreachputcharnftnl_expr_set_u32nftnl_rule_add_exprnftnl_expr_setnftnl_expr_set_strnftnl_expr_set_u8nftnl_expr_set_u64nftnl_expr_set_u16nftnl_expr_add_exprnftnl_rule_set_datanftnl_rule_unsetvfprintffwritenftnl_rule_is_setnftnl_rule_get_datajson_stringreallocstrdup__sync_sub_and_fetch_4json_deletejson_vpack_exjson_array_sizejson_array_append_newfmemopenjson_object_update_missingjson_object_updatejson_truejson_nulljson_objectjson_packmemmovejson_array_insert_newjson_dumpfnftnl_udata_putnftnl_table_set_datanftnl_chain_set_datanftnl_chain_unsetnftnl_set_set_datanftnl_set_unsetnftnl_set_add_exprnftnl_flowtable_fprintfnftnl_set_elem_addjson_falsejson_object_sizejson_unpackjson_dumpsjson_object_iter_keyjson_object_key_to_iterjson_string_valuejson_array_getjson_integer_valuestrcatjson_vunpack_exjson_object_deljson_loadsjson_load_filestrndupstdinnftnl_set_elem_snprintffilenoisattynftnl_expr_iter_createnftnl_expr_iter_nextnftnl_expr_iter_destroygetservbyport_rstrcpygetprotobynumberfseekfreadmnl_attr_putfgetcclearerr__fstat_time64globglobfreejson_array_extendstrtok_rreadlinkfscanfnftnl_flowtable_is_setnftnl_flowtable_getnftnl_set_fprintfnftnl_chain_fprintfnftnl_rule_fprintfnftnl_set_elem_foreachstrncpynftnl_set_elem_nlmsg_build_payloadnftnl_set_elem_freelibmnl.so.0libnftnl.so.11libjansson.so.4libgcc_s.so.1libc.solibnftables.so.1LIBNFTABLES_1LIBNFTABLES_2LIBNFTABLES_3LIBNFTABLES_4GLIBC_2.0GCC_4.4.0JANSSON_4LIBNFTNL_13LIBNFTNL_15LIBNFTNL_18LIBNFTNL_14LIBNFTNL_16LIBNFTNL_11LIBMNL_1.0                     ژ<M$[M$i[wi&0ii `^'  Dpc e h d f a `/55 5 5 5 5 <6 X6 \6 6 7 7 7 7 7 @8 \8 `8 8 9  9 9 9 9 D: `: d: :  ; ; ; ; ; H< d< h< < = = = = = L> h> l> > ? ? ? ? ? P@ l@ p@ @ A A A A A `B pB B B B B B B B  C 0C @C PC `C pC C C C C C C C D 0D @D PD `D pD D D D D D D D E E (E 8E HE XE hE xE E E E E E E E E E E  F $F (F 0F 8F \F `F dF F F F F F F F F F F F G G G (G LG PG TG \G pG G G G G G G G G G G G G H H H H H `re`ra M Ir`000wO!nqML@8e0\Am)L@:ep@0L@:eCajvd 0 >Og@8e Ir `000wO!n p+K0L@8eE#` 8e@0L kI K Mhjl j @2id eF " @r ` mtG@*`tQ`On@8e wdZ `0O^On@8e g2@nNm@:eO BPH:en@)MqLmeM@:eZajJ0ҐO~On@8ej`AA`@ AexV4!Ce j @2idce\g$gP:e@g @bgjme @C "@|@J@a܀jg \gn2@m@:ee\gCt ;eM@ Deb\g@=eDe\gp;e@ g@eg qHKg n@:ex \ I ;e ml@geB\g qHnL@:eBa@ae\g|\IҠ` J"g\g n2@m@:e`ea\gb2@Lng m@:eg@KCgdgC M@;ee\g@=eD @;eH؞e\g@=ejNn\gL@:eR`jK!cd @:e@M @ml@:ebeAہ`@\gg@=e @e ҅e`AA`AݠA jV @2ide\ggQP@:eMjjaddT5I堀HIe j @2ideRg\gD%g@:eklJL2IeJajvdB`ja\g2X@:ee *\g2X@:ee"j `jl"`\Z Xg j jv @2ideDI!HҀ aHJa\g @=evd\g@=ege ( j6 @2ide.gn000qxOML@8eJ"@P"AހH"C`jm@dd j @2i deMg@:ere)aj@ Jn * D1T50DM@:e ѐP @:ep3mBeaBp2IӀlڭL0 >Mg@:ere`L0 ^ Mg@:ereajL0 ^Mg@:ere`D"@@0@~M@:eeqH @:ee$@8eP2Ikbcdezdje js @2id'DegI\g,g@=eud@=eIee j3 @2idej S&BQ"g %gҢgP\g7J@:ege"qH@:ee &"080 M@9e@r2a0 M@9ep Ģ@9e e@8e@/ra0ԘNqL0gkM@:eR`wd0ԘN0Me jS @2iedgΜp0pM@8edd j3 @2iedg̜p0pM@8edd j @2id`ejlg&g"@no@:e0ggM0g@8e|dPdd@:e Pea` g:e @ P eo}ng:e @ P enog@:ee*Fcx`@FG@:eg00XgMg@:eje+9 `@:; @:eg00Xg>Mg@:eje+ }kca@ }no@:eg00Xg>Mg@:eje+ [ a@ no@:eg00XgMg@:e_"0>MFj+_*00>Mg@8e;[&6ee\&6 j @2iedgҐT0Lp:e@%ggg8e@gudDg$el#nKnڠ j @2iedL@8eJN*󤘄@=e󤘅e@=eeg@8eude j @2idggҊe `gpTp@:eI؅g@?edd j @2ideLgZg`Z@`kx Zq䇜`Z`ddJZ`$p񼟐g@?eJZ`ğjHK*񬟐g@?ej YIBKPK*񤟐g@?e j j j @2ide|g@XB@M@I Lg@:e@re`r`h\gnd0ӐXO@:ee7H?%IB\g)Hp\g@:eRe2a\ggT ml@:eheg\gl0ӐXЩ^On@:ege\g@=eejKꂙm #\g1@Nl@:ekaA܀a@V@:ejeKꃙd #1@*0mAo[qD@:e@re`𴘕@=eeTg@:eP̟G옧B?emM@L@eUكonomjLٖjSTR٢jT "gLm@:eeS3"gLm@:eoeD m@ȩqP1@:eg?ee@TQe@=e1He@:eR*0moRAZTeLGA]JV䘴@:ee "qD@:e@re`󼘒@=ePeeO_"jKVQ@=eeSPe|jlF"W8*]gIjTSUEPjHQXl@:eRe:`QXl@:eeJN2}gL2KeBU,"jDQ@@:eUٞe$*0 mRjRٿWw@EWASWCT`I@UFP]gIT"jjjDʩqP虤1@:eHSe "gr@m@:eeT "gr@m@:eeP "gXm@:eeQ䘵@?eq󠘕e@=eqPe@:eS*0@mH蘇ASeLV@:ee#"Q󼘓@=eIeeqD@:e@reLaR?"jKVjST󼘒@=eeoIe|jlHـ "WB"@EWATWEP]gIQXl@:eRe3`QXl@:eeJN2}gL2KeDQL@:eUٞe*0𔘡m|qP@:eSٞe*0𔘀mLojSٵjPTEjT "gHm@:eeP2"gHm@:eoeDmʩqP1@:e옵g?ee@P1󼘕e@=eTe@:eT*0m#oP옇ATeLV@:ee"qD@:eV@re`@=eIeeV@rajKVjT٨Ie[^JUjVP\DU{JxKn"G"GAeJYUZDA]N:M@:ejeVـ| jl"U XJPP\EPuJ Kn*O"GAeJYUZ@A]N@:ejeVH"GAeJYUPZٱXA]NM@:ejeVF"GAeJYUPZٲPA]NM@:ejeVـ|@jl"GAeJPقgTי@:eVJe"W "A "WB"X@:eVJe*R *S*T*O*VR`"e@P\JAgT@:eTٞe?*0mjT1PJI٢gE J@:ee*P @bgjl*D|l*CwЙI㩙\AeL@:eReV٭aPDJP59|l?"U XJPP\EPuJ Kn?"PJI٢gE J@:ee*0@@:ee""wgI㩙\AeL@:eReV aPDJPjVUDJUQ󼘓@=ee]@=eeXV@:e"e@P\JAge0sd (* j @2iedNMlg@:e* jO @2ide@g\g0P@:eDd j @2iedgg0Ԙ0@8edd j @2iedgg0ؘ0@8edd j @2iedgg0ܘ0@8edd j @2idejK \g$g0HQHk ҠH-IAM\gP#g0Ԝ^ Nl@:exd g @:e e|g0ԛm~N j/ @2idej\g-P@@]g@H r/`JZ,a-rXgZXgE@0r%` j @M"ggQP@:egPD@:e je @ * c*\g Pm@?e e-IA!kklXraIjBraIjjbg s?`CL\;aCL \%`J c,a\g Pm@?ejeg@=e!0ԘINl!8eB@M{CL\`JK[`J @DgJ I\g PL@:ee"g" 8JV2B:`g\gPP@:ege imk>eg)+3mߢMqg JJa\gPT@:e"ge"`\gbn000𔚘OMLhg6ߢge- [aK#{gM  J " /B ),B>`g\gPP@:ee [*AD @j)a @ ,"Jhi C%an "\g`n000𔚘OMLq@8e j KX@jB mj Xan B2B2jg@bgB2B2ee:e_gg b00Ig`ga8e @00 B2gB2 gIM`L-\g PXgg@:eie" (3mI@u YJ (2IJ@ZXgG\g Pm@?e-rea+j!gBPDnoL@:e"B@?eg@)Lg@8ejpde? j @2iedgP\&g@:e $*@m҇Bp\)L@:eZXgprxg g@=e PBonL@8e@ xd j @2ie dgP\%g@:egGAJ PDe,L@:e p𬘀@=e  on @:e@xd j0@=e-QPeg@:eL7Pn j @2ideg@XE@KMIقgQP@:eJN2}gL2KeFHGA!JeCqLn@:ejne,P0ԘMNl@:eek'#1@8eZ`@DgJ$KijHfHGOBPDn7L@:ed@۞ejexde j @2i deMkA'Eg@Il"@ l@:er]`0Ԙ Ngl@8e* g 2@ nm@:ej jXe m@:ege"T@:e0ԘgNgl@8e|d G"@=e0Ԙ?Ne@r`000q8O n]M_ L@8eA=e@ ҐP  ong@8e@j j @2iedgXk @ M A@legK "@  l@:err`0ԘNP l@:ee+2@ nmg@:e jjX egm@:ege"T@:eg0ԘP Nl@:ee G#1@8eG "g@=e0Ԙ?N@ r`000q8On]ML@8eqHnM@:eeg@=e PDnoL@:e @۞ejpde j @2ie dgqD%g@:e j@Xe n@:e eI`- "t`+Za0Ԙ Ngl@8e\@:e"BZ`pP C ong@8e@jxd0ԘNe j @2ie dgqD%g@:e j@Xe n@:egCg jeI-``++ `"s`*1C a0ԘNgl@8eydH1@:eSpP ong@8e@jXnl @:ege"T@:e0ԘgNgl@8e e@raA=e@S r`000qO@n]ML@8e j @2ie dgQPg@:ej 0Tei ba) @8ekxc3@aj.@mrZ`nR`dr`hr=`J Z` J r+a0ԘNsr`0ԘNj, "0ԘNl@8e{d sP\J@:e ҞejM J J Ңj,"0Ԙ?N sP\J@:e Ҟej2X>M@:e*j,"0Ԙ_N sP\J@:eJ eJ jj,"0ԘN sP\J@:e Ҟejj,"0ԘN sP\J@:eҞej Ygg Y guqCxgjY gq}kyxg\&6 j @2i degGEJ pD @:e"g* #0Ԙ Nl@8e"gQgydpP  on@8e@ j- @2idegI0Ԙ8eNM@ldde j @2iedg02X fM:e@&ge*jk@ajud2X0 M@:ee*j2X0 M@:e*0Ԙ Nl@8ee jM @2i degM%g 02X M@:eIe"2X0 M@:e "0Ԙ_Ngl@8exdjP  ong@8e@je j @2idceMg5g 0rT0Ԙ%gONm@:ejLD e @:eReI`qD@:eDe@:e0ԘgNgl@8ecdpP  @ong@8e@j j  @2idҚe&g(Ir+axd|g0ԛ0tJN is`dc B\gM@@:eG@e|g0ԛ JN(ʚ&d\gc0@M@:e jm @2ideD`^'`v:`v`jv@`D0𴙀@ M@:e000q eOnM L@9evq`vXg* e mKi҂gT@:ee  mK҂gT@:eke`@G Ir\gXJ \g0TJ `a0TJ ʚ@@:eB H2Ie&@@:ee@Ә @:ejecJbaxd @pP M@:eeүjH2iH2Iࠚ%@jl"Xon@:eTe l@:eeJp @ N@?eB H2Ie &@0M@:ee@Ә @:eeF"g@ @:eCkJ R@` Jg D@:eg 2@e m@:eje l j`M`.+ch2iH2CIT-` mj@1T @:e e@=eeT l@:eZH3Mh3m hc` J sa MJb#K$~mÚaLJ^m yK j @2ie deeV!aFgYgKgN6Zaj0ҪOn X@:e ekN%#jL!#Kl"CgJ]`000wOnMLq @9eJr `rR`0_ On"虢g0L@?eL2gg?e@Ұg?e@ @?e@?eg@?eT@:e Ze a000wOnMLL Ir`raL @:e"L2L2PCgkj@D Iria"虢g0L@?e JrAag?e@Ұg?e@ @?e@?eg@?eT:e@ MgB?e@)MM?eB@)L @:ep𬙊@=eX@:eJKbg ggX@:e eC2?0n_ Og X@:e e*000wOnM L  ȢgPH@:e J L@:e gPD ȣ@:e@:ep\nm@:eL6 T@:ej@D Lmbgl  H HKbg kPbg pڰX:e@gImI H HKK@:e ii h hkkK +P\ J@!M@:e ReaJ gɚG@%JjP\OJ@:e Re Ҁa˘ Ir`jy B`ʚ0HCmL@:eg*X @:e e\@:e ҞeI"|g 񀚐h j "Cg@;e e:"G@JұDl@:eM @:e#"0HX 0L@:e 0 ҐDn?O@:e e0H j@IJKLMX%Mg@:e ReaK Hbgjl"0O n R"0 O]" Ng Og @bgjLDg#*0MO n "e P\&JAg"0MON"`hj`M0 nXO@:e e TL@:e e"0ԙJج @_N@:e eG mBPL@:e n Ier7#`000𔙗OnM?L9ObgjmO k OmOMD@:e eg Ir`000𔙗On`000𔙗On Oobg jMP\J@:e e?"l`ہK g@)KBgP\OJ@:e Re a̘ Ir_`!`n"1@`raL r:nr`P\ Jg@:e Je *"e P\JAg L%*D@:e r` R `r `r `0`Or`Lr`0 O"Ann `NM9 HZXgrxgAjX kk \Ls`r `0O x+ XK")K*j XL_"P\ J@)Ng@:e Re amjmM2 X *Lho8+j XP\ ؠJ g@:e Je" Ir aM is9`sal0JJaojl%*P\ J@@1N%Og@:e Re Ҩ`3pk* j ta t aojmO̘-&0NOH`X 4M@:e*Kjl 񀛌 * 0nXO@:e | I r`IC" HZXgrXg Xr a Ir a@1M@?e Xr6` ru`Pg:e@  g@:e AjX I 0L@:e 0 ҐD@n OM@:e e"e P\JAgl j4MX@:e BdKjLMG@%JܢgXj@:e !*KAjX I H*P\J@:e*D0 @@ONM@:ejK8l Ir2a kML \ Hl"ojmOؐ @?e \@:e @e r\gP\J ` g@%KkӰg@:e p@=e Re`"e P\DJAg i s`000𔙗OBnML"e P\JAg l`` 0K+ xs8` s9`0 kӰg@:e Re ҫan%"D0𔙠1TL@:e 0e00𐙗Obn"e P\JAg̙ęP\ Jg@:e Re an "D0𔙠1TL@:e 0e00𐙗Ob n"e P\JAg Am HZgjNI k \kLs`r`0@O"e P\JAg p+ P I H*0@`OnMg"e P\JAgJ*K *0 O"e P\JAgP\ РJ g@:e Je> "J#"P\ J@@)N!Og@:e Re aJ Ir a0O"e P\JAgK"P\ J@%Ng@:e Re aK Ir_a0O"e P\JAgJ"G@!JjP\ԙOJ og@:e Re aVkl" Ir `0 O"e P\# JAg LbgC_a0jҪ@On"e P\ JAg HZXgrxgAjX I \rJ` kklr~aJ *0O"e P\JAgP\ J@!Ng@:e Re _aK"G@%JjP\0ęOJ og@:e Re ?a˘ Ir~`ʘ"e P\D JAgJ *0O"e P\JAgK "0O"e P\JAgG@!JjP\0ęOJ og@:e Re `"e P\DJAg0O"e P\JAg HZXgrxgAjX I \raL"G@)JjP\0ęOJ ogg@:e Re ҿa̘ Ir`K" Hr` r-`0 O"e P\JAg̙ oG@%Jj g@:e Re ҟa˘ Ir_a"e P\JAgęo j@IJKLMX!Mg @:e Re~a Ir `0O"e P\# JAgL Xik HK0JҢg @:e Re^aP\ Jg@:e Re^ajhl "0 O"e P\# JAgR "0@O"e P\# JAgL 0T G@)Jn*Jl j 񀛍 @"e P\DJAg@ N@:e Rea @ Kk In * gIJKLM 0JҢgX@:e Rea LHbgjl"0`On"e P\JAg M tp`t`t|` \@:e0OgX@:e e"e P\JAg@kOmj @LʚPD@:egkP\m0J oM@:e e~"j@` M g@M@:e Re~a ML@ Ir`0O"e P\# JAg@jOkL*+ Pj8M E@=e B-M@:e Re>a Ir%`0Ong"e P\JAgkl* gg0H@:e Re`"e P\JAg@j `l*0O X LҩP\ J@:e*E0EOg"e P\JAg \ @?e Hebgjm HML `jl> "P\ n J"e P\$ JAgG@%JjP\POJ og@:e Reajhl*0 O"e P\# JAg j@IJKLMX!Mg @:e Re~a Ira읐H @:e*0Tx@Jgn"e P\ JAg X ik HK0JҢg @:e Re^aP\ Jg@:e Re>akHl *R*Jl L0Kg \ɚ HP\OJ@:e ReakHl "0`O"e P\# JAgR "0O"e P\# JAgNom "0O"e P\# JAgM 0T G@-Jn>"@ N@:e Rea @ K>"kl>*0O"e P\JAgP\ xJg@:e e"e P\JAg@!M"e P\JAgD0𴙀@M@:e 0e00𐙷 O n"e P\JAg sd jH @2ide` 0 @`O n@ҐX@:eRa0\g@:eJ" BpDNm@:e N Er\aAjXI H 1*0O8j Jg pX@:e 𴚀ĥPD@:eg0P m@:egB0TL@:eҬD @:eR` 0@!O n8@9e BpDNm@:e Or` NHP\)gJHZXgrXg Lra 6"AjIhLo/+ @?e IBbg k Lr)`ra IbgDK&* AjXI \ra0P0 J/jpk* jLۃg IbgLK "0P0JҀO~ AjXI \ r?a0P0JAOiHZxgsgAj+ggF1KXm lI[L`[`C\ap @?enK[`ho+p t&` t9`񈙓,j Y񐙓, j*sasj0ҐX aOn@:eR`Hdjhj`"@0@ ҐXOn@:epAjX kkI \lr` Jg P@ ؃m@:e ĥ9JPD @:eg0P m@:e?eg@ 0TgL@:eg0\g@:eJ*po+h`0 $@`N`OMg@9e | I҂gL@:eg@JZa0E!OҀ MC `0t AKgn nJjPD@:e @:e@r2`rH`X m@:e gL @:eRea Ir`hjl2*000WOnM Lq @9e k0J gm?eg@w@?e 䙭B)Lp4@9e I H HKbg kHbgjm HۉD g@:e?* L MB )MB@)L@:eRa0O *D @:e)p, @@9e @9e  jhl"000wO@nML}I ҂gL@:e@re`000wO@nMLb Ira000wO@nMLO ʢv`v1`D0𴙀@aM@:e000𐙞ewO`nM L, Hrj $`000wO@nML Hrj `000wO@nMAL@ @:e p89e@I hKbg k"eP\ JAg Pra0ҁ Oh4J`P ӧBkX)Mg @:eR?a L JJZ` Kc`Cg hKjjLM gB -M@:eRa kM Hl " Hl* L ԌM I҂gL@:e@JZ a0 EO ) kHgl"$F2l* \@:e0 Og8@9e"eP\JAg @:ee#D0 DOҁ8@9e"eP\JAg ʢ^`^)`D0𴙀@M@:e0e00wO@nJFZ` kHL$ #F2kl* lHbg+0 aO"eP\JAgF2* q)m@ L M0J ҂gp\@:eR+ajK0X O@:eep+D0𔙠1T! L@:e0e00wO@nap@ @:e k c` c a jsa0tK 0X  O@:ee0tK nBP\)M Jg @:eRea ngL B -M@:eReua @?e k h‹eHlV*j?+)@ L G Kc|gP| K 7` nB)MgCg@;eRe?a L jҰT B -Mg@:eRe+a @?e  hek kHl" M  h iP\) Jg@:ee!jKK1p+)-tdk ta%K+0jҁ On"eP\JAgI%"@C M " I rAa0JL ja000𔙗OnMALjj  L@jjjP\)@ I r``000𔙗On"j "0O  I r aLJZ`0 On Hbgjl"" *0 EO"eP\JAg 8" kL I hI KjLj Jg@:eRea !\`\2`>$tWaIh*\@:e0AOR" " JD3M d3F?kl/Z`PtH2I@b dj k0@kDjDbL!+bl* taDg0𴙀@M@:e0e00𐙗OnpQ*\@:e0!Ong"eP\JAgHbgl *@ra@@:epk=eb hd@IeI+b+D0)aO"eP\JAg +b @x3M gB)n3@ t`000𔙗OnML"eP\)JAg@D@‰ | JV2T2I "" @jajjHZaj0On"eP\JAg @҅ 0J* Hbgm HX@:e p񸙉=e@I) SKI aE0OE"dIjKjLM*)@"eP\JAgkjP@ L@ P\ Irl`000𔙷O nML"eP\)JAg Jg@:eR `4 @9e"eP\JAg Ir` @=e0AOn8@9e"eP\JAgiF*Cg@r` @=e0IaOEҊ 0Ng@?e @e ҏ 0Jn ӣ* PD똩nL@:eB ?e)L@g @=e)p,@9e)"eP\ JAg L@P\ Ir`000𔙷Onh Jg@:eRe^a Ira L Ira l IraL D LL isf`000𔙷O!nML"eP\)JAg @:e@:eg LL@:e  ies`000𔙷O! nM?L"eP\)JAg mMaڀ@ Ir `000𔙷O! n NJN @ Ғ 0Jn* @=ep @=ee@Er ` lHbge+0"O  Ira0O nraD@:e le Ir`000𔙷O!nML"eP\)JAg o Ir `000𔙷O!nk pO=eM o@ @aAA@`  Ier aL Ҕ isea l0Jj ` ` `܁LM @=e  Ier`000𔙷OA nM"L"eP\)JAg n Ir `000𔙷OA n NJi N Ir `000𔙷OA n Obg OgCg OF2* Ir `000𔙷OAn kOMo l i sakmO 0Jj_aE " @kl" OM o O9ebgjm g@OK"eP\JAgE "" kDEgENba @T@O ҂gjZa\+E Xk kk؊lM gBX)M@:eR^ a E " ` k+ u`]`kE[` A ҐH@:e "0TJg\g@:e0 "On"eP\JAg@KJ"JH`ӐX0 BOn@:eR`"eP\ JAg !j*HM@:e"0TJ0$҂Ong@9e"eP\JAg0TJ0TJ$ @ Ҫ_` ` @n"GEJҐPg:e@  񀚐H@:e"0TJ @:e 0Ґ$ҢOng@9e"eP\JAgu_ `ua @9e LHbg h"eP\ JAgl gG)K j-a XI ҂gP\ J@:e*H :e@'"0TJe0 OenҐg"eP\JAg ]`]` u0TJ0TJIJK I r&aLJZ_ajIJKLM gBX)M @:eRa LHbgjl%"0`On  ral0M` taLB\`0n Og"eP\jJAg`G M t,`\`t`tJ`\@:e0O "eP\JAgta L 񀚐H@:e*0O  kOmꍘ $ I raX@:ee"*p@=e0O"eP\hJAgjj ʘBPD똩L@:ee@r\gTHagPnm@:ejM 0P\JӢMg@:ee>"># |˛8`D0g@M@:e0e00O n"eP\JAgD@:eĢjPD@:ep@=e gM @M@:eRa ML@ Ir `0O"eP\JAgOkLV+E xId*kIjLMP\) Jjؐg@:eReaE l |K,EkP X8M=ekjE)@ @g M X L ҩP\ J@:e*E0E O"eP\IJAgkl*0Hgg@:eR`"eP\ JAgd4 k#@h Ir`000OnM L"eP\)JAgL P\ E@H isa 0Jn" t`A Ґ\@:e0X On@:e""eP\ JAg M@=e @e  gB -M@:eRa IraL `jl_ *  \ @?e Hbgjm HML `jl>"P\ Jn0Mg@:eC2"eP\JAgE *0 O"eP\hJAg 񀚐H@:e*0ԙ" N 4g"eP\H JAg xI'"dIjLM اBXj)Mg @:eR~a nHbg+0BO"eP\JAgkkl hm H \*0ԙBN `+ k#4 hIIjLM jاB -Mg@:eR>a kHl *0bO"eP\JAg @l8" IkB[+ar)` raL0Ma | j3* lHF2,*0 O"eP\JAg iC\as`@ | jH \h jl"P M@=e @l @L$ t `\@:e0ҢOnl" M taLP\ J@:e* 0nIOEE"eP\IJAgP\)Jg@:e"eP\JAgP Og@?e Mbg NI J k"eP\JAgP Og@?ejIJKLM L* Mbg P 8B)Mg@9eR`"eP\ JAgHZXgrxgAjXI \Z`*0O"eP\hJAg r `E}" XK"eP\IJAgP\ 8J@:eXg@:eRe\gpL `@:e"eP\JAg Ir.aE,"L is'am t"a Ȣ0J 80KB9e@L"g @:e @:e) "eP\ JAg @:eD\@:e0𴙞eg@BMg@:e0e00On"eP\JAg  *"eP\JJAg *"eP\ JAgjBe. j @2i d eHkglg $F2l*000OnMbLq@8e H j` I r Ҁ a,@ ҰL @ i sw`000OnML Hr ;` @:e@re2`r`000OnML Ir"a raKB]`000OnM LA5)L@?ee @ ҨKJZa\ @:eg@AgL@:eX@:eRe a``Aaa@0J.*zdjKL@:e@r.`rajx AK  H2i@ Ґ\@:e 0`O hh3 ` ng@8e *KJZ` H\ @:eg@:eF@L@ۣg@8eC2e j @2iedgXg:e@&gR-a I ҂gL@:e@r` 0EOg@8ewdhjl*0BOg@8ejKj j" @2ide@g L - Ir`000O`nMbLq@8e Ir`000O`nMbL h Hn"000O`nML @?e @?e e ʢGA)J vBP )M /`^$`p@ve`v`D0𴘀@M@:e000𐘞eOnM Lv=`va : @9e g@9e Ȣj BPDL@:e"gB :e@)Lp𬘀@=e ڰ4@9e @9e@8e}d @?e Hr`000O nML/ @:e@:e g@?e Hr `000On @:e g@9e@:e g@?ee j @2id$ge@g Qraj0Ґ On@8ewdJQ Ja000qO`nML@8e@=eg@8e `aݠہ`qKq j! @2ideg&g@ IZ`Z`r`r`j90IP\J0N@:eRe(a 4IK |g ʢx\gvD`v`v$a:e@ꍛgm @:e@Xg@:ewd:e@ꍛgm:e@ꍛgmD0𴘀@M@:e000qeWOAnM L@8ee j! @2i`deL IraGCg-J Ir.`Z`r`r `j$ralj 񀛌"@HCP\J@:eRaP\J@:eRef`jKxd̞P< @ is `0007OnMLq@8eQgJ@:eRea gB)K+L @ @ is$`0007On @:eP\J @:e Raٞe ہ`ܣa  0J*@, Ir`0007OanM" L ʡv `v;`v9`D0𴘀@BM@:e000𐘞e7OanM L{MB@)L@:eL䘰M?eB@)LMB)L@8ej JD@:ep g@?eg@8el e j @2ide@ @2ideOgOLL\gP@:eMdd j @2idoegoll܍8e@%g 8e@M Nude j @2idqePqPoNgNoܒ$\gP@:eRG@EJSTdde j @2iedgҰ\W-Rn@?eJDdjKe j^ @2ideLgO%gBMNR\6m@:ee"JZajK R m@8ejvdR\ m@:ee ڡe j @2iedgR\͝%g:e@mR e̙8e@mud je j @2iedgR\ѝ%g:e@mR\ eЙm@:eR\ e͙m@:eR\ eϙm@:eR e ء8e@mud je j @2ied @2iedg$gL8e@)LA8e@5Lud j @2ide Ig r`000qXO neML@8e,@ j\ I ra0J.*xd ta,@:eIeD"rA`]gP@:e R\e ɡm@:ePem@:e  @:eIg@:eRea @?e e@?e J@e ҤjK j @2iegd񰝌@=eDd j @2ide\g0X@:eDde j @2iedgҲH$g@:eXeAmg@:eRe$ar!aRDmg@:eRe`qD@:eDe@:e0g&mL@8e #vd je j @2i$deg҂g2@nm N@:ePNe@:eDl@:e"gAeFٰԘXNmqN@:eQP e@:ege0ԘrTANmL@:e@ !@ wd j j} @2idcҚeg&g+\gFD@:eB؞eBdq C` )C`DIcad3c `\g0Dg@:eBeC `)C\g qHg@:eDbIDIk`Qgvde j @2ideAg "C*jxdBl؀nML@8e xde j @2iedgmp4n o @9eZea000qOCnML@8e wde jX @2iedg}gp4jnQjo  @9e Zea000qOHnML@8e]gwd Qe j @2iedg}gp4jn Cjo  @9e Zea000qxOMnML@8e]g Cwde jx @2iedg}gp4jnQjo  @9e Zea000qxOWnML@8e]gwd Qe j @2idevg$g2`GgJI j`JJ2B(`PPg@:egemjk& BL2va2IM`nk  JFgjKZnXgN&000qXOnMEL@8e#AE5`AvdP@8ee j8 @2ie dg0T'g:egg@mjHCg0J ҂gg@?ee"!A_`000q8OneMeL@8e0 7@8ewde j @2ieNd$ :"8"6"4"L@:e L e@:e Le@:e Le@:e"gLe@:e 0 0Yg kng@8e{dj j @2ideg@XlF@OP@:eLٞe*qD@:eDe@:e0gpm0L@8eHnm@:eRe`qD@:eDe@:eg0sm1L@:eEieD]gIQXl@:eRey`QXl@:eeKK}gJN2L2KegJ1D@:edMaڑHel@:eHMhgb@em@:ek`Meg\@:eReaQL˙@:eMjGٰTeCMR.`GV"qD@:eke`IejKMqD@:e@re`MJA*qD@:eDe@:eg0|mPjjC JґDș噭@:eMٞe"R `qD@:e@re ajGQL˙@:eMٞeIeM*T@:eP@k`fOe`n"1@deJAg"e@T~JAgtH:e@oOJOTeJT"e@TJAgsjDTXK`DAOقg2@nm@:eSZe`V2H2gAIKJitL|GAqJSBrDno@:eJe~"Lt\l3"QLЙ@:egJe*qD@:e@re`"e@TJAgjKnJGA]J0@rH降@:eeReWSsGAUJnZXgJT@LjKO\g0PPGAUJRrSj3aWU@S@QUrj`Q@:e󤘕e@=eSU@eSg0ԘU Nm@:ee"e@T>JAgSoCc`N@UUnjajKOU\OSUXCaO`U,Ukr jՙD3M Ȟh3maәĞgabrJaUHrxg` $m` , #Z`rxg#kn@"Dl@:e0Ԙg0P NA@:eeCJZ`@kdl -l"jL#UP"@BUiMBT!L@:eQٞe"Dl@:eMQLKQ0L@:eK0Ԙ0P홲NA@:eeqD@:esbe`SuCxc`u|C_a𠘓@=e󤘓e@=eeLS@LU`dV"0Dęom@:eRe a@`ABUiMBX!L@:eM`DeQ_"@AKقg0Hљ@:ee*M_"Dl@:eJMRMQ0L@:eq0ԘlM N꙲U`d\?"0Dęom@:eRea@`ABUiM\@:eQ`DeM"g0HA@:ee_ *Q"Dl@:eJQ 񀚐H@:e%"0TJKQXIQ0L@:em0ԘAlINK0P꙲@:ee0TJ`D0Dęom@:eRea@`ABUiMBX!L@:eM`DeQٟ"g0HA@:ee*M"U2X@:ee"Dl@:eKMRMQ0L@:eq0ԘAlM N뙲0P@:eeU`|JC_"0Dęom@:eRe?a@`ABUiML@:eQ`DeM? "@AKقg0H͙@:ee*Q"Dl@:eJQ|JEIQ0L@:em0ԘlI%N`DU|JI"0Dęo m@:eRea@`ABUiM@@:eQ`DeM"@AKقg0H͙@:ee*Q"Dl@:eJQ|JEIQ0L@:em0ԘlI%NyUJRA+SBzr=aUk @Q @l4"Q@0%H-"PHn:eo`A@0M`D?Re2`Q0𰘀2XM@:e&*P0Ԙ MNA@:eeRaSUGriatgaP0ԘFNA@:ee0Dęom@:eR`Q0Ԙ BPNA@:eeUʚ@B0HmL@:eM"UT@:ee"qJ`r2Xk٣g@:e*M0L@:em0ԘAlӱPN M@:eeD@:e0ԘgP NAj"e@T>JAgTe0d  eelLnZ XgLLMMN Ne j @2ide\ggQP@:e"A*s ar `^\knKB2ddjje jM @2ide\g2@8mg`Z `r:` r:`r a'D)IQgudr9`Z+`r+`r)`dg\ @:e0𴘞eg@^Mg@:e000qeYO3nM L@8erg H@8e8e@ge j @2iedgp@0L:e@%gg0X &aF+0𴘧Mg@:eud0M0g616Mg@:ee jM @2i degM%g02XM@:egAKe *J Pҩ on@8e@jQ2X0M@:ee"L:m@:ee>"qD@:ej@qLe n@:e`e+ mj``:sa@2@2 qLn L@:e`+ `+ mI0Ԙ Nl@8eydq\nm@:ee j, @2iedgp@0L@:e"gP@@e*P@`$QP@:eZea@UMMZ`Zi`Z`ZJ Z` $QP@:eZe`$QP@:eZea@mM($QP@:eZea@%M $QP@:eZe`$QP@:eZea@=MP0ԙol:eGN@OBBp4aA܀ a9e@@jKacd萘 $QP@:eZe`_$QP@:eZe?a@j M H#Z``Z`r3`knZXgBkd"l@,l+ r@a `@#`j`Kj`@ݤ&Eg@dm *jHr aHr a%jjHZ`Z@` r ` Z`r`JZajCrap#\" aܠD%j /JZ`opJ# @av# b" @`DgM$ hI BIk`opX :e@g eIk`"m\jHJ$Z4`D3 m`i]]]aI]]]]]]    ] j`P*j* AjV " ېBۢjmp#\" aܠD%jjjBKbgjl"Bbkgk #Bp#@" aܠE jopX g@:eeooooo o ooH r5` Z%`r4aDl@:ejbp cڄD@:ek lL3 mJ L2I@݁ݞer`rHr ajjjb@e T bja@ 0TbJaB|JEDZXgJ> GbgjKlra H r<` Z `r `r`` @ ra @H"g 2@nm@:e @?e@M@g@:eX @ml@:e `eA` a@ @ "@ @JJ 0a` `J]* ` `J* ` `J* @p\  aN%  `@`܁ۍB @:eM@Lg 2@emn@:e @M@:e\gOP@:eX @lm@:eҀa@eG@ )Jg C:e@Mg 2@emn@:e  @:e @ Ze `0pH29Ki@*000O nMgLq @9e@g@:eX @lO@:eҀa@eJ @B M:e@Lg 2@emn@:e @M@:e@g@:eX @lm@:eҀa@e  @B M:e@Lg 2@emn@:e @M@:eDg@:eX @lm@:eҀa@e g@:ee 񀚟$dDDn "pg@?eNe (2@ nm@:eBBkBeIl/"G@ZMQ`xH2KiPNl@:egɜ?e @,L0𴙇B0X M%L@:e0 @=ee gB KjIABCDǘOFZ`D3 m`ie)))) E - E 9 c Q 0OȘv`^!`vg`vy`v`D0𴙀@eM@:e000𐙞eyOBnM\gv0H `hFK[`jDL,s`kl"ʘtJ ҂g @:ee* \g ,H@:e B !MBL@?e ̚B mMBL@8ee @B@!ML@?e L@:ee] @HX" X!*T0ԙ Ng@:eeBpDJDBhn`*"eT)JAg kI X !@@@:eRe`j@_@H t` Ґ\@:e0X nO@:ee-k @L #kl *@Ș 0H@:ee @B@!ML@?eǘ \ @ʘ B mL@:e Ҟe* X@:ee %*T @:ee *L@:egB@!ML@?e @Ҙ ML@?ee) k @l* T@:ee*P @:e ҚB ML@?ee k @l}" `%Dg@:e re`La0Lg@:e0 On@M' @P*" 0 B gƚ`욐P@:ee* @P \@:e0 'OngD@:ee% `P*"Tkj "# pBX!Ӑg@:ee* `P \@:e0 GOnBg % @kgl,m @ Fr`ra `Lra MX@:eJeRa0ngOMD@:eeD*D0𔙠L1T@:e000𐙞eYO nM LC`D0𔙠 LJ̜D L @B@?e!M@LʘB mL@:e * \ @:ee!* \ *`@ *0nO@Dg@:e 와КB@ ML@?ee \ 5"gDl@:eg@@r a0 On@ @D@ ҢgP n@:ee*@X \@:e0 On`@D"`@3 @B@?e!M@)LʘB mL@:e " H @:ee*@g@:e 와КB@ML@?ee @r` r`kn" @ "eTJAg r\ d2i H2I`h4kj$a`@ @ `@@ j` rd2i H2I@j ja0 OnM.uuK Abg H2I 2X@:ee(* |]g H H2iI t@=e 󤙈e@=e e@=e  @e Ҥ J R " T" X" \*0@'OnM t/+ X"I0@bj"# ҂g@!@:eRea T_" xIin_"0@'OnM <i"#Ұ@ !0@@:eRe`ȘOF$Z`D3 m`ie+I19m\ "ʘB0HmL@:ege"\ @:ege"񼙇BL@=e񰙐g@=ee$ @ $" @kl" `%F ҂gD@:e re`L a0L @:e0 OnV ҟ"ʘB0HmL@:ege"T @:ege"񼙇BL@=eg%ʘB0HmL@:ege "񼙇BL@=e0񠙐g@ _"ʘB0HmL@:ege_"\ @:ege_"񼙇BL@=egln 왰gannnnn n nnD0𴙀@eM@:e0e00yOn"eT JAgȘv a Pg"eT JAgD0𴙀@eM@:e0e00𐙙On"eT JAgȘoF[ `jDL&+PkL9+kl*D0𴙀@eM@:e0e00𐙙O n"eT JAg%ʘB0HmL@:ee*"eTJAg Tg"eT JAgȘB ^mL)` ^`vXg D"v`D0𴙀@eM@:e0e00𐙹On"eT JAgvXg \gxg0HY#vxg +ʘ@:eg_"\ Ңg\@:e " T%0Hʘ@:eg?"\ Ңg\@:e *@ pPUM"eTJAg P@:ee-*Dl@:e0@ҀOnUM"eTJAgʘ@:eg"\ Ңg\@:e Ҟe" k @l @$p@=e  e@hȘv aʘB0HmL@:eg"T@:ee* X"eTJAgD0𴙀@eM@:e0e00O#n"eT JAg @@aB+0gO@nMEra0O H ("g02XM@:ee)"2X0 M@:ee"0 Ong"eTJAgj0pL2H2Ki@F=jj @@J?*0OD0𴙀@'M@:e0e009On"eT JAge0(**) (@ 0 j @2ideg  QP$g:e@gB\@:e ҂g0qTeM@:ekjll*jjlh*X XJҰT J g@:e ҰT (J g@:e Jel*qD@:e@reM` GA%JI @ @ n^* @ @ n g*@ @2id$gLҚeg`C``C\ggqH@:eude j @2iedgX, @ K JV2L3 Z aD0g@M@:e000qe9On M L@8e g2@@nm@:egA00pI)M@9e 9e͛FQ@)M0O @?e `en"1@8eqde j @2iedgX @!KJV2L3 Z aD0g@M@:e000qeO n M L@8eL$gBg ҂g0P)MpJ:e@ mKwg?e@LB?eg@)M ̙q@:e@=e0 O @?e !`en"1@8esd j @2ie daH &a(eHbgjJlF"qLlL@:ege<*0𔙹m  @8e e mN`J g@:eegqXom@:eeRaH ` g@:eQeg@?eeҚ &q@mg@:ee*0𔙾meHbgjJl"R\nmg@:ee*0m Q@g@:eHeg@:egqXem@:e𤙞eg@=eed Ir `000𔙹OndkOl~" |" 0j6LuOj Ng@?e  Ie rR`Z`r `JZaD0𔙠1T(L@:e0e00𐙹Ontra @m ̚m@?e Me"QPDHg@:egemgqX@:eed Ir`000𔙹On] *000𔙹On MLq @9edo@jl" "p g?e@gqX e m@:eeenHL Ir a6jMm@?e0rd&n j @2idegjҐL@:e"g\em@:eFXem@:egP:e@ LXem@:eg @:eRٱHe m@:eP1Het m@:ee "\ m@:e @ٞe1Hm@:ee"1Hm@:ee"1H m@:ee"1Hm@:ee"\m@:eg`L0L@:e`HLem@:eҰT o T PD n:e@ @PXe m@:eg @:eHّ\em@:e on@:e`Pّ\em@:e1He m@:eee"Dl@:eLjTXe m@:egl @:e @jeA `jm @ %H였n@:ee1Hm@:ee&"Xm@:egLe0ܘ@:eReU`0P0ԘNm@:eg8e@iQg|d1H m@:ee"@ m@:e jH3 ҍ`J+DL@:e L e N+ `Tه @:e @ eJ CgJ$@8eg @:e Dٮ jx @2iedg2@ nmg@:erP)e m@:eҞe"R@) m@:egeL0ИNg@:eRe`0Ԙ0(Nm@8eiQgtdb$L@:ee[$L@:eeT$L@:eZXgreXg"I$L@:e0P J"g@:e  e "g@9e Ҟe# "gD@:e Ҟe@)m@:eg"g0PJ @:eҞe*0Ԙ0(gH Nm@8ejjjjj @)m@:e"ge|gjpl,5"@)m@:e ҂g @:e Ҟe(*0P0Ԙ (H Nm@:eji  @:e p@:e @8e@8e @8e@8eCj @jL !@)m@:e e"000q9O`n Mh L@8eP@ TgH@:e"g@)em@:eFQ@)em@:egP:e@ LQ@)em@:eg @:eXe@] "g @:e`Dٞe rP)m@:ee"D)m@:e(g0PJgpM@:e Ҁa@ېPA?e@@)em@:e @ٞe\gD "g @:e @)em@:eL7e"2 #kKnN2* \j " | jH @:e@)em@:eL7 e"KgBn3+ Xj@^j ұP)m@:eP)@@rPet m@:ee "P) m@:e Pٞe trP) m@:ee "@) m@:e DٞerP) m@:ee "@) m@:e@PٞerP) m@:ee "@) m@:e`HٞerP)m@:ee "@)m@:e HٞerP)m@:ee"jR@)m@:ege"`A R`ICU`rP)m@:ee"(0)@pJұ\ M@:eGg @@kL\gPD #k @:e \ @:e \ @:ej j jPD@:e Xٞe ` ICqH @:e `\  j @2ideg@XE@KQX@:eIٞe *0m L@8eF옉?e@mFeƚLm@:eFeҚLm@:eFeؚFg"Hm@:ee]gDQXl@:eRe_`QXl@:eeJN2}gL2KeCSQ"!jF@m@:ehofegqP1@:eqeg?e@FFIP@:edRee!`Q@=eqDe@:e@knZXgeKꅙk]#1@"1Xmg@:e Xemg@:ee"\mg@:e 0PgQ Jm@:eg"g0P J@:eg.)LdB#J*o0H@8eXmg@:ee"\mg@:e og@8eCxd0[ Hg@8ee js @2ie dg1Xgm@:e@em@:e"g1Xem@:eg0T g@:e"g0PQ J0m[ H@:e g8e@gvde j @2ie dg1Xgm@:e"g1X em@:egT g@:e"g0P Q J0m[ H@:e g8e@gud js @2ie dg1Xgm@:e"g1X em@:eg0X g@:e"g0P Q J0m[ H@:e g8e@gud j @2ie dgұ@gm@:e"g1X em@:eg0\ g@:e"g0P Q J0m[ H@:e g8e@gud j @2iedg1Xgm:e@&ggP@ @:e0P0Q Jgm[ H@:e 8e@gvde jR @2iedg1Xgm:e@&ggPD n@:e0P0Q Jgm[ H@:e 8e@gvd j @2ie dg1Xgm@:e1Xem@:e"g1Xem@:egPH g@:e"g0PQ J0m[ H@:e g8e@gvd jr @2ideOFZgg a0Ԙ0N@8ejddO7䀜$@8e j @2iedg\g@:e0P"J @:e"g*00Ԙ p N@?e@8ejvdg@?eKJV2eT3*000qOnML@8eoIһ jr @2ie dg0PgQ Jm@:eg0PJ@:eҞe *0Ԙ0 N@8eyd1Xm@:ee="r=`j gґ\00m@:eI9e@  ґ\em@:e9e@ gH @:eg0P0@:eg@8eC۸ j je jr @2ied"m@8e702L@=egґTeʙ:e@mTe̙:e@meΙm@?eeϙ&m@?eeЙm@8evd0L@=egґTeʙ:e@mTe̙m@:eeΙj @2ide$ghB ‚@b *Hpa\gg@=evd\g@=e@eejJ @2i deEg J `vXg *\k mI҂gT@:e K m҂gT@:ek` p?e@g 0eM@8ewdpP @:e0TJjF @2ideҀj\ggP0T%go m@:e 0 vdj @2iegd00nm@?eDdej @2ie$dg0𴘱@0M*L@:ee ""g0T  ҂gTmgM@:ee" ҲL J M@:eaBe#raVja raqHg@:eV X Xn *X Tn*P \D V @:e Ҟe=*2@0jL@:e Ҟe1" 2P @:e"ge"RraqL A n L@:eZega@*V` @:e"ge"q\ @:e ўe8@=e VP xT {dqg@8ejejF @2i̜e& $gPT[ &k\Xg n j jej @2i de\g$g0Pgbg K;e@gBe\g@P@)L@:ege\ggH@:eҞe/*kc%`kGCkklGDlZ `Ua\g0P@:eC a Kpِg@:e@jwdjKjejF @2ideK"@8e3jLjk@?e?egg@ @:eB :e@)M@:e "@8e@8e@8eU@8e8e@0Jgg g@:e @8eKbgPIp0 xk A+K XPۀZK pL:e@ @8e J Jrap<m@9e * 8e@+ gK @:ej000OnM L k K@?eLKsaej& @2iedgL@:eZ `H2:H @ddjj @2ide\g:e%EF EH0%g1"\gPK*jN^XgH2\gHK"* jj \gP4EYgm0T@:e,ڍh odpwdjjje @2idegj D$g@:eHeg@:egeL0И N@:eR`iQg|d $"pD@:e"geR*$"L@:e Le@:e ҞejL@:ee 5$L@:ep\ 0񜘱g@:e"g"K" O Pj@DK@p@:ebkd8e@I$@:eNٞjjj% @2iedguLIawajK*jN^Xg0d JpP2iMl !dj @2iegd%gP?e@g* udej @2i dgel%g Ir` JH2I ud荜 IraKragP@K *0L@?e*j@r@`PDW-0L@?ek@nZaj% @2id\Қe `t,`t,`t,`jdd t)`tj`gD0𔘠1TL@:e000qeyOnM L@8ejjjjj @2ideM."!gg0PJ@:eLlLn*oA[`jFkl *P?e@gNXXgudjejE @2idtҚe%g5`\g`t+`P@8e.(t.` t`t`D0𔘠1TL@:e000qeyO nM L@8e jKZjNYud XgGErJZa~IYjej @2ide Igr`0009OnMLq@8eOkx$gm䧛V%PtoR#en"0009OnMLP0P Jg@:e k JJ jP\ @n+* kAn&*P0 ]"" , JP2Iailـ|M hyd% @:e*J J raeje @2iedg0P$g Jg@:eҡBBP@)L@:e Ire`0009O nMLq@8eOkxm䧛N%en"0009O@nMLP0KH g@8e mBkJK qm.a   .mp`jxdOJajejE @2i dePg Ir`000O@nMLq@8eOkx%gm䧛d%Pto`#en"000O`nML0PJ g@:e k J)J jp\ A4" @n&* P2I, KAaLc>` "  @:ekkaA܀a@F%P\@:e*J J rap\AnmL@:egT@:eN" A`A܀  @:eaA܀a@ aKqkmK*ydej @2ide\gXml@:egAl@:egB XeP #u`)C``)C\ggqH@:eA`Avdj$ @2iedgT$g @:e8ee@wdej @2ideLgZ$g`xH2Ki0X0 M@:eΙ&0 M@:evd0ԘNej @2idge Pgrg`r`0ԟNMkL\g0X#0*M@:edd0ԟ*N0ԟ* N0JMej$ @2idegҎ\g08$LJ `\g0 M@9eeggH@:e "mL0 M@9evdoTh3ik0 JM@9ej @2iedgp(@9e00 JM@8e 9e@鋚udejD @2igdlesgg`s`0ԘNh2iH2I00j M@8edd0ԘjN0ԘjNej @2ide#P ҰPg@:eRaf A`ځ@ ̚AjXI \raLK *HK"PK*Pґg@8e󬘲HPLHmBpLL0@:eҢgg@8eR?`jK6ej @2iedg2@mAn:e@$g DPXl3ikAxmG @ E jl"0g H@8eudjc @2ideug$gI`]Eg#`JZ#aD0 @M@:e000qenONM L@8e ra jXnI҇BqHL@:eg` jl"0 Hg@8evd`TZ`LkjaD4Q4aB`tHqHnL@:eeL`Kejc @2i dg럚e(_jga000𔘙ObnMLq@8e_`000𔘙OcnM LPH ȥ:e$g70M@ObgjXIPPg@:ee*P@K*-mvdP(uame[a000𔘙OxnM Ln",@,saAt[`,000𔘙O}nM*LC4KAtp gg@8eej# @2ideg\0:e@%g`eA`a@(2 J j ҰX |JCCazd@@ jaP蘣g@?e J eJ  |JBi @`h3i@ J Iro`Z`r^`JZ[a000On M Lr`JZL JM is-`000On MJ Lq@8e@:e"g@:egg@?e`A e@0Jn*@=ep@=ee @:eg@?ee iL JM is`000O n MjL0Jn"@:e"g@:egg@?e`A e@j# @2ideҨ2 Dg|J Bgib@h3i@0\ ҂g\@:edj!B|KJcc+aJpL:e@ JmlڰP@:e"g Ire,`000qOn M?L@8e |JBi(3m@`h3i@J@:eg@?eQgojmO\ C`J@:eJ- jaBJ|Kcc/azd :e@@ @ n*J @:ep@ @:ep䘢gg@?e @  |JB9ei@h3m`h3i@g@@=eej @2ideҨ2 \gg@iҀ@Cawd Di(3@i@" @r a@:ee\g@=eIj# @2ideҨ5jJahdH7` `s agg@=ePgddJej @2id1%eBg"\g@=ee\g@=eBan*AjBvdua&!\gg@=ege\g@=eFan*AjFejC @2i deL%g IJZ ` Ȣ\g@?ee J raM Ir `JZa\ggg@?eZe`QH@ JH2IAX"aHR"JP"dl t$` tGals(`sBa\g0L@@:ege Z5`jDkL(+kl+"gXR`%t"agi+\g0LD@:ere`r`hh hl I r` r$`\g0 ,O@?ee Lra IraKra\g0L@@:ere*`:r`LZ`Z"`JZahjl " \g@?ewdJZ` jNK r`rpajejb @2idegLPTkJ"%ggBEH2I@*u@aF>"0P J@:e_H`kflC#l t>at a̛'.u` ʢ v,a*,șl,u$al򄘓 $󌘏 #0,H @8evd荚 IraKraD0L@:eraua0do+ L L isaosaLP`o +0P IJg@:e"Pdk*ej" @2ideHg J&gJZ`M IraO ұg@?ePD.*,=e@gg@8el{d @:e ҂gP ȡ @:em#K`W 蘇B?e@)LM ECK۰D˙gL@:e  B 0PgL@:e J ra@?eLB0TL@:e  Lea@a܀ Ir`000O!nMLq@8eO*000O!nML n"000O!nMLN%"ln *LlmLmnLn0P J@:e "0L,ONQB@?e jXI㇚H@:e K ?eAJĢ@﬚ L ȣ @:e J r ahjl" @?e rma lj 񀛌f"@Hc" is`000 OnMLXl0JnL" IrHa IrCa Ir`000OAnML8Or-aKr*aKr'aF$*P"P@K"PDK*@0L@:eCk %.˙%KsLa?e@g ȡ@?e gĢQB@8en, Kp3mmFj @2ide @2iedg$gp @8e@8eudj @2iedg$gp @8e@8eudj @2iedg$gp @8e@8eudj @2iegdp𬝊@=eDdj @2iedg$gp @8e@8eudj~ @2iegdp蟊@?eDdj> @2iɜdeBg=e*@r a00ĞgM@?eDdp@?eej @2iedgxL< KP2i00X$g M@:eLr a0͙ M@:evdej @2idgeKgg"0ԘN00M@8edd0ԘNej^ @2ide\gg0x0 ;e$gM@gke+\gm0L ʙMg@:ewdj @2idejgs%g0X6` [`s`s&`h3m0𴘑gJM@:e s` s`0ԘN0 Mg@:e pg@8eud0*M0*M0JMej^ @2ide\g$g00 M@8eojle "\gʙ0 jM@8eeojl "\gة0 jM@8eeojl "\g˙0 M@8eeojl "\g٩0 M@8eeojl"Mr` Z`|gH2pI\g 0𴚪M@8een/jl/ra\g0𴚪 M @8eud\g0ԚNjL+#\g 0𴚪M@8enjleC"\g 0M@8ee\g0КNnjl "\g 0M@8eenjl "\g 0M@8eenjl "\g 0M@8een jl"\g0 M\g0ԚjNj @2iedg08J0 M@9e 0ԘkV Nl "0 M@9e0ИN kVl"0 *M@9e"0 *M@9e p @8evd0 *M@9eej @2ide\gg008 M@9e Lre`r `!"ud\g 0JM@9e Mr`\g0JM @9e e\gp@?eLr` ra klr`\g0j Mklr`\g0jMej> @2ide$ggjTh3i|g00 M@8eKe*Lx" Xr ` r`ojl "\g 0𴚊M@8ee\g 0𴚊M@8eke5#\g 0jM@8ee\gpHL" IraI@ra\g 0𴚊M@8e @;e e\g0M@8eeL"K *\g 0jM@8ee\g 0]M@8e e\gp@?ee-3!|gj0ԛ,jN"0 M@8ee\g0КNj,"\g 0𴚪M@8ee\g0КNjL!\g 0𴚪M@8evd\g0jM @8eeN\g0𴚊Mr!aLI@ra\g 0𴚊M@8eK @;e e\g0𴚊M@8eK e @:eemej= @2ide\gg008 M@9eje##\g 0*M@9e e\gph@;eke #\g 0M@9e @:evdej @2iedg0X$gpHK," H Z`xH2[Ki.0ԘN0 M@:e @:e0M @:e @:evd0Mj @2idegJ%g00XgpM@:eg@8evdej @2ide\g$g00 M@8e Qrea P" Z `|gH2x[Ki.\g0ԚN\g 0𴚞 M@8ee\g 0𴚊M@8eje0#\g 0jM@8e Ier\gpH>aI@r:a\g 0𴚊M@8e @;e e\g0M@8eeK"J *\g 0jM@8ee\g 0]M@8e e\gp@?evd @:eeej @2iegdgkXh3ig00M@8eddj] @2id$geKkLgg+0ԘNkL+0OkL\g0X#0 ԩ M@:evd0ԘN0 O0+M@:ej @2idgeLgZg`|P2I00KM@?eDd0ԟNj @2idemL@8eudej @2iedgD$g@:e2e8egm@gvdej @2ideg,000qZOnML@8e\l@:ex"gj\Dq JeA8eDX@nPDA@T@XQgudj @2ide"L0Ԙ`MN0PJ%000gNMl @:e 0 gMl@:eg0Ԙ 0NMl@:exdoTh3ik0И0t0Kp0tNKӫMlejt @2iedg$g PLbg%dJ+lPXp3i0Ԙ0@NMl@:e XRea"gD@:e0𴘞egD M@:e0И0 NMl@:ewdej @2id윚eg$g'Mp@jl|g`O |gr0tK `a|z2?'Z8`xH2 Ki@0Ԙ 0mNM`l@:e"ge*D@:e0𰘞egDMg@:e0Ԙ gNl @:ezd0TJK0И0TJ0T0J NM`l@:e"gra 0Ԙ0 N Ml@:e0Ԙ g N l 0Ԙ0mNM l@:e e*D@:e0𰘞egD M@:eOr `r`0Ԙ Nl0Ԙ Nl0Ԙ +Nl{j @2ide$gg҈2xH2I0Ԙ0@NMl@:eLre&`ra0𐘲 LD@:e0𴘞egDM@:e0И0NMl@:evd0𐘒Ljs @2ide Lg)"r,`0TJn00t0ИKm00tKK8e+ ON+Ml@gd0TJ0TJj @2iedgxL< KP2i00И0@OrNM` l@8eedj @2iedgXg:e@&ge " g@8eudg@8ejS @2ideg $g ҂gqHMn@:elD!jKlM ,ra l#0eOZl`xH2I@0И0tNMl@:e eC"Di@:eҞejD l" (2I〚D@:egPe@:e OLeIqa"gQTm@:egPe@:e0 s M@?e0И0 2NM l@:e{d0Oe@j @2iedg\ :e@%gF" g@:ewdD@  \@:e0𴘞eg@K M@:eB e҂g0ИPNm@:eB g@?eqHe@:e 0BفM\l@8eej3 @2ie dgD%g@:e Ir"a J n*HJg:e@g@8e @:eg@8evd\g@:eeg@8eej @2iedgg ҐH3ig HgJ@:e0g8eMl@gudejS @2id`e %gm j@ݐHh3i%g@*0TgJg\ @:eg @:e0T0 J0Ԙ0T0gJ8e# OaNkM l@Ҁ`zde@j @2ide@jKlkm|g@<g@9e g9e@鍚Ҟe|g 0ԛ0@NMl@:e`wdj3 @2iedgD$g@:e I re`000qz OniML@8eL\ I raGA)Jn*0Ԙ0NMl@8ewd @:egPe@:e@ejr @2iedgD$g@:e Ire`000qZOniM L@8eL\ IraGA)Jn*0Ԙ0NMl@8ewd @:egPe@:e@ej @2i⌜de `jlg"@@8edd0Ԙ0NMl@8eejr @2iedg\$g@:em00t0Ԙ0K8eONM l@wdej @2iedgD$g@:e Ire`000qZ O@niML@8eL\ IraGA)Jn*wd @:egPe@:e@ejr @2ide\g\@:eDdjR @2ie|gd$g@8e 8e@ge|g0@M@l@:evdj @2imde Igr$gaL \I@r+`0TJ \ @:e @:e0T0dJ0  8eOM`l@yd0TJejr @2iedgqH `nMg@:e&kLe=ad2iH2JJidH |g D"&A$\'@:e e&+D&0𴘀@̛M@:e000qe:OniM L@8eKs Ia"00 OMl@9esd "0 Ml@9eejr @2ideQgr$gc`\@:e0T J 0Ԙ@0KN Ml@:e Xe"QTm@:e0𴘞egD M@:ee$QTm@:e0𴘞egDM@:ee "g0𰘑DR M@:e0 Ml@:ewdj0TeJejr @2iedgҐL :e@%gDe" g@:ewdD0𴘀@,M@:eB e҂g0ИPNm@:eB g@?eqHe@:e 0BفMl@8ej @2iedg\$g@:e"nAEL +p+r+sAEL `0tg0Ԙ@K,Ngl@:eDge"@on@:egQTeg@:e0𴘞egDL M@:eeDg"@on@:egQTeg@:e0𴘞egDLM@:ee$D@:e0𴘞egDLM@:e "\@:eg"gHe@:e𰘑g@=e0Ԙ(N l@:ewdjR @2ide@g \gD@:e`jme@\g \Ja @wdgg@:ege\gP@:e j @2iedg 0L:e@%g0te0tiK ng0t@HKh0Ԙ0tg(KlN LlM@:e 񘙞e$D@:e 0𴘞egDLM@:e eD@:eL ұ\eLAn"*X@:e e-"0𰘑DR M@:e0Ԙ0lNM!L@:e|d@:eg Pe@:e @eD0𔘠1TlL@:e@=eej @2iedg 0L$g@:e0te0tiK rg0t@mKl0Ԙ0tg(KlN(LlM@:e 񄙞e$D@:e 0𴘞egDLM@:e e `jly"@j %PHno0M@:e e`w%PHno0M@:e eH3"0L`@:eb#se`0tK 0p0TK'J0t0Ԙ0ԬKlNӌMAL@:e Ҟej0TҀTB8a "g0𴘑DM@:e e "gL@:e@=e0Ԙ0lHNM\L@:e}djҐ0tK0tKlH2I〚 *D@:e eJҰ@r aglMOL@:e eD@:eg Pe@:e ejQ @2ie"\gQ@m@:eeg\gmL@:ee\gmQ@@:eeg\gmL@:eie\gPg@:eGٞeL"\gQ@=eeOe\gQ@=ejKGF@:ee"\gp@=ee\g@=ecY`en`"\g1@M@:eie (2I 2X@:eex"I qaqH ,n^M@:eie (2I 2X@:ee/"I qam$2)H2hBJ oIn0P@8eDg@:eҞerT0Ԙ N@m@:eqH n~M@:e e i 2X@:ee" I J q a0 MB@8ej qd nmVej @2i8deg $ggqHnM@:ew@Z7`Z`r>`HwJ  g@:ee>* j2X@:ee"J J"ra0-Mg@8eJZ`cjld*0Mcjl *0 Mg@8ej(jL#0MM0T0@:eHeXw@:eCe `Lwg@:eg *0{dgmJ@:eg*0gp M@?e@8e@?eJew Hg@8ed3h3Kベ %x"XjL\g"K0ӢM$Hg@:eQPe@:eJZeaH0 M@:e0TJecjl8"QP@:e QPe@:e IJZe`H@:eQPe@:eJZe`H0 M@:e0TJecjl8"QP@:e QPe@:e IJZe`H@:eQPe@:eJZe`H0M@:e0TJecjl:"QP@:e QPe@:e IJZe_`H@:eQPe@:eJZe_ `H0M@:e0TJecjl3"QP@:e QPe@:e IJZe`H@:eQPe@:eJZe `H0 M@:e0 Mg@8eiL g@:eeja @2ide\g#Hg-mJ:e@g#udej! @2i de_r aw a0M<@8e-h3HCm>_H<@:ej? @2i,deg҂gqHn9N^M@:e[e" !1@[@:e0ZgNM@8ej*[X@:ege*I Jqa0ZM@8e$3-h3P@Cm\PZ@:e }dej @2ideg ҂gqHlnM@:e)e" !1@)@:e0(gM@8ej*)X@:ege*I J qa0(NM@8e$3-h3HCm*\(@:etdj @2i deg҂gqHHnM@:ee" !1@@:e0gnM@8ej*X@:ege*I Jqa0M@8e$3-h3GCYJm @@:edej @2i.deggW բgLg:e@n"g"1D 0ԘO  l\ON @8eTaA`ځ@Qg zdej @2ideg g01H0ԘON:e@$g*0\ ҂g1L @:e "aA`ځ@jxdp @8eej @2ideg g01H0ԘON:e@$ge-* 0 Ңg2XlL@:e0|e "2X0 cL@:e"P0Ԙ Nl@:e "aA`ځ@jydj P @8ejej~ @2ie dg04 01HIgO@:ee3*1T0ИN g@:ee(* 0 ҂g2XM@:ee2"2X0 M@:eie"0 M@8ejxdi 0 ҂g2XmM@:ee *n00g@8ei2X0 LM@:e*n0M@8eej^ @2ideg g01H0ԘON@:ee.*2X 0𴘑g M@:ege$"2X0𴘑gM@:ee"2X0𴘑gM@:em "0. M@8ejwdm00n@8ej @2ie dg0T0J 1H mO@:eeA* jPL H1 E@%"2X @:ee*1T0И N @:ee "]g0 Pn@8ekpJra0 NM@8ejyd @i J $2X @:ee *]g0 Pg@8e IJ q a0 nMj @2ie dg0T0J 1H mO@:eeI* i pT (2i@ "2X @:ee7"Iqa0 M& i  J $2X @:ee *0pg@8e IJ q a0 M@8ejyd1T0И N @:ee"0pn@8ekpj @2ideg g01H0ԘO N:e@$g * ^ a0Mg@8ejwd0pg@8eej @2i degj0T0J 1H mO @:eeq*  ҂gqH n^M@:eie (2I @ Ҁ2X@:eeT"Iqa0 M@8e3i J $2X @:ee*D K"0P9 @8e= IJ q a 0 M@8e0 0Ԙ O N@:e"j1T0И N@:ee"0P n@8ekpdej @2iedg0T0J 1H "O@:ee>* PX P2i⠚$%2Xg@:ee*1T0Ԙ "N @:ee "jK ]g0P Ȃ @8e Jr a0g.M @8ejpd2X 0𴘑geM@:e Ҟe"2X0𴘑gM@:eke "0g.MqH08nZMg@:ej `JrIa0 NMej} @2idegj 0T&gKJ 01H0Ԙ+ OLNg@:ee3*1T0Ԙ0𴘑g N M@:e 2X0𴘞eMg@:ege"2X0𴘑gM@:em "0gnM@8ejyd0P @8eej @2i degj 0T1( J0 KO@9ee<*1T0Ԙ N@:e02XeeM@:ee*j00 on@8eyd2X0 M@:e "0M@8ej00Ԙ R ON@9e *H mJ@:e"ge *0 M@8e1T0Ԙ  N@:e 00 Z g@8e,ڧj} @2i deg g qHn~M@:e 01H0ԘNtO@:ee[* i (2I 2X@:e Ҟe&"Iqa0 .M@8e=ra0M1jra0M(0g@8e&qa j iH0ИJ+Os N@:e MU aj*0M@8ej{dej] @2i de` Z`r3`r(`0p NM@?eg@8e  ra0u+aD@:e jJCg kp g@8e0 Pg@8e0 P gP\ 0@:e p@ ؁@:eej @2ideg 0Tg(J 01H0Ԙ# ON:e@$ge* 0 ҂g2X'M@:e "0 Mg@8ejyd @@r `0Mg@8ePL@:e0Pg@8eej @2ie dg0T0J  1H O@:e*H J@:e *0M@8eiQgydpL0@:e"g eJ0Ԙ1T N@:e* @:e*0M@?eg@8eKej @2i deg 0T0J0T0Ԙ(J1H,N# O@:e e0*2X0𴘑g'M@:e Ҟe("2X0𴘑gcM@:e e"2X0𴘑g'M@:ek "0g M@8eiQg|dj HJ@:e *0/ M@8e@@r`0O M@?ep @8e0iNM@:e"0Xo M@8ej |dP @:e$e$ @:e$Ҟe!L@:eB?eL@"g @:e DٞeZkB[`jFkl*0T0ԘJ0T0'J1TYNM@:e " [Z@8e)L@:e"g `jm @ @:eHٰT PDn o:e@ @P҂gQ@@:e`Hٞe *0MX@?e'1T0Ԙ0YNM@:ee %HXMJ@:ePٞe*0X M@?e1g@=e@8e:1T0И YN@:e Ҟe1*0҂g2XM@:ee"2X0M@:e " `P0Mj  n o@:e`Pٞe"Zr aT0YiM@:eA?e Ңg@L 5ejY @2i.deg 2@nm@:e0\ g qHen@:e qH en@:e qH eDn@:e0T1(Jj00J0T0ԘHJUJ0TT(JON@9e*Vra00Ԙ:UTiON@9e"j zd00ԘUTR ON@9e*Vr`1Xg@:e "0TgOM@8e0@9e @9e V re`r aj WV@8e"@r`0TM@?e1@8e1T0Ԙ0UJNM@:e*JKaBCXgJKp\ m@:e Ҟe1T0Ԙ0ULNM@:e e$@9e eX1TiX@:e Ce)aVr aT0UiM@:e g JT@:eg*0goMP@?e IeLg@:e ge"@"1@@:e0g/MT@?e@=ekej @2i>deg  2@ nm@:e0T1(J 0J0T0Ԙ(Ja`NO@9ee0*br0TmJ 0TJ'a1T a2@:ee+"1T0Ԙ0aFiNM@:e"0`M@8ej0pd HJ a`@9ee*br`  Ңg1Xg@:e "0`gOM@8e0&@9e2e&$@9e2ҞebZ\g0\`bjFkl "j cb@8eH@:e"g 0TJe Ңg0Ԙ1T aN@:e "0𴘯M`@?eHJ` @:e Xٞe"1T0Ԙ aN@:eec*X$@rXg S*X@:e 0PeJ0PJ0TJ0P2J0PJ0TJ0PRJ0T J0PJj  H2I㠚%2X@:ee" J r aj @@@@>"@j `m @1T0ИaN@:ee*0 ҂g2XM@:eeK*@PH0ИJa`s NO@:eReL`02 M@ `@:e \ٞe"jQXm@:e0`g M?e@  e@=e񰘑g@=e 1@8e2X0 lM@:e*j0 M`@?e ` m @0Ta(Jg 1T@:ee*H J `@:e@Hٞe*0/ M1T0Ԙ0aL N0AM@:ee* T kxy T0T0Ԙ J Ңg1Ta N A@:ee* djX D1T0Ԙ a`AlN@:e01Te0ԘaPA,NM@:e1Te0И aN@:e  *1T J`PA@:eJ*񰘑g@=e > AL@?ebre aT0aiM@:eX cb@:ejx @2i.deg 2@%gnm@:e 0T0(J 0ԘHJ0TRmJOJ0TO N(J1Hg@:e*1Xg@:e"0RgOM@8ej yd0@9e$9e@$H JR@:e"g*0R1oM@?e@8eTjKlraRgQDg@:e"1p @=eg@8eRCbgjmRC۵0UT@8eej @2ie.dd`lTalQk2a#ACrO`R@`r`00jIQPg@:ed3kJjq@ jAa@bW`d2b`D@jKWj6N .r `s `h60N9KPJkr`r`00 Ij000I00PI00IH20JiJ @lH2I㠚1TJ@:eib7aKӠ@j``+jzd%s aassab`aBH20JJ@q`H2I1TIJ@:eIIKj|eeeej @2id9k=ggeeg@qqHAn MqL@:eqH`AP@xـkew "D0𐘠1TUL@:eegAqKjA_ILBCDۺjk@@^ٺj@Igl$AlIM䀜skl"pj@\gAqHAngqM@:e@@ATQjOjKSJR,rAeDP@"|gәD0𰛀@uM@:eeTs`P@ "\gq욑@?eedOiqD2ItCaCgqkLG2JUOra"e@qP[JAgD2ROajOojJX\gTL@:eNٞe*"e@qP[JAgg\glqHC@:eohd2JpJ(ep2knP2Mmup2kP3\ggqHg@:eop2kP2JpJ(egp2kmP2Mjuh2iH3qHgu@:eq@@Ane"󤘃g@=eelNiTـHMHUjJIUP@"|gϙD0𰛀@uM@:eedOinD2ItCa"e@qP JAgJEMFNQSra"e@qPJAg\gQXCScD2I@LـJ "RJ#*P@"|gD0𐛠1TL@:eegAIKjiA\gqMqTPA@:eRٞeRR`P@"|gD0𐛠1T L@:eejMRMliZ`gD2Q|M`+qd0Ki@RNA`KL|g0PnlJI@SٓjP5WqH5`A@:eSsH2iuH2KMSe"@mYfzmg{mh|ud}\gAqHn]MA@:eP@e*LJZ `H3 m`i?a -Oq=_ +Mo;] ) K m !9![!}!!!!/"_"""y$=%%& '!'9'S'(5(M(e(}(((((()))C)])w))))G*y*+5+i++E,,K---.U....-/c///0;0q000 1y11322334}4445U5555-6c66667778M8889S999:I:}:::;G;y;;;<C<<<=s===>C>w>>>?3?e????/@a@@@@-AaAAAA+B]BBBB%CWCCCC'DYDDDDECEwEEEFAFsFFF G=GoGGGH7HiHHHIaIIJoJKK5KQKmKKKKKKL1LQLmLLLMM N5NNNgOOWPPSQQ[RRcSSkTTsUAV[VVWWWWWXY'Y?YsYYkZZ[/[G[a[{[[[\?\\\\?]g]]]]]]^7^S^o^^^^^^_5____``aQa{aaa1bMbgbbbbbccd%d[dddd5eeee fffff-gGgagggghEh_hhhhi1iKiiiijj7jyjjjjkAkm[mmmnnOopp3pppqq;qqr3rKrcrrs;sWssssssssMttt=uuuvcvvvCwww#xsxxyEyyy3zqzzz{/{K{{{|5|[||||#}U}}}~/~O~~+Y+S5ÁAi!Aa%Ea}݅=φ)Ea}݇Ks-IeϋیCӍ =sَ #MwݏGݐ9Uqّ#?[wג7OgǓAqєUɕ'Geٖ5MyǗߗ?WoØ!M˙1aך!OwכIɜA]ߟ?1Iay١ !9Qi5Qmݣ1YѤUEɦ)Ys]u3Ѫ Gaӫ-Wì{Ieծ )'Cs Gcӱ_ղ Qճ #=͵C] e׷ %Q}øݸM} qϺ9k3Kc{ۼ ;ksվ)}ѿ%y!uqmA}+eM1Mi'U 7a7So3Ok/KgKs'C_{1M )EaO 'Cq7g7So3Ok/Kg+GMey-Ie!=Yu{9Uq5Qm)Ea}9Uq-Ie!=Yu1Mi %Uq-IyGA]y %Uu-Ie )Ea )Ge+GcEa}?[w;Ws7So3Ok/K{-Y 5aUq%A]y9i1Mi %UqMiRrsa\gAqHnqMA@:ejeJR\gQ\MScD2I@`B#JZ`mD2M`s a|gqd0Ki@RNٮ`QtjN`\gqHnA@:eSegA0pINHKD2mi|g0𐜠qXgVL@:eTJTUHJUTeH@SP@"\gq욑@?eeR`Z<`\gqdRKD2i@MP@"|gD0Л0@NgN@M@:ee|gq@?ee|g lT@:ee"e@1T[JAgjK"JKP@&"|gD0Л0@NgS@M@:ee|gq@?ee|g lT@:ee\gHqHqHnPAg@:eue\gKqHAnuqMg@:ejKeR"e@qP;JAg\g0pS KD2i@L~*RJ.*RLKn*@ATA@LULAGAqJBGAYJN٢g\g@J@:eMٞe.*N@N"e@qP JAgmMa@zmYb{md}|"e@1TJAggD0p0@KJLD2i|gLMB@@:eSeKD2|gGjN0PBSnB>`NJgN\g@M@:eND2┙egI0p@HKD2iq@?eeg lT@:ee@N"B\gqHnL@:egAIKji⎙@Mea@a܀P@bg\g0P JN*#|gD0Л0@6 NgU@M@:eLe|gD2Iq@?ee|g lT@:eeSsP2kP2CTd3kT\gHqHqHn`Ag@:eme\gKqHAgun]M@:eld2neIg`0PKd3KJI「@Z`QD2U堍,|gqd0Ki@N"e@qP;JAggAIKjim@\g@?eehgAIKjim@\g@?eeWgAIKjim@\g@?eeFgAIKjim@\g@?ee5gAIKjim@\g@?ee$gAIKjim@\g@?eegAIKji m@\g@?eegAIKjim@\g@?eegAIKjim@\g@?eegAIKji m@\g@?eegAIKji1m@\g@?eegAIKji!m@\g@?eegAIKjim@\g@?eegAIKjim@\g@?eegAIKji"m@\g@?eezgAIKji#m@\g@?eeigAIKji2m@\g@?eeXgAIKjim@\g@?eeGgAIKji$m@\g@?ee6gAIKji%m@\g@?ee%gAIKji m@\g@?eegAIKji m@\g@?eegAIKjim@\g@?eegAIKjim@\g@?eegAIKjim@\g@?eegAIKjim@\g@?eegAIKji&m@\g@?eegAIKjim@\g@?eegAIKji m@\g@?eegAIKji m@\g@?ee{gAIKji'm@\g@?eejgAIKjim@\g@?eeYgAIKji4m@\g@?eeHgAIKji(m@\g@?ee7gAIKji)m@\g@?ee&gAIKjim@\g@?eegAIKjim@\g@?eegAIKji*m@\g@?eegAIKji5m@\g@?eegAIKjim@\g@?eegAIKji+m@\g@?eegAIKjim@\g@?eegAIKji,m@\g@?eegAIKjim@\g@?eegAIKji-m@\g@?ee|gAIKjim@\g@?eekgAIKji7m@\g@?eeZgAIKjim@\g@?eeIgAIKji.m@\g@?ee8gAIKji/m@\g@?ee"e@1T>JAggAIKji0m@\g@?ee"e@1T>JAggAIKji3m@\g@?ee"e@1T>JAggAIKji6m@\g@?ee"e@1T>JAggAIKjim@\g@?ee"e@1T>JAggAIKjim@\g@?ee"e@1T>JAgPgAUIKji╙@n@G\g0𰚱\M@:ee"\g0𰚱\nM@:ee"U@/ragAIKjiⵙ\gAH]N@:eaBe+\g@=eeSsP2kP2Cd2tKTP@ "\gq욑@?eeT@SMU"e@1TJAggAIKjiՙ@A]OAbgNH2IgAIKji‚J@:eRe#aNJNgAIKji@BbgNca\ggA0IKjiՙJA]O M@:eRe`*\g@=ee"e@1T>JAgjN\gLJ"r`\g0КPANl]M@:egceA`ځ@bgAIKjiA@ILkIJ`H2IAJ?PN٢g\gP@:ee'"\g0КP5NMl@:eAILk`ecAہ`@\gp@=e?e\gИ@?e?e\g@=ee"e@1T>JAggAIKjiA@ILkIJ`H2IИ\g?@?e?e\g@=ee"e@1T>JAggAIKjiA@kILIJ`H2IAJPCJAU@N\g@GJuJn*\g@=ee"e@1T>JAgU\g2X@:eeT*G@:eUDe!*gD0𔘠L1T@:e000𐘞ePg(O` nM Lq@8egC `gD0𔘠 LuJD*\g@=eue\gp@=ee\g@=eeNU@NنgAIKjiAIL@kD`JDۺk`hn-"jK"e@1T>JAg`@Ak`"e@1T>JAg`@Ak`"e@1T>JAgp`@A`"e@1T>JAgPO"B\gqHnLM@:egAIKji⏙@Mea@a܀jURJ!"R`Z`\gqdRKD2i⠊A\gINk0qXPAv L@:eeSsP2kP2KRd2tCP@ "\gq우g@?ee\g0PT"e@qP JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAgp`@A`"e@1T>JAgp`@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAgp`@A`"e@1T>JAgp`@A`"e@1T>JAgp`@A`"e@1T>JAg``@A`"e@1T>JAgp`@A`"e@1T>JAgj\gAXg]O ml@:e``Ae@"e@1T>JAgO@@gU?PB\gL@?eGAeIJkM\g@=epe\gXՙA]O ml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgPB\gnqHM@:eO@@egU\g?pC?e@LGAeIJkM\g@=epe\gXՙA]Oml@:e``Ae@"e@1T>JAg@A\g@X]Oml@:e``Ae@"e@1T>JAg@A\g@X]Oml@:e``Ae@"e@1T>JAgPB\gnqHM@:eO@@egU\g?pC?e@Lpe\gXՙA]Oml@:e``Ae@"e@1T>JAgPB\gnqHM@:eO@@egU\g?pC?e@Lpe\gXՙA]Oml@:e``Ae@"e@1T>JAg@gAUgIKji@@l\gQD@:ee"\g@1@=ee\gp@=e`@Ake`"e@1T>JAgUA\g@X]Oml@:e``Ae@"e@1T>JAgPB\gnqHM@:eO@@egU\g?pC?e@Lpe\gXՙA]Oml@:e``Ae@"e@1T>JAgGA]JgN\gX@:eUuej @\gC@?e@)Lue\gX@ml@:e``Ae@"e@1T>JAg?@A\g?@X]Oml@:e``Ae@"e@1T>JAg_@A\g_@X]Oml@:e``Ae@"e@1T>JAg?@A\g?@X]Oml@:e``Ae@"e@1T>JAg_@A\g_@X]Oml@:e``Ae@"e@1T>JAg_@A\g_@QL]Oml@:e``Ae@"e@1T>JAg_@A\g_@QL]Oml@:e``Ae@"e@1T>JAg_@A\g_@QL]O ml@:e``Ae@"e@1T>JAg?@A\g?@X]Oml@:e``Ae@"e@1T>JAg_@A\g_@X]Oml@:e``Ae@"e@1T>JAg?@A\g?@X]Oml@:e``Ae@"e@1T>JAg_@A\g_@X]Oml@:e``Ae@"e@1T>JAg?@A\g?@X]O"ml@:e``Ae@"e@1T>JAg_@A\g_@X]O"ml@:e``Ae@"e@1T>JAg_@A\g_@X]O$ml@:e``Ae@"e@1T>JAg@A\g@X]Oml@:e``Ae@"e@1T>JAgj\gAXg]O ml@:e``Ae@"e@1T>JAgO@@gU?PB\gL@?eGAeIJkM\g@=epe\gXՙA]O ml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgPB\gnqHM@:eO@@egU\g?pC?e@LGAeIJkM\g@=epe\gXՙA]Oml@:e``Ae@"e@1T>JAgPB\gnqHM@:eO@@egU\g?pC?e@Lpe\gXՙA]Oml@:e``Ae@"e@1T>JAgPB\gnqHM@:eO@@egU\g?pC?e@Lpe\gXՙA]Oml@:e``Ae@"e@1T>JAg@gAUgIKji@@l\gQD@:ee"\g@1@=ee\gp@=e`@Ake`"e@1T>JAgUA\g@X]Oml@:e``Ae@"e@1T>JAgPB\gnqHM@:eO@@egU\g?pC?e@Lpe\gXՙA]Oml@:e``Ae@"e@1T>JAgGA]JgN\gX@:eUuej @\gC@?e@)Lue\gX@ml@:e``Ae@"e@1T>JAg?@A\g?@X]Oml@:e``Ae@"e@1T>JAg?@A\g?@X]Oml@:e``Ae@"e@1T>JAg_@A\g_@QL]Oml@:e``Ae@"e@1T>JAg_@A\g_@QL]Oml@:e``Ae@"e@1T>JAg_@A\g_@QL]O ml@:e``Ae@"e@1T>JAg?@A\g?@X]Oml@:e``Ae@"e@1T>JAg?@A\g?@X]Oml@:e``Ae@"e@1T>JAg?@A\g?@X]O"ml@:e``Ae@"e@1T>JAg_@A\g_@X]O$ml@:e``Ae@"e@1T>JAg@A\g@X]Oml@:e``Ae@"e@1T>JAgj\gAXg]O ml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgPB\gnqHM@:eO@@egU\g?pC?e@LGAeIJkM\g@=epe\gXՙA]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAg@A\g@X]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgPB\gnqHM@:eO@@egU\g?pC?e@Lpe\gXՙA]Oml@:e``Ae@"e@1T>JAgj\gAX@]Oml@:e``Ae@"e@1T>JAgj\gAX@]Oml@:e``Ae@"e@1T>JAgP?\gAQL/@]Ol@:e``A@?Per> a?T>*P``B```d"e@1T>JAgj\gAX@]Oml@:e``Ae@"e@1T>JAgj\gAX@]Oml@:e``Ae@"e@1T>JAgj\gAX@]O"ml@:e``Ae@"e@1T>JAgj\gAX@]O$ml@:e``Ae@"e@1T>JAgj\gAXg]O ml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAg@A\g@X]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgPB\gnqHM@:eO@@egU\g?pC?e@Lpe\gXՙA]Oml@:e``Ae@"e@1T>JAgj\gAX@]Oml@:e``Ae@"e@1T>JAgj\gAX@]Oml@:e``Ae@"e@1T>JAgP?\gAQL/@]Ol@:e``A@?Per}a?T]*P``B```d"e@1T>JAgj\gAX@]Oml@:e``Ae@"e@1T>JAgj\gAX@]Oml@:e``Ae@"e@1T>JAgj\gAX@]O"ml@:e``Ae@"e@1T>JAgj\gAX@]O$ml@:e``Ae@"e@1T>JAg@A\g@X]Oml@:e``Ae@"e@1T>JAg\gnqHg`A@:ee"e@1T>JAgj\gAXg]O ml@:e``Ae@"e@1T>JAgj\gAXg]O ml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAX@]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAX@]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAX@]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAX@]Oml@:e``Ae@"e@1T>JAgj\gAXg]O#ml@:e``Ae@"e@1T>JAgj\gAX@]O"ml@:e``Ae@"e@1T>JAgj\gAXg]O ml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj?\gAQL@]Ol@:e``Ae@"e@1T>JAgj?\gAX@]Ol@:e``Ae@"e@1T>JAgj\gAXg]O&ml@:e``Ae@"e@1T>JAgj\gAXg]O%ml@:e``Ae@"e@1T>JAgj\gAX@]O$ml@:e``Ae@"e@1T>JAg``@A`"e@1T>JAg\gnqHg`A@:ee"e@1T>JAg@ "P\gqHn_@@:ee\gnqH@`A@:ee"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAX@]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAX@]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]O ml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAg@A\g@X]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]Oml@:e``Ae@"e@1T>JAgj\gAXg]O m l@:e``Ae@"e@1T>JAgj\gAXg]Om l@:e``Ae@"e@1T>JAgj\gAXg]Om l@:e``Ae@"e@1T>JAgj\gAXg]Om l@:e``Ae@"e@1T>JAgj\gAXg]Om l@:e``Ae@"e@1T>JAgj\gAXg]Om l@:e``Ae@"e@1T>JAgj\gAXg]O m l@:e``Ae@"e@1T>JAgj\gAX@]Om l@:e``A@`e t"e@1T>JAg@@AgU\gm2@n@:ee\g\@:eҞe\gՙXA]O m l@:e``Ae@"e@1T>JAg@@AgU\gm2@n@:ee\g\@:eҞe\gՙXA]O m l@:e``Ae@"e@1T>JAg@@AgU\gm2@n@:ee\g\@:eҞe\gՙXA]O m l@:e``Ae@"e@1T>JAg@@AgU\gm2@n@:ee\g\@:eҞe\gՙXA]O m l@:e``Ae@"e@1T>JAg@@AgJ\gm2@n@:e`e\ggpDc?`$lb@:eڃbgڂeNjF\gqHgnM@:ene\gXʙA]O m l@:e``Ae@"e@1T>JAg`@Ak`"e@1T>JAg``@A`"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Aڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg@@AgU\gn2@m@:eje\gՙXA]O ml@:e``A@`e `"e@1T>JAg\gH@:e``AAIL@ۺke`Bi[8akj`Al H\g]M0КPU N@:eAILk`ecA`gAIK@ܺjiA@kILD`JD"e@1T>JAgAIOnh4KŜںj@iڦ"e@1T>JAg?`@@"e@1T>JAgPAILk\g@A]M@:ee*P"e@1T>JAg@?`M?D`AA`"e@1T>JAg@gN\g1\@:el``Ae@ہ#*\g0КuNPl@:eeAILk`cA`ځ@܀"e@1T JAg\g@=ee"e@1T>JAgp`@A`"e@1T>JAg_@BN\gnqHM@:ene\gC_@?e@L_@e\g1@=eGAeIJkM\g@=eP_`PB@@|ڠہ`ܞe``A@"e@1T>JAg_@BN\gnqHM@:ene\gC_@?e@L_@e\g1@=eP_``B``dڠہ`ܞe``A@"e@1T>JAg_@BN\gnqHM@:ene\gC_@?e@L_@e\g1@=eP_``B``dڠہ`ܞe``A@"e@1T>JAg_@BN\gnqHM@:ene\gC_@?e@L_@e\g1@=eP_`pB``tڠہ`ܞe``A@"e@1T>JAg_PB\gnqHML@:e_Pke `o@@gU\g_pC?e@)Le\g1@=e@_p`B``lڠہ`ܞe``A@"e@1T>JAg_PB\gnqHML@:e_Pke `o@@gU\g_pC?e@)Le\g1@=e@_p`B``lڠہ`ܞe``A@"e@1T>JAg_PB\gnqHML@:e_Pke `o@@gU\g_pC?e@)Le\g1@=eP_p`B``lڠہ`ܞe``A@"e@1T>JAg_PB\gnqHML@:e_Pke `o@@gU\g_pC?e@)Le\g1@=eP_p`B``lڠہ`ܞe``A@"e@1T>JAg_PB\gnqHML@:e_P ke `o@@gU\g_pC?e@)Le\g1@=eP_p`B``lڠہ`ܞe``A@"e@1T>JAg_PB\gnqHML@:e_Pke `o@@gU\g_pC?e@)Le\g1@=e@_p`B``lڠہ`ܞe``A@"e@1T>JAg_PB\gnqHML@:e_Pke `o@@gU\g_pC?e@)Le\g1@=e@_p`B``lڠہ`ܞe``A@"e@1T>JAg_PB\gnqHML@:e_P ke `o@@gU\g_pC?e@)Le\g1@=e@_p`B``lڠہ`ܞe``A@"e@1T>JAg_PB\gnqHML@:e_Pke `o@@gU\g_pC?e@)Le\g1@=e@_p`B``lڠہ`ܞe``A@"e@1T>JAg\gL@:e``AAIL@ۺke`Bi[8akj`Al H\g]M0КPU N@:eAILk`ecA`gAIK@ܺjiA@kILD`JD"e@1T>JAgAIOnh4KŜںj@iڦ"e@1T>JAgp`@A`"e@1T>JAg?@pB񈚠hڠہ``@``A"e@1T>JAg`@Ap@uـQ% Ir`\gAn000LOML"e@1T JAgUB I)Lr`\gAn000LOML"e@1T JAg\g0MP@?ee\gp@=ee"e@1T>JAgup"e@1T>JAg?@AILk \g@M@:ee*?@ "e@1T>JAgp`@A`"e@1T>JAg?@pB񈚠hڠہ``@``A"e@1T>JAg@N \g\J@:eIe2*N J@:e᚞e|g0ЛP Nl@:egAIKlqecAہ`@܎|gp@=ee"e@1TJAgn`@A`"e@1T>JAg@@ANnjC@ABCDUnB\gMqH L@:ene\gCqHn!L@:e`@``Ae \guٱDn?A]L@:eue@"e@1T>JAg@ kh`@``A"e@1T>JAg``@A`"e@1T>JAgj\gAPDno]L@:e``Ae@"e@1T>JAg@N\g02X$L@:ee"\g0К N"e@1T JAg\gPnm@:ekkhڞe`@\g``A@=ee"e@1T>JAg@ \g\N@:eI`e#*N @:e᚞e|g0ЛPNl@:egAIKlqecAہ`@܀`@A`"e@1T>JAg``@A`"e@1T>JAg@@ANnjC@ABCDUnB\gMqH L@:ene\gCqHn!L@:e`@``Ae \guٱDn?A]L@:eue@"e@1T>JAg\g0H@:e``Ae@"e@1T>JAg``@A`"e@1T>JAgp`@A`"e@1T>JAgp`@A`"e@1T>JAg?@AILk \g@M@:ee"\gpQ?@``A@ "e@1T>JAg?Pp ``@``A"e@1T>JAg?P``A @"e@1T>JAg?Pp d`@``A"e@1T>JAgPU?@PBN\g@?ene`@A`\g@=ee"e@1T>JAg?PAILk@\g@M@:ee*?P``A@@"e@1T>JAgPk@}`@``A"e@1T>JAg?@AILk`\g@M@:ee*?@``A@`"e@1T>JAg@?`M?D`AA`"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg\g0H@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@Aڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@Almڡ"e@1T>JAgp`@A`"e@1T>JAg?P``A @"e@1T>JAg?Pp d`@``A"e@1T>JAgPAILk \g@M@:e_󐘞e"\gpLU@:e?U@:ee"e@1TJAgP?`? ڈ |ڭ k ``@``A"e@1T>JAg_PAILk \g@M@:e?e "\gpLU@:e_P  ` uauam@@m `\gp@=ee_p`@A`"e@1T>JAg l `@AILk \g@M@:e_􀘞e*@?` @`@k ``@``A"e@1T>JAg_P?p xp @`@k ``@``A"e@1T>JAg?P ` ``@``A"e@1T>JAgPU?@PBN\g@?ene`@A`\g@=ee"e@1T>JAg?P`@h`@``A"e@1T>JAg?@AILk`\g@M@:ee*?@``A@`"e@1T>JAg?Pp@p"e@1T>JAg?@``h"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\g0QH@:e``Ae@"e@1T>JAgp`@A`"e@1T>JAg`@An@NUJgJN B\gqH@:e?`e\guQ@g@:ene \%*\g0КPVNl@:eAILk`ecAہ`@\g?@=e?e\g@=ee\gnqH@@L@:ee"e@1T>JAg`@Ap@``"e@1T>JAgeee```@Aj`񈛍`H"e@1T>JAg```@Aj`񈛍`H"e@1T>JAgPAUهB\gnqH]ML@:eu`@Ae`"e@1T>JAg@AUهB\gnqH]ML@:eu`@Ae`"e@1T>JAg\gA0T]L@:ege`@A\g@?ee"e@1T>JAg?@Uقg\g@?eu`@Ae`"e@1T>JAggAIKji@A]L\gH@:ee"``A@"e@1T>JAg@|gL@?e``@Ae`"e@1T>JAg@Nقg\g\@:ege*\g0КvN"e@1T JAgĢj\gPD@:e`@ٞe\g``A@=ee"e@1T>JAgj\gpPDn o@:e``Ae@"e@1T>JAg@@ANnjC@ABCDUnB\gMqH L@:ene\gCqHn!L@:e`@``Ae \guٱDn?A]L@:eue@"e@1T>JAg\g0񜚰X@:e``Ae@"e@1T>JAgp`@A`"e@1T>JAgp`@A`"e@1T>JAgPAILk \g@@:ee*P "e@1T>JAgp`@A`"e@1T>JAgp`@A`"e@1T>JAgPAILk \g@@:ee*P "e@1T>JAgp`@A`"e@1T>JAgp`@A`"e@1T>JAgPAILk \g@@:ee*P "e@1T>JAgP``A@``B```dk `"e@1T>JAgp`@A`"e@1T>JAgPAILk \g@@:ee[*P "e@1T>JAgp`@A`"e@1T>JAgp`@A`"e@1T>JAgPAILk \g@@:ee;*P "e@1T>JAgp`@A`"e@1T>JAgp`@A`"e@1T>JAgPAILk \g@@:ee*P "e@1T>JAgp`@A`"e@1T>JAgp`@A`"e@1T>JAgPAILk \g@@:ee *P "e@1T>JAgp`@A`"e@1T>JAgp`@A`"e@1T>JAgPAILk \g@@:ee{*P "e@1T>JAg``@A`"e@1T>JAg\g0𔚐PL@:e``Ae@"e@1T>JAg\g0𔚐PL@:e``Ae@"e@1T>JAg\g0𔚐PL@:e``Ae@"e@1T>JAg\g0𔚐PCL@:e``Ae@"e@1T>JAg_@G\gXJNN@J=*\g0КPvNMl@:eAILk`ecAہ`@\g_@=ee\g?@=ee\gpLU@:e"e@1T JAg\g2X@:enKenٲ*PnNUBNMpB\gqH@:ee\gP@:eneH\g@=epe\gAqH Cnn]M@:eue\gKgjqHnnPC@:e?`e\guQ@g@:ene`H*\g0КPVNl@:eAILk`ecA`ځ@n\g@=epe\gqHun0Cg@:eU @ebgjmu @"e@1T>JAg`@AgU\gnqHg@:ee\gAqHn]M@:ee"e@1T>JAg\g0QLLL@:e``Ae@"e@1T>JAg@@AUujA@ABCD\g oPDn]L:e@uenE\ggqH`A@:ee"e@1T>JAg@Aj@ABCD@nE\g`AqH@:ee"e@1T>JAg@@AUuj@ABCD@gN\gQP@:eL7e\gnPPDAn]L@:eNٞe\g@=eue\gqHng`A@:ee"e@1T>JAgLAUuj?@ABCD\g@`A0К@na\grTmMN@:ee\gQP@:eL7e\gnPPDAn]L@:eNٞe\g?@=eue\gqHng`A@:ee"e@1T>JAgLAUuj?@ABCD\g@`A0К@na\grTmMN@:ee\gQP@:eL7e\gnPPDAn]L@:eNٞe\g?@=eue\gqHng`A@:ee"e@1T>JAg``@A`"e@1T>JAg@``AK@"e@1T>JAgGA]JgANIKji@\gH@:eUٞe{"\g0T@:ege`@A\g@?ee"e@1T>JAg@|gL@?eAe|g]L0T@:ege|g``@A@?ee"e@1T>JAg``@A`"e@1T>JAg`@Ak`"e@1T>JAg?`j 񀛍 @"e@1T>JAg?PU`P$"\gA0КPNl]M@:eAILk`ecAہ`@"e@1TJAgUA`\gnqH]ML@:eU @ebgjmu @"e@1T>JAg@|gL@?e``@Ae`"e@1T>JAg\gAPDn o]L@:e``Ae@"e@1T>JAg`@Ak`"e@1T>JAg`@Ak`"e@1T>JAg\g0𐚐PL@:e``Ae@"e@1T>JAg@@AgN\gpD@:eUٞe\g@=eUe"gAIKji╙@Ca@a܀"e@1TJAgn`@Aڡ"e@1T>JAg`@AU\g@no@:ee@a"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@ANهB\gn2@mL@:ene\gqHnC@:eN`ef"e@1T>JAg`@ABN\gn2@m@:en?@ۃgeX\gaqH|ܵLnyL@:ee"e@1T>JAg`@AgN\gnqH@@:ene\gqH۵CnL@:ee"e@1T>JAg`@AgN\gnqH/@@:ene\gCqHnyL@:e@aeX܀|"e@1T>JAg`@AgN\gn2@m@:ene\gqH۵CnL@:ee"e@1T>JAg`@AgN\gnqH@@:ene\gqH۵Cn-L@:ee"e@1T>JAg`@AgN\gnqH/@@:ene\gCqHnyL@:e@aeX܀|"e@1T>JAg`@AgN\gn2@m@:ene\gqH۵Cn-L@:ee"e@1T>JAg`@AgN\gnqH@@:ene\gqH۵Cn]L@:ee"e@1T>JAg`@AgN\gnqH/@@:ene\gCqHnyL@:e@aeX܀|"e@1T>JAg`@AgN\gn2@m@:ene\gqH۵Cn]L@:ee"e@1T>JAg`@AgN\gnqH@@:ene\gqH۵CnEL@:ee"e@1T>JAg`@AgN\gnqH/@@:ene\gCqHnyL@:e@aeX܀|"e@1T>JAg`@AgN\gn2@m@:ene\gqH۵CnEL@:ee"e@1T>JAg`@AgN\gn2@m@:ene\gCqHnyL@:e@aeX܀|"e@1T>JAg`@AgU\gn2@m@:eue\gAqHCn]M@:e@aeXܠ|"e@1T>JAg`@AgU\gn2@m@:eue\gAqHCn]M@:e@aBCXg╙ex\"e@1T>JAg\gnqHg`A@:ee"e@1T>JAg@@gU\gg@?ee\gnqH`A@:ee"e@1T>JAg\g@qHnyM@@:eXXjeX@@gU\g||k?e|@ge\gnqH`A@:ee"e@1T>JAg@@gU\gg@?ee\gnqH`A@:ee"e@1T>JAg@@gU\gg@?ee\gnqH`A@:ee"e@1T>JAg@Nقg\gQP@:eZea\go0К N"e@1T JAgn`@A`"e@1T>JAg\gn2@m`A@:ee"e@1T>JAg`@AUلB\gn2@m@:eU`e`"e@1T>JAg`@Ak@x"e@1T>JAg`@A`@x"e@1T>JAg\gAp\m]L@:e``A@`eu`jaB\g@?ee\g@=ee"e@1T>JAgL\glD@:e``A@`ea@A`"e@1T>JAgp`@A`ځ@A`ځ@"e@1T>JAg\glD@:e``A@`ea@A`"e@1T>JAgp`@A`ځ@A`ځ@"e@1T>JAg\gAD]L@:e``A@kjpek"e@1T>JAg\gAD]L@:e``A@kjpek"e@1T>JAg\gAD]L@:e``A@kjpek"e@1T>JAg\gAD]L@:e``A@ kjpek"e@1T>JAg\gAD]L@:e``A@kjpek"e@1T>JAg\gAD]L@:e``A@kjpek"e@1T>JAg\gAD]L@:e``A@ kjpek"e@1T>JAg`@Ak`\g@=ee\g@=eAe\g]M0ԚNPl@:ee"e@qP6JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAgUnB?PMB\gqH@:eGAeIJkM\g@=epen\guqHCnnCM@:ee\g_PLA]L@:e``Ae@"e@1T>JAg\gXA]L@:e``Ae@"e@1T>JAg\gXA]L@:e``Ae@"e@1T>JAg\gT?A]L@:e``Ae@"e@1T>JAgPAUهB\gnqH]ML@:eu`@Ae`"e@1T>JAg\gAPm]L@:ege`@A\gp@?ee"e@1T>JAg?@Uقg\gp@?eu`@Ae`"e@1T>JAg\gLИ?L@:e``Ae@"e@1T>JAg\gAp@]L@:e``Ae@"e@1T>JAgp @r`\g!n000LOML"e@1T JAg@J"e@1T>JAg?@ `s`\g! n000LOM6L"e@1T JAg`jkk"e@1T>JAg\gA@]L@:e``Ae@"e@1T>JAgp`@A`"e@1T>JAg?` @r`\gAn000LOMVL"e@1T JAg۫"e@1T>JAg?` @r `\gA n000LOۭ"e@1T>JAg\gApD]L@:e``Ae@"e@1T>JAg?@ `s`\gAn000LOMvL"e@1T JAgkګl"e@1T>JAg\gApH]L@:e``Ae@"e@1T>JAgp`@A`"e@1T>JAg@@AgANIKjiA@ILkIJ`H2I\gL@:eUٞe\gU*AINkN`@cA`@"e@1TJAg@=e?@ujkeo"e@1T>JAg?@`xko"e@1T>JAg?@`kko"e@1T>JAg?@`yko"e@1T>JAg?@`mko"e@1T>JAg?`NN"e@1T>JAg@N\g02XL@:ee~"\g02XL@:ee"\g02XL@:ee|"\g02XL@:eeq"\g02X L@:eef"\g02XL@:ee["\g02X,L@:eeP"\g02XL@:eeE"\g02XL@:ee:"\g0КNPl@:ee"e@1TJAgj`@\gk`Aa܎@=ee"e@1T>JAgjjjjjjjj`@Aڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A/lmڡ"e@1T>JAg@?`M?D`AA`"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gApL]L@:e``Ae@"e@1T>JAg?P `s`\gn000LOML"e@1T JAga+\g0КN"e@1T JAgИxgؘn?`ڏp"e@1T>JAg?P `s `\gn000LO`ګokn?`ڭp"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\g0𔚐PfL@:e``Ae@"e@1T>JAg``@A`"e@1T>JAg`@Almڡ"e@1T>JAg@@AgN\gPA]L@:eUٞe\g@=eUe^*N``ATA"e@1T>JAg\gApP]L@:e``Ae@"e@1T>JAg_@ @r`\g!n000LOML"e@1T JAg@@AgN\gPA]L@:eUٞe\g@=eUe *N_`?D?K?PۭN"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Aڡ"e@1T>JAg`@A??ڡڀڣ"e@1T>JAg`@Almڡ"e@1T>JAg`@Aڡ"e@1T>JAg@/mUقg\gL@:eNٞe<*\gA0К]M6NPl@:eUٞe\g@=eUe> *@T@`Apx`AiAHcB"e@1T>JAgNuw\gg2H@:eJٞe *\gm0]L@?eGA]JgG\gP@A@:eUٞe\g@=eUe*NJN\g02XM@:ee;"\g02XM@:ee3"\g02XCM@:ee("\g02XC M@:ee"\g02XM@:ee"\g0КvNOjkHiRJAg`@Aڡ"e@1T>JAg@@AgN\gPA]L@:eUٞe\g@=eUe>*N``ATA"e@1T>JAg`@Almڡ"e@1T>JAg`@AJAg`@Almڡ"e@1T>JAg`@ALLڡ"e@1T>JAg`@ALLڡ"e@1T>JAg\gApT]L@:e``Ae@"e@1T>JAggAIKjiA@ILkIJ`H2I\gALm]L@:e`@ٞe\g``A@=ee"e@1T>JAg``@A`"e@1T>JAg@kkv"e@1T>JAg@?klk lŠ\g@?ee"e@1T>JAg?Pklk lŠ\g@?ee"e@1T>JAg@? klk lŠ\g@?ee"e@1T>JAg?P klk lŠ\g@?ee"e@1T>JAg_Pk lŠ\g@?ee"e@1T>JAg?Pk lŠ\g@?ee"e@1T>JAg_Pk l"e@1T>JAg\gApDm]L@:e``Ae@"e@1T>JAg\gApDm]L@:e``Ae@"e@1T>JAg\gApH]L@:e``A@k p`ej"e@1T>JAg\gApH]L@:e``A@?`e p`j"e@1T>JAg\gApH]L@:e``A@k p`ek"e@1T>JAg\gApH]L@:e``A@k p?`ej`k"e@1T>JAg\gApH]L@:e``A@_`e p?`j`k"e@1T>JAg\gApH]L@:e``A@?pe p`k"e@1T>JAg\gApX]L@:e``Ae@"e@1T>JAgp`@A`"e@1T>JAg?@`tkk"e@1T>JAg?@` jkk"e@1T>JAgpjK"e@1T>JAgpjK"e@1T>JAg`_@ P?@ RÀPl T"e@1T>JAg`@ P?P RÀPl T"e@1T>JAg\gAX]L@:e``A@ ke `"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAgp`@A`"e@1T>JAg\g?XAm]L@:e``Ae@"e@1T>JAg\g?XAm]L@:e``Ae@"e@1T>JAg\g?XAm]L@:e``Ae@"e@1T>JAg\g?XAm]L@:e``Ae@"e@1T>JAg\g?XAm]L@:e``Ae@"e@1T>JAg@@ANnjC@ABCDUnB\gMqH L@:ene\gCqHn!L@:e`@``Ae \guٱDn?A]L@:eue@"e@1T>JAg\gT?A]L@:e``Ae@"e@1T>JAg``@A`"e@1T>JAg\gD?A]L@:e``Ae@"e@1T>JAg\gH?A]L@:e``Ae@"e@1T>JAgP`k"e@1T>JAg?@`k"e@1T>JAg?P?` x`k"e@1T>JAg?P?`k`l"e@1T>JAg_@?`k`l"e@1T>JAg_P_` x?`k`l"e@1T>JAg?@`l"e@1T>JAg?P`l"e@1T>JAg?@`m"e@1T>JAg@_p x`kko"e@1T>JAg_@?p x`k"e@1T>JAg?P`k"e@1T>JAg_@?p x`kko@km"e@1T>JAg?P`kko@km"e@1T>JAg\gApDm]L@:e``Ae@"e@1T>JAg?P`l"e@1T>JAg_@pl`m"e@1T>JAgP`m"e@1T>JAg\gApDm]L@:e``Ae@"e@1T>JAg?@`l"e@1T>JAg?P`l"e@1T>JAgP`m"e@1T>JAg?Ppl`m"e@1T>JAg_@pl`m"e@1T>JAg\gApL]L@:e``A@`ej"e@1T>JAg\gApL]L@:e``A@?`ej`k"e@1T>JAg\gApP]L@:e``A@`el"e@1T>JAg\gApP]L@:e``A@_`e h?`k`l"e@1T>JAg@?`M?D`AA`"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gpTAn]L@:e``Ae@"e@1T>JAg\g?ШpTA]L@:e``Ae@"e@1T>JAg\g?ШpTA]L@:e``Ae@"e@1T>JAg\gApTnm]L@:e``Ae@"e@1T>JAgp`@A`"e@1T>JAg?@A\gnqH]ML@:ee"e@1T>JAgp@V"e@1T>JAg\gH?A]L@:e``Ae@"e@1T>JAg@?`M?D`AA`"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gp@@:e``Ae@"e@1T>JAg\gA@]L@:e``A@?`enpk`j"e@1T>JAg\gA@]L@:e``A@_`enpk?pj"e@1T>JAg\gA@]L@:e``A@_pen?`Bk_`)Mj\gpg?e@ue\g@=ee"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gAp\]L@:e``A@`eo?pkpl_pj"e@1T>JAg\gAp\]L@:e``A@peo_`Bkp-Ml`j\g?pg?e@ue\g@=ee"e@1T>JAgGA]JgU\gpX@:e``A@_`emkn?`Bkpl\gnqHL@:ee"e@1T>JAgGA]JgU\gpX@:e``A@`em_`Bn?`kpnl\gLqH@:ee"e@1T>JAg\g0TA]L@:e``Ae@"e@1T>JAggAIKjiA@ILkIJ`H2IAG@J٢g\gP@:eNٞeX"D!*gD0𔘠L1T@:e0e00Pg(O`n"e@1TJAg*C `gD0𔘠 LnJADj\go00Tm]L@:enlڞe`@\g``A@=ee"e@1T>JAg\gT@:eege"B|g0ЛNlXg@:ee"e@1TJAg\g0КlNXg"e@1TJAggAIKjiA@ILkIJ`H2I\gALm]L@:e`@ٞe\g``A@=ee"e@1T>JAggAIKjiA@ILkIJ`H2I\gALm]L@:e`@ٞe\g``A@=ee"e@1T>JAg@@AgUa@0ԟrTN@m@:eGAIJkMA`ILieDCkH2`IA\gmL]L@:e``Ae@"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAgp`@A`"e@1T>JAgИ?va jMnj*\g0ԚNM"e@1T JAgra\g0ԚNjra\g0ԚN\gAT]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg@?`M?D`AA`"e@1T>JAg\g?0\An]L@:e``Ae@"e@1T>JAg\g?0\An]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg@N\g02XM@:ee"\g02X M@:ee$"\g0КN"e@1TJAgj`@\gk`Aa܎@=ee"e@1T>JAgj\g?XAm]L@:e``Ae@"e@1T>JAg\g?XAm]L@:e``Ae@"e@1T>JAg\g?XAm]L@:e``Ae@"e@1T>JAg\g?XAm]L@:e``Ae@"e@1T>JAg\g?XAm]L@:e``Ae@"e@1T>JAg@@ANnjC@ABCDUnB\gMqH L@:ene\gCqHn!L@:e`@``Ae \guٱDn?A]L@:eue@"e@1T>JAg\gD?A]L@:e``Ae@"e@1T>JAg? Ir.aO,* Ir(aO&*\g1P͝A]L@:e`@ٞe\g?pL``A:e@UU@:ee"e@1T>JAg\gAH]L@:e``Ae@"e@1T>JAg\gT?A]L@:e``Ae@"e@1T>JAgPAUهB\gnqH]ML@:eu`@Ae`"e@1T>JAg\gAPm]L@:ege`@A\gp@?ee"e@1T>JAg?@Uقg\gp@?eu`@Ae`"e@1T>JAgp`@A`"e@1T>JAgp`@A`"e@1T>JAg\gLИ?L@:e``Ae@"e@1T>JAg`@AU@AB\gnqH]ML@:eUpe`"e@1T>JAg\gp@@:e``Ae@"e@1T>JAg?`@A@LMgU\g@?ee\g@=ee"e@1T>JAg``@A`"e@1T>JAg\gT@:e``Ae@"e@1T>JAg\gp@L@:eBe`@\g``A`?egu@EMe\g@=ee"e@1T>JAg\gp@@:e``Ae@"e@1T>JAgp`@A`"e@1T>JAg@N\g02XEL@:ee*\g@=e`@Almeڡ"e@1T>JAg@@AgJ\gpD@:eUٞe\g@=eUe*j`@Aڡ"e@1T>JAg?@گ"e@1T>JAg?@ڱ"e@1T>JAgPAILk㒚\g@@:ee*P"e@1T>JAgp`@A`"e@1T>JAg\glD@:e``A@`ea@A`"e@1T>JAgp`@A`ځ@A`ځ@"e@1T>JAg?@گ"e@1T>JAg?@ڱ"e@1T>JAgPAILk㒚\g@@:ee*P"e@1T>JAg\gAPm]L@:e``Ae@"e@1T>JAg`@@Ak`\gAPDn o]L@:e``Ae@"e@1T>JAg_@?? ڀ "e@1T>JAg\gAX]L@:e``A@ke `"e@1T>JAg@@AgN\gPA]L@:eUٞe\g@=eUe *N_`?D? T?P @@"e@1T>JAg\gAX]L@:e``A@ke `"e@1T>JAg\gp0ԚrTmN0CM@:eJeZ\gak0КKgPNl"e@1TJAg@=ee"e@1T>JAg\gAX]L@:e``A@ke `"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A!lmڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg@Nn@B0C%"\g0КPgVNlM@:eAILk`ecAہ`@_"e@1T JAg\g_0ԚrTNm@:eJZ_􀘞e*a|gj0ЛPg NMl@:egAIKlqecA`|g@_"e@1TJAg\g@=en?@e@B"e@1T>JAg?Pp@`"e@1T>JAg\glD@:e``A@`ea@A`"e@1T>JAg?@`a@ہ``@``A"e@1T>JAg\g(l\@:e?ڀeNهB\gqHnML@:eNn@Aڞe`@A`"e@1T>JAg?Pp r"e@1T>JAg?PUP`B\g@?ee\g@=ee"e@1T>JAg?Pp p"e@1T>JAg?Pp r"e@1T>JAg?Pp t"e@1T>JAg?Pp x"e@1T>JAg?Pp |"e@1T>JAg?Pp p"e@1T>JAg\gAX]L@:e``Ae@"e@1T>JAg_@` @`k@d?` @h"e@1T>JAg_@` @`k@d?` @h"e@1T>JAg\gAX]L@:e``A@ke `"e@1T>JAgp`@A`"e@1T>JAg?``@A`"e@1T>JAgAkIL`@A\g`0OnXEL@:eev*"e@1TJAg?@@ds`\gn000LOML"e@1T JAg`@h"e@1T>JAg?@`@l"e@1T>JAg?@k@p"e@1T>JAg?@k@p"e@1T>JAg?@`@q"e@1T>JAgp`@A`"e@1T>JAg?``@A`"e@1T>JAgPAUuIL``ٺk`@A`\gӵ0XEnOL@:eev "uU@J@H@L"e@1T>JAg@@Dr`\gn000LOML"e@1T JAg\glD@:e_`d?`eNـBj§B\gQPM@:ee+"\g0КPgNl@:eAILk`ecAہ`@\g@=ee"e@1T JAg@@Ja@\gaݠ@=ee"e@1T>JAgp`@A`"e@1T>JAg?``@A`"e@1T>JAgAkIL`@A\g`0ӄOn?@@ds`\gn000LOM6 L"e@1T JAg`@h"e@1T>JAg?@` p"e@1T>JAg_@AILk \g@M@:ee*_@ \g@?ee"e@1T>JAg_@AILk \g@M@:eez*_@ \g@?ee"e@1T>JAg_@AILk \g@M@:ee:*_@ \g@?ee"e@1T>JAg_@AILk \g@M@:ee *_@ \g@?ee"e@1T>JAg?@` |"e@1T>JAg?@` ~"e@1T>JAg?@`@a"e@1T>JAg?@`@`"e@1T>JAg?PB\gnqHML@:ee"e@1T>JAg?PB\gnqHML@:ee"e@1T>JAg?PB\gnqHML@:ee"e@1T>JAgp`@A`"e@1T>JAg?``@A`"e@1T>JAgPAILk \g@@:ee*P "e@1T>JAg\gAX]L@:e``A@ke `"e@1T>JAg\gИ0PAm]L@:e``Ae@"e@1T>JAg\gИ0PAm]L@:e``Ae@"e@1T>JAg\g\@:ege\ggAX]K?Иgum@:e?eg\g0Pm@:e``Ae@"e@1T>JAg\g?|;e@uu;e@Nge\ggAX]K?Иgum@:eeg\g0Pm@:e``Ae@"e@1T>JAg\g\@:ege\ggAX]K_gum@:e?eg\g?0P@:e``Ae@"e@1T>JAg\g?|;e@uu;e@Nge\ggAX]K_gum@:eeg\g?0P@:e``Ae@"e@1T>JAg\g0P?L@:e``Ae@"e@1T>JAg\g0P?L@:e``Ae@"e@1T>JAg\gA0T]L@:eNne```@A\g?Xg:e@UU@:ee"e@1T>JAg?@AUهB\gnqH]ML@:ee\g@?eu`@Ae`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg\g?XAm]L@:e``Ae@"e@1T>JAg\g?XAm]L@:e``Ae@"e@1T>JAg\g?XAm]L@:e``Ae@"e@1T>JAg\g?XAm]L@:e``Ae@"e@1T>JAg\g?XAm]L@:e``Ae@"e@1T>JAg@@ANnjC@ABCDUnB\gMqH L@:ene\gCqHn!L@:e`@``Ae \guٱDn?A]L@:eue@"e@1T>JAg@@ANnjC@ABCDUnB\gMqH L@:ene\gCqHn!L@:e`@``Ae \guٱDn?A]L@:eue@"e@1T>JAg`@Ak`"e@1T>JAg`@Ak`"e@1T>JAg\gAPDno]L@:e``Ae@"e@1T>JAgAILjA@IMlIJH2|gI0LA Om]L@:e``Ae@"e@1T>JAgAILjA@IMlIJH2|gI0LAOm]L@:e``Ae@"e@1T>JAgAILjA@IMlIJH2|gI0LA Om]L@:e``Ae@"e@1T>JAgAILjA@IMlIJH2|gI0LAOm]L@:e``Ae@"e@1T>JAgAILjA@IMlIJH2|gI0LAR Om]L@:e``Ae@"e@1T>JAgAILjA@IMlIJH2|gI0LA Om]L@:e``Ae@"e@1T>JAgAILjA@IMlIJH2|gI0LAOm]L@:e``Ae@"e@1T>JAgAILjA@IMlIJH2|gI0LAOm]L@:e``Ae@"e@1T>JAgAILjA@IMlIJH2|gI0LAmOm]L@:e``Ae@"e@1T>JAgAILjA@IMlIJH2|gI0LA Om]L@:e``Ae@"e@1T>JAgAILjA@IMlIJH2|gI0LAeOm]L@:e``Ae@"e@1T>JAgAILjA@IMlIJH2|gI0LAOm]L@:e``Ae@"e@1T>JAgAILjA@IMlIJH2|gI0LAEOm]L@:e``Ae@"e@1T>JAgAILjA@IMlIJH2|gI0LAOm]L@:e``Ae@"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg``@A`"e@1T>JAg@@Ak`\gApPDno]L@:e``Ae@"e@1T>JAg@@Ak`\gApPDno]L@:e``Ae@"e@1T>JAg@@Axkk`\gApPDno]L@:e``Ae@"e@1T>JAg@@A2k`\gApPDno]L@:e``Ae@"e@1T>JAg@@A3k`\gApPDno]L@:e``Ae@"e@1T>JAg@@Ak`\gApPDno]L@:e``Ae@"e@1T>JAg@@Ak`\gApPDno]L@:e``Ae@"e@1T>JAg@@A:k`\gApPDno]L@:e``Ae@"e@1T>JAg@@A/k`\gApPDno]L@:e``Ae@"e@1T>JAg@@Alk`\gApPDno]L@:e``Ae@"e@1T>JAg@@A!k`\gApPDno]L@:e``Ae@"e@1T>JAg@@A|kk`\gApPDno]L@:e``Ae@"e@1T>JAg@@Ak`\gAPPDno]L@:e``Ae@"e@1T>JAgp`@A`"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gAPnm]L@:e``Ae@"e@1T>JAg\gAPnm]L@:e``Ae@"e@1T>JAg\gmPAn]L@:e``Ae@"e@1T>JAg\gPmA]L@:e``Ae@"e@1T>JAg\gPmA]L@:e``Ae@"e@1T>JAg\gmPAn]L@:e``Ae@"e@1T>JAg@gU\gQP@:eL7e\guPPDAn]L@:e`@ٞe\g``A@=ee"e@1T>JAg\gpXA]L@:e``Ae@"e@1T>JAg\gpXA]L@:e``Ae@"e@1T>JAg@@ANGA]JgJ\gΙ1L@:eUٞe\g@=eUe*N\gpX@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg??TuИ/a.* IA r]L\gaP\@:e``Ae@"e@1T>JAgD@:e``A@kjpek"e@1T>JAg\gAP\]L@:e``Ae@"e@1T>JAg\gP\?A]L@:e``Ae@"e@1T>JAg@@ANGA]JgJ\gΙ1L?@:eUٞe\g?@=eue#GAIJkM㵙`Ca@aݠ"e@1TJAgNg\gP\@:e``Ae@"e@1T>JAg\gAPX]L@:e``Ae@"e@1T>JAg\gP\A]L@:e``Ae@"e@1T>JAg\gP\A]L@:e``Ae@"e@1T>JAg\g0XAn]L@:e``Ae@"e@1T>JAg\gИ0XAm]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gP@A]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Aڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\g?PH_A]L@:e``Ae@"e@1T>JAg`@Aڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg?D?*^ a\g0ԚN"e@1TJAg\g0T?A]L@:e``Ae@"e@1T>JAg?@rt?a,?T?И*^a\g0ԚMN"e@1T JAg ra,wa+owa+o\g_0TA]L@:e``Ae@"e@1T>JAgj?_PA\gn0X]L@:e``A@`el"e@1T>JAgj?PA\gn0Xo]L@:e``A@_`el"e@1T>JAgj?PA\gn0Xo]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg\gPDAn]L@:e``Ae@"e@1T>JAg?@r?da+\gAPDn]L@:e``Ae@"e@1T>JAg r a +ua,m`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gP@nA]L@:e``Ae@"e@1T>JAg\g?P@A]L@:e``Ae@"e@1T>JAg\g?P@A]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gA0T]L@:eNne```@A\g?Xg:e@UU@:ee"e@1T>JAg?@AUهB\gnqH]ML@:ee\g@?eu`@Ae`"e@1T>JAg??Tua*\gAD]L@:e``A@kjpek"e@1T>JAg\gp@nA]L@:e``Ae@"e@1T>JAg\g_p@?A]L@:e``Ae@"e@1T>JAg?A I]Lr\gaPT@:e``Ae@"e@1T>JAgPL@:e``Ae@"e@1T>JAga@+Z&agl0ПPӵVNl@:eeAILk`cA`ځ@"e@1TJAg *\g0КN"e@1TJAg`A@a"e@1T>JAg\gAp\nm]L@:eUue```@A\g?ИT_󰘃g@:euj Hje@D"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg@N\g02XM@:ee*`@Almڡ\g@=ee"e@1T>JAg\g0КN"e@1TJAg\gИp\A]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gИp\A]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gИp\A]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg\gИp\A]L@:e``Ae@"e@1T>JAg\gРP\?A]L@:e``Ae@*\g0КM N"e@1T JAgpsat+kp"e@1T>JAg\gP\An]L@:e``A@kep"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gИPp\A]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gИp\A]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gИp\A]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg\gИPp\A]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg\gИp\A]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gИp\A]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gИp\A]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gИp\A]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gИp\A]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gpp\A]L@:e``Ae@"e@1T>JAg\gPXAn]L@:e``A@kep"e@1T>JAg\g PXA]L@:e``Ae@*\g0К N"e@1TJAg\g_PXAn]L@:eg`@Aej?_\gpL@:ee"e@1T>JAg\g|p\Au٣g]L@:eunڞe``A@"e@1T>JAg@AUu`@A`\gCqHn]ML@:eue\g\N"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gxp\Au٣g]L@:eunڞe``A@"e@1T>JAg@AUu`@A`\gCqHn]ML@:eue\gXN"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gИp\A]L@:e``Ae@"e@1T>JAg@``A@|gln"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg@``A@|ghn"e@1T>JAgGA]JgU\gPXn@:ege\gPX@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A`lb"e@1T>JAg`@A`b€"e@1T>JAg`@A`lb"e@1T>JAg`@A`lb"e@1T>JAgp`@A`kb"e@1T>JAg`@A`lb"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@AlLmڡ"e@1T>JAg`@AlLmڡ"e@1T>JAg`@AlLmڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A"lmڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Aڡ"e@1T>JAga+\ a\g0ԚN"e@1TJAg`@Aa"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAgeeQ: `@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gИp\A]L@:e``Ae@"e@1T>JAgT *]`\gApD]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@A lmڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gp@An]L@:e``A@kep"e@1T>JAg\gp@A]L@:e``Ae@"e@1T>JAg\gp@Am]L@:e``Ae@"e@1T>JAg\gp@Am]L@:e``Ae@"e@1T>JAg\gp@Am]L@:e``Ae@"e@1T>JAg\gp@Am]L@:e``Ae@"e@1T>JAg\gAp@nm]L@:e``Ae@"e@1T>JAg\gAp@n m]L@:e``Ae@"e@1T>JAg\gAp@n m]L@:e``Ae@"e@1T>JAg\gAp@nm]L@:e``Ae@"e@1T>JAg\gAp@nm]L@:e``Ae@"e@1T>JAg\gAp@nm]L@:e``Ae@"e@1T>JAg\gИp\A]L@:e``Ae@"e@1T>JAg?``@A`"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gИ0p\A]L@:e``Ae@r"k@d"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gРPTA]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gРpPTA]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gРPTA]L@:e``Ae@"e@1T>JAgPBCXg``AA"e@1T>JAg\gРPTA]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg\gРPTA]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAgPBCXg``AA"e@1T>JAg\gРPTA]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gРPTA]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\gРPTA]L@:e``Ae@"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg`@Almڡ"e@1T>JAg\g`pXh3i⠚-\gn000HO.Nf ML"e@1T JAg\gAPTn]L@:e``A@kep"e@1T>JAg`@Almڡ"e@1T>JAg`@A+lmڡ"e@1T>JAg`@A,lmڡ"e@1T>JAg`@AJAg`@Almڡ"e@1T>JAg\g0PJ"e@1T>JAgR`Z`\gqdRKD2i@"e@1TJAgj"e@1TJAgMJa*N@A"\g@=eeGAUJMـ\gT@:eAYMeN@>"J@A@:eMٞegAIKjiΙ\gAqL@?eMJe"\gAqHnqMA@:eKreqaRR$`q*jSjU"e@1T JAgm@A@݀j@jKM\g0P J"e@1TJAgA\gIMk0qXPA6L@:ejeK"e@1TJAg\gHqHqHnPAg@:edAe\gCqHAsnqM!L@:eue\gK𚳙nuكg@?eP@e-"|gD0Л0@NgS@M@:eNegD20pqHKiⓙ@?eeg lT@:eejKTJTNS"e@1TJAgA\gILk0К욠AVNqL@?ejSٞej"e@1TJAgNQjSj"e@1TJAgjS"e@1TJAgTm"e@1TJAg@tAHKIND2mi|g0𐛠qXҙ L@:eRJJeRHQJaq@@An"\gg@=ee@A"\g@=enUede26@@FAGBHCD Dej @2ideJg޸8*kjJ+KA*\gH@AB*\gP@BE"ch3i@*\gg0@=ece\gh1Teg:e@%@ٞe\gg0@=ee\gX)X@CeH2I@gKm\g@ \gD•d2I@"p1\g=e d5 @D2YP+|g pII `d2I@grad3m@*PD2I1@TKH@Xj@)ؠr`\gqdzKH2i@"j#aSK"\gD,*|gg0PJg1T@:eeX@1pYg`Sa瀤tM` s ach3m`LۘgJR`gD2qd0Ki|g@M@:ee Z`H3 m`i{% % { { # # w w  s  o  e [[WWQ[+Ou94_#I o3Y+ 6_#I o 3!!!Y""###_$$#%%&s&&E'' (k((/)))U**+++M,,-s--7...]//!000U112{22M334s44E55 6U[k66=778q885999[::-;;;S<<%===Y>>9?? @m@@1AAAeBB7CYC DkDˎD=EEFqFF5GGG[HH-IIISJJKyKK=LLMcM1VUM'NNNMOOPPsPsPslP7QQQ]R]RR!SSSGTˇT UmUU1VVVeWW7XXX]YY!ZZZU[['\\\M]]^^^S__%```ga-1Va+bbb_cc?ddee'eSffgygg=hhicii'jjjMkklsll7mmm]nn!oooGpp qmqq1rrsssStt3uuugvvGww xmxx1yyyWzz{}{{A||}g}}+~~~Qwـ; oт3YCiˇ-o߉AuU'PP]R]R[ˎ-Syۑ=cœ'MsՖ7 k͘/qۚySϞcaaϞCKr>a\gԘ0@M@:ee(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?eeggg@?e0𐘞e\gVL0@=er`a|gg0P Jg1T@:eeTKJX@CeH2I@k+dga`kkgAiic aTe\gg\)@:ebgD2I@e"p1\gg 5 @JD2Y, I@r`"I)bg"eqPJAgKkJz+\g0@6M:e@e"eqP{JAg(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ej Jyd(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ej J(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ejJ(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ej J(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ejJV(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ej J,(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ejJ(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ej J(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ejJ(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ejJ(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?e{j[(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?e}j2(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?e[j (QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?e]j(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?e(j(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?e)j(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ejJd(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ejJ:(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ejJ(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ejJ(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?e|j(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ejJ(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ejJi(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ejJ?(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ejJ"eqPJAgHRaCeH2I`T l_ZXgGX g\g@?eeJ"eqPJAg(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?e j"eqPJAg(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?e j"eqPJAg(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?e j"eqPJAg(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ej"eqPJAg(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?e` j"eqPJAg(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?ejQJ"eqPJAg(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?e` j"eqPJAg(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?e` j"eqPJAg(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?e` j"eqPJAg(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?e` j"eqPJAg(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?e`j"eqPJAg(QaCeH2I l`T)_ZXgG@Ҁ\ggg@?ee\ggg@?e`j"eqPJAgHRaCeH2I`T l_ZXgGX g\g@?ee @2ide\g&gqDg@:e@e ajD@aAaKEbkg"ch3i@*\gg0@=ee @jJE"ch3i@"jHjI ""Km@JHKIkMkjk55EA)Md4m䂙h3L〫a𪩤44A)ML A~jd4q4嫙KBjɀ(MJL,m@:ege "Cm@JHKIkMkjkMJL,m@:ege "Cm@JHKIlMkjٜMJjdjbj`kjkwL,m@:egMeB& K@%r`jKj@k\gHqL nm#mAK)L?L@:ejomemk_jkjkL,m@:ege "Km@JHKIkMkjCMJBJmKIMMR_a|etd j: @2iedgDg0𴘀@M@:eel@8ej @2ideE* $ @9e@ zd$r/a @J Z)a l i@bgK[ahBK [a_ra J jg @:ej g@:e ggB Pq"P @:e Ҟe=*T @:e☞e|g%"B0ЙNl@8ee@@ @ F* 󤙀@=e e@=e0ЙNl@8ee CM ҂gQP@:e g 0O@?e𠙐g@=e󤙂e@=e󤙞eg@=e @e JØ  g@:e󤙂e@=e󤙞eg@=e @e ҟj @2ide w$%x =$%x <$%x ;$%x :$%x 9$%x 8$%x 7$%x 6$%x 5$%x 4$%x 3$%x 2$%x 1$%x 0$%x /$%x .$%x -$%x ,$%x +$%x *$%x ($%x '$%x &$%x %$%x $$%x #$%x "$%x !$%x  $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x  $%x  $%x  $%x  $%x  $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x ~$%x }$%x |$%x {$%x z$%x y$%x x$%x w$%x v$%x u$%x t$%x s$%x r$%x q$%x p$%x o$%x n$%x m$%x l$%x k$%x j$%x i$%x h$%x g$%x f$%x e$%x d$%x c$%x b$%x a$%x `$%x _$%x ^$%x ]$%x \$%x [$%x Z$%x Y$%x X$%x W$%x V$%x U$%x T$%x S$%x R$%x Q$%x P$%x O$%x N$%x M$%x L$%x K$%x J$%x I$%x H$%x F$%x E$%x D$%x C$%x B$%x A$%x @$%x ?$%x >$%x =$%x <$%x ;$%x :$%x 9$%x 8$%x 7$%x 6$%x 5$%x 4$%x 3$%x 2$%x 1$%x 0$%x /$%x .$%x -$%x ,$%x +$%x *$%x )$%x ($%x '$%x &$%x %$%x $$%x #$%x "$%x !$%x  $%x $' 'src/cache.crulenotrackflow add @%s%lusrc/datatype.c%s%.2x:ct 0x%Zx [invalid type]%Zu0x%Zxsrc/gmputil.ccnt <= 1 %-30s %u %hu/etc/iproute2/%s/usr/share/iproute2/%s../sys/fs/cgroupsrc/evaluate.cleft->right->etype == EXPR_VALUEComparison is always falseBUG: Unknown expression %s mask length %u exceeds allowed maximum of %u (map->mappings->set->init)->etype == EXPR_SET(map->map)->etype == EXPR_CONCATi->etype == EXPR_MAPPING(i->right)->etype == EXPR_CONCATchain name too long (%u, max %u)chain name length 0 not allowedchain name must be smaller than %ufiltersrc/mnl.c%s; did you mean table '%s' in family %s?src/cmd.c(init)->etype == EXPR_SET(last_cmd->expr)->etype == EXPR_SETexpr->len / BITS_PER_BYTE <= sizeof(val)BUG: datatype %s has no print method or symbol table BUG: verdict expression length %u is too large (%u bits max) %s %scontinuebreakjumpjump gotogoto returnacceptdropstolenunknown verdict value %u0x%x %511s 0x%x %511s #%u %511s %u %511s #iproute database '%s' corrupted unknown location of pre-defined symbolic constants from %s (in decimal): (in hexadecimal): /etc/connlabel.confrt_marks%llus%llud%lluh%llum%llums0sdtype->refcnt != 0Value %s exceeds valid range 0-%uValue %s exceeds valid range 0-%sString exceeds maximum length of %uEmpty string is not allowedAll-wildcard strings are not supportedUnexpected datatype %soffset and size %u exceeds max tcp headerlen (%u)offset and size %u exceeds max ip option len (%u)cannot use exthdr with %sCannot generate dependency: no %s protocol specifiedlink layer, . concatenation of (src/erec.cerec->num_locations < EREC_LOCATIONS_MAXcache initialization failed: %s%s: could not parse %s "%s"%s: could not parse %s "%s": %s%s: bit %llu out of range (%u max)Could not parse %s expression; did you you mean `%s`?sym->etype == EXPR_SYMBOLNo symbol type informationCould not parse symbolic %s expressionCould not parse %s; did you mean `%s'?Could not parse %s; did you mean `jump %s'?src/mini-gmp.cj == snrn <= allocCould not parse %sInvalid LL addressInvalid IPv4 addressCould not resolve hostname: %sHostname resolves to multiple addressesai->ai_addr->sa_family == AF_INETInvalid IPv6 addressai->ai_addr->sa_family == AF_INET6Protocol out of rangeCould not resolve protocol nameService out of rangeCould not resolve service: %sDay has been specified twiceHour has been specified twiceMillisecond has been specified twiceMinute has been specified twiceSecond has been specified twicewrong time formatvalue too largeinvalid data type, expected %skbytesmbytesWrong unit format, expecting bytes, kbytes or mbyteswrong policycgroupv2 path fails: %sIn file included from%s %s:%u:%u-%u: from%s:%u:%u-%u: BUG: invalid input descriptor type %u %s: missing icmp error typeBUG: unknown reject family BUG: cannot generate reject dependency for type %d snatdnatredirectmasqueradeconflicting protocols specified: %s vs. %s. You must specify ip or ip6 family in %s statement%s; did you mean chain '%s' in table %s '%s'?%s; did you mean %s '%s' in table %s '%s'?src/intervals.c(existing_set->init)->etype == EXPR_SET(ctx.purge)->etype == EXPR_SETinterval overlaps with an existing oneconflicting intervals specifiedBUG: unhandled op %d Evaluate %s not a value expressionBUG: invalid verdict expression %s payload statement for this expression is not supporteduneven load cannot span more than %zu bytes, got %upayload->payload.offset >= BITS_PER_BYTEsizeof(data) * BITS_PER_BYTE >= masklenpayload_byte_size > 0%s; meter '%s' overlaps an existing %s '%s' in family %sMeter key expression can not be constantMeter key expression can not contain commentsexisting set '%s' has timeout flagexisting set '%s' lacks timeout flagexisting set '%s' has size %u, meter has %u(set)->etype == EXPR_SETmeterct secmark must not be set to constant valuelevel and group are mutually exclusiveflags and group are mutually exclusivelog level audit doesn't support any further optionslog prefix is too longlog prefix must have a minimum length of 1 characterreject code must be integer in range 0-255you cannot use tcp reset with this protocolcannot use reject with arpabstracted ICMP unreachable not supportedconflicting protocols specified: ip vs ip6cannot reject from this link layer protocolcannot reject this network familycannot infer ICMP reject variant to use: explicit value required. NAT is only supported for IPv4/IPv6Expression is not a mapnat map and protocol are mutually exclusivespecify `%s ip' or '%s ip6' in %s table to disambiguatetransport protocol mapping is only valid after transport protocol match(data)->etype == EXPR_CONCATBUG: Internal error: Unexpected alteration of l3 expression BUG: Internal error: Unexpected alteration of l4 expression tproxy is only supported for IPv4/IPv6/INETTransparent proxy support requires transport protocol matchEither address or port must be specified!Address ranges are not supported for tproxy.Port ranges are not supported for tproxy.fanout requires a range to be specifiedqueue expression max value exceeds %umissing destination addressmissing destination interfacecannot specify deviceunsupported familymissing familyExpression does not refer to a setKey expression can not be constantKey expression comments are not supportedMap expression can not be constant__objmap%dExpression is not a map with objectsinvalid mapping expression %sdatatype mismatch, map expects %s, mapping expression has type %sCounter expression must be constant%s is not a mapData expression can not be constantData expression comments are not supportedData expression timeouts are not supportedThis flags are not supported for SYNPROXYBUG: unknown statement type %d dependency statement is invalidexpr->payload.base == PROTO_BASE_LL_HDRconflicting protocols specified: %s vs. %spctx->stacked_ll_countBUG: unknown protocol base %d src/proto.cdescsrc/payload.cexpr->etype == EXPR_PAYLOADBUG: Unhandled icmp dependency code incompatible icmp match: rule has %d, need %uconflicting %s protocols specified: %s vs. %sprotocol specification is invalid for this familyLeftRightmeta nfproto is only useful in the inet familyno transport protocol specifiedunexpected transport protocol %s%s nexthop will not matchcannot determine ip protocol version, use "ip %1$caddr" or "ip6 %1$caddr" insteadconflicting dependencies: %s vs. %s Prefix expression is undefined for non-constant expressionsPrefix expression is undefined for %s typesPrefix length %u is invalid for type of %u bits widthexpr_is_constant(base)Range negative size!expr_is_constant(arg)expr_basetype(arg)->type == TYPE_INTEGERarg->etype != EXPR_UNARYarg->byteorder == BYTEORDER_HOST_ENDIANarg->byteorder == BYTEORDER_BIG_ENDIANBUG: invalid unary operation %u Binary operation limit %u reached Binary operation (%s) is undefined for %s typesBinary operation (%s) is undefined for %s expressionsBinary operation (%s) with different base types (%s vs %s) is not supportedRight hand side of binary operation (%s) must be constantshifts exceeding %u bits are not supported%s shift of %u bits is undefined for type of %u bits widthBUG: invalid binary operation %u BUG: recursion counter underflow !list_empty(&expr_concat(ctx->ectx.key)->expressions)too many concatenation componentsspecify either ip or ip6 for address matchingunexpected concat component, expecting %sBUG: Unexpected etype %d cannot use %s in concatenationcannot use %s in concatenation, lacks datatypecan not use variable sized data types (%s) in concat expressions(*expr)->etype == EXPR_CONCATConcatenation of size %u exceeds maximum size of %ludatatype mismatch, expected %s, expression has type %sList member must be a constant valueBasetype of type %s is not bitmask(list)->etype == EXPR_LIST(i->left->key)->etype == EXPR_SETSet reference cannot be part of another set(elem->key)->etype == EXPR_SETSet member is not constant(i)->etype == EXPR_SETnumber of statements mismatch, set expects %d but element has %dmissing statement in %s declarationstatement mismatch, element expects %s, but %s has type %sElement mismatches %s definition, expected %s, not '%s'You must add 'flags interval' to your %s declaration if you want to add %s elementsImplicit map expression without known datatype__map%dBUG: %d vs %d (ctx->set->init)->etype == EXPR_SETexpected mapping, not %smapping outside of map contextset is not a mapKey must be a constantmap has no mapping dataValue must be a constantValue must be a singletonObject mapping data should be a value, not %sElement mapping mismatches map definition, expected %s, not '%s'ipsec expression is only valid in ip/ip6/inet tablesBUG: unknown expression type %s !expr_is_constant(*expr) || expr_is_singleton(*expr)basetype == TYPE_INTEGER(((i->len) + (8) - 1) / (8)) > 0Byteorder mismatch: expected %s, %s got %sRange expression is undefined for %s typesRange is not constantleft->etype == EXPR_VALUEright->etype == EXPR_VALUEleft->byteorder == right->byteorderleft->byteorder == BYTEORDER_HOST_ENDIANList limit %u reached *expr != next(*right)->etype == EXPR_SETleft->etype == EXPR_BINOPBUG: invalid binop operation %u Inverting range values for cross-day hour matching Right hand side of relational expression (%s) must be constantRelational expression (%s) has constant valueCannot be used with right hand side constant valuecannot combine negation with binary expressionnegation can only be used with singleton bitmask values. Did you mean "!="?Set is empty(right)->etype == EXPR_SET__set%dUse concatenations with sets and maps, not singleton valuesBUG: invalid expression type %s Relational expression (%s) is undefined for %s expressionsBUG: invalid relational operation %u datatype mismatch: expected %s, expression has type %s with length %ddatatype mismatch: expected %s, expression has type %syou cannot use a set here, unknown value to useyou cannot reference a set here, unknown value to useyou cannot specify a prefix here, unknown type %sPrefix expression expected integer value%s statement must be statefulccid_specificreserved_longdata_checksumelapsed_timetimestamp_echotimestampdata_droppedack_vector_nonce_1ack_vector_nonce_0ndp_countinit_cookieconfirm_rchange_rconfirm_lchange_lreserved_shortslow_receivermandatorypaddingSundayMondayTuesdayWednesdayThursdayFridaySaturdayexistsmissingunspecunicastlocalbroadcastanycastmulticastblackholeprohibithostotheretherpppipipipip6loopbacksitipgrebinding-refresh-requesthome-test-initcareof-test-inithome-testcareof-testbinding-updatebinding-acknowledgementbinding-errorfast-binding-updatefast-binding-acknowledgementfast-binding-advertisementexperimental-mobility-headerhome-agent-switch-messageDay of week of packet receptionhourHour of day of packet receptionRelative time of packet receptionifnamenetwork interface namefib_addrtypefib address typedevgroupdevgroup nameicmpx_codeicmpx codepkt_typepacket typegidgroup IDuiduser IDclassidTC classidrouting realmiface_typenetwork interface typemh_typeMobility Header Typell_addrlink layer addressreplyrrequestrreplyinrequestinreplynakether_addrEthernet addressarp_opARP operation8021q8021adresponsedataackclosereqclosesyncsyncackfinsynrstpshurgecncwrhtypeptypehlenplensaddr ethersaddr ipdaddr etherdaddr ipdestination-unreachablepacket-too-bigtime-exceededparameter-problemecho-requestecho-replymld-listener-querymld-listener-reportmld-listener-donemld-listener-reductionnd-router-solicitnd-router-advertnd-neighbor-solicitnd-neighbor-advertnd-redirectrouter-renumberingind-neighbor-solicitind-neighbor-advertmld2-listener-reportmembership-querymembership-report-v1membership-report-v2membership-report-v3leave-groupsource-quenchrouter-advertisementrouter-solicitationtimestamp-requesttimestamp-replyinfo-requestinfo-replyaddress-mask-requestaddress-mask-replynot-ectect1ect0cs0cs1cs2cs3cs4cs5cs6cs7dfbelephbaf11af12af13af21af22af23af31af32af33af41af42af43vaether_typeEthernet protocol0x%.4Zxdccp_pkttypeDCCP packet typetcp_flagTCP flaggenevevnivxlanicmpv6_codeicmpv6 codeigmp_typeIGMP typeicmp_codeicmp codenewrelatedassuredprotoinfohelpermarkseqadjexpectedseen-replyconfirmedseq-adjustsnat-donednat-donedyingfixed-timeoutoffloadhw-offloadestablisheduntrackedintegerExplicit Congestion Notification0x%.1ZxdscpDifferentiated Services Code Point0x%.2Zxgretapl4protoprotocolsportdportvtagchecksumcsumcovlengthnexthdrcpihdrlengthreservedspimrtgroupct_eventconntrack event bitsct_statusconntrack statusct_dirconntrack directionct_stateconntrack statenf_protonetfilter protocolbitmasknetlinkverdictnetfilter verdictpcpdeicfiiface_indexnetwork interface indexackseqdoffwindowurgptrhtonntoh<<>>&^|==!=<<=>=icmpv6_typeICMPv6 typeicmp_typeICMP typenetdevicmpv6mtumax-delaytaddrgatewayinet-servicenetwork layertransport layerpayload datahost endianbig endianWarningErrorinternalcgroupsv2cgroupsv2 pathbooleanboolean typerelative timeport-unreachableadmin-prohibitedno-routehost-unreachableaddr-unreachablepolicy-failreject-routenet-unreachableprot-unreachablenet-prohibitedhost-prohibitedfrag-neededpacket mark0x%.8Zxinet_protoInternet protocolstringflow_offloadinet_serviceinternet network serviceipv6_addrflowlabelhoplimitipv4_addrfrag-offoriginaldirectionstatusexpirationl3protoproto-srcproto-dstpacketsavgpktzoneip saddrip daddrip6 saddrip6 daddrinetnfprotoct_labelconntrack label%s; did you mean obj '%s' in table %s '%s'?src/expression.ce1->flags & EXPR_F_SINGLETONe2->flags & EXPR_F_SINGLETONBUG: refcount was 0 BUG: refcount saturated $%s-*unknown-exthdrtcp option %dtcp option @%u,%u,%utcp option %sip option %ssctp chunk %sdccp option %dexthdr %scheckunknownfib iifoif0x%x(concat_expr)->etype == EXPR_CONCATsrc/iface.ccmd->expr->etype == EXPR_SETingresspreroutinginputforwardpostroutingoutputegress%s; did you mean flowtable '%s' in table %s '%s'?BUG: invalid command object type %u (expr->map)->etype == EXPR_CONCAT(expr)->etype == EXPR_CONCAT(expr)->etype == EXPR_LIST(expr)->etype == EXPR_SET/%u(, } : vmap map @%s timeout never expires comment "%s"symhashjhash mod %u seed 0x%x offset %udsize_bytes == div_round_up(i->dtype->size, BITS_PER_BYTE)%s is not a valid variable expressionmust be a value, not %s(concat)->etype == EXPR_CONCAT(new)->etype == EXPR_CONCAT(new)->etype == EXPR_LIST!list_empty(&expr_list(expr)->expressions)!first(set_expr)->etype == EXPR_SET(new)->etype == EXPR_SETBUG: invalid range expression type %s BUG: Unknown result %d src/fib.cexpr->len >= expr->prefix_leni + (bytes > 0) == rn(((len) + (8) - 1) / (8)) > 0%s is not a valid priority expression%255s %c %dexpr->etype == EXPR_VALUElen <= expr->lenexpr->dtype->basetype->type == TYPE_BITMASKn < lenexpr->etype == EXPR_RELATIONALexpr->op == OP_EQ || expr->op == OP_IMPLICITBUG: unhandled expression type %d expr->etype == EXPR_SET_ELEMBUG: Prefix for unexpected type %d expr->len / 8 > 0BUG: unhandled key type %s (set->init)->etype == EXPR_SETsrc/ipopt.cexpr->etype == EXPR_EXTHDRtype < array_size(ipopt_protocols)src/exthdr.csrc/sctp_chunk.cexpr->exthdr.desc != NULL/etcrt_realms. Try "typeof expression" instead of "type datatype".%s definition does not specify keyauto-merge only works with interval setsunqualified type %s specified in %s definition%s(set->key)->etype == EXPR_CONCATexpression is not a concatenationmap definition does not specify mapping data typeset->data == NULLexisting %s lacks interval flag%s already exists with different datatype (%s vs %s)!set_is_map(set->flags)Cannot merge %s with incompatible existing %s of same name(*dev_expr)->etype == EXPR_LISTStatement after terminal statement has no effectCould not process rule: %s(ctx->init)->etype == EXPR_SET(elems)->etype == EXPR_SETelement does not exist(purge)->etype == EXPR_SET(set->existing_set->init)->etype == EXPR_SET(add)->etype == EXPR_SETsrc/rule.c# Cannot set up netlink receive socket buffer size to %u bytes, falling back to %u bytes # ERROR: We lost some netlink events! # ERROR: %s datatype %s (%s)%s expression, datatype %s (%s) (basetype , %u characters, dynamic length, %u bits pre-defined symbolic constants Could not process rule: %s Please, rise /proc/sys/net/core/wmem_max on the host namespace. Hint: %d bytesChains of type "nat" must have a priority value above -200Chain of type "%s" is not supported, perhaps kernel support is missing?Chain "%s" already exists in table %s '%s' with different declaration"destroy" command is not supported, perhaps kernel support is missing?rassrrptrlsrrrrasconfseqnoforward-tsnnew-cum-tsnasconf-ackshutdown-completelowest-tsnecnecookie-ackcookie-echoshutdown-ackshutdowncum-tsn-ackabortheartbeat-ackheartbeatsacka-rwndnum-gap-ack-blocksnum-dup-tsnsinit-ackinit-tagnum-outbound-streamsnum-inbound-streamsinitial-tsnstreamssnppidreserved2more-fragmentsoifnamert2rt0addr[1]addr[2]srhlast-entrytagsid[1]sid[2]seg-leftrange_symbolrange_valuecatch-all set elementxfrmrelationalbinopunarymappingset elementset referenceconcatpayloadprefixvariablesymbolprioritypriority typeout of dynamic memory in yy_scan_bytes()out of dynamic memory in yy_scan_buffer()meta %ssrc/mergesort.cilen > 0rootnone%0x:%0xInterface does not existValue too largeUser does not existGroup does not exist%Y-%m-%d %TError converting timestamp to printed time%Y-%m-%d %R%Y-%m-%dCannot parse date"%02d:%02d:%02d%T%RCan't parse trailing input: "%s" meta %s set %s set BUG: Must be a value, not %s BUG: Interface length %u exceeds limit ifname_len > 0BUG: Interface length %zu exceeds limit, no NUL byte (dev_expr)->etype == EXPR_LISTibriportobriportsecpathsrc/meta.c_ret >= 0syntax error, unexpected %s, known keys are %sBUG: Unknown type %d src/monitor.caddcreateinsertdeletename too long, %d characters maximum allowedtype <= NFT_OBJECT_MAX && obj_type_cmd_array[type]set definition does not specify keySet %s: Unexpected initial type %s, missing { }?The %s family does not support this hookinvalid priority expression %s in this context.invalid policy expression %sThis chain type cannot be bound to devicemissing hook and priority in flowtable declarationinvalid hook %sinvalid priority expression %s.invalid state for this protocolmissing optionsspecify either ip or ip6 for addressthis output type is not supported, use nft -j list ruleset for JSON support insteadJSON export is no longer supported, use 'nft -j list ruleset' insteadinvalid event %sthis output type not supportedBUG: invalid command operation %u %s (you must be root) /dev/stdinCould not open file "%s": %s Not a regular file: "%s" define %s=%s; src/libnftables.clist_empty(&cmds)src/optimize.ck >= 0stmt_a->type == STMT_VERDICTMerging: into: flowtablechain# device keyword (%s) unexpected for this family } hook %s device %s { hook %s { %011d %010u +%010u %s %s %s %s [%s]} family %s { unrepliedrepliedsyn_sentsyn_recvfin_waitclose_waitlast_acktime_waitsyn_sent2retransunackiifnameiiftypeoiftypeskuidskgidnftracertclassidibrnameobrnamepkttypecpuiifgroupoifgroupiifkindoifkindibrpvidibrvprotosdifsdifnamebrouteibrhwaddrreplacegetflushrenamedescribepolicy typetrace id %08x %s verdict src/netlink.cBUG: Value export of %u bytes would overflow BUG: invalid expression type '%s' in set __chainsrc/netlink_delinearize.cpctx->table != NULLsrc/trace.ctmp->len / 8 > 0conntrack: packet: E: Contact urgently your Linux kernel vendor. Netlink ABI is broken: %s:%d %s Cannot parse userdatakey->len / 8 > 0Unexpected set element with no key!list_empty(&expressions)list_empty(&expressions)data->len / 8 > 0%s:%d: Unable to initialize Netlink socket: %s BUG: invalid data expression type %s BUG: chain length is 0 BUG: chain is too large (%u, %u max) BUG: Unexpected expression type: got %d nld.len > 0BUG: unexpected set element expression Unknown data type in set key %u!datatypeUnknown object type %unetlink event: %s W: Unable to cache set: table not found. W: Unable to cache set_elem. Set not found. W: Unable to cache object: table not found. W: Unable to find object in cache %s table { flags dormant; } # handle %lluchain %s %s %sset %s %s %sW: Received event for an unknown set. (dummyset->init)->etype == EXPR_SET%s element %s %s %s {s: {s:s, s:s, s:s, s:o}}elemW: Received event for an unknown table. %s rule %s %s %s handle %llu handle %llurule unknown rule handle %llupolicy %s %s %s %sflowtable %s %s %s# new generation %d by process %d (%s)No JSON command found with seqnum %u Empty JSON object in cmd list Malformed JSON object in cmd list handlesrc/json.cInvalid destination register %uInvalid source register %uRelational expression size mismatchconsumed > 0Relational expression has no left hand sideUnknown set '%s' in lookup expressionLookup expression has no left hand sideBitwise expression has no left hand sideBitwise expression has no right-hand expressionInvalid bitwise operation %uByteorder expression has no left hand sideInvalid byteorder operation %uCould not parse inner expressionUnsupported inner expression type %spayload statement has no expressionexthdr statement has no expressionhash statement has no expressionmeta statement has no expressionct statement has no expressionNAT statement has no address expressionNAT statement has no proto expressiontproxy address must be IPv4 or IPv6MASQUERADE statement has no proto expressionredirect statement has no proto expressionDUP statement has no destination expressionDUP statement has no output expressionfwd statement has no output expressionfwd statement has no familyqueue statement has no sreg expressionCould not parse dynset stmtUnknown set '%s' in dynset statementDynset statement has no key expressionConcat expression size mismatchCould not parse dynset map data expressionsUnknown set '%s' in objref expressionobjref expression has no left hand sideunknown objref expression type %uNFT_MSG_NEWTABLENFT_MSG_DELTABLENFT_MSG_NEWCHAINNFT_MSG_DELCHAINNFT_MSG_NEWRULENFT_MSG_DELRULENFT_MSG_NEWSETNFT_MSG_DELSETNFT_MSG_NEWSETELEMNFT_MSG_DELSETELEMNFT_MSG_NEWGENNFT_MSG_TRACENFT_MSG_NEWOBJNFT_MSG_DELOBJe->etype == EXPR_PAYLOADBUG: register reg_low %u invalid src/netlink_linearize.cBUG: invalid comparison operation %u BUG: invalid nat family %u value->len >= binop->right->len (inner) saved ll headers:update %s protocol context%s: %-20s: %s <-(right->set->init)->etype == EXPR_SETinnerimmediatedreg < ctx->reg_lowdiv_round_up(expr->arg->len, BITS_PER_BYTE) != 1byteorderbitwiseexpr->mappings->etype == EXPR_SET_REFlookupdreg == NFT_REG_VERDICTBUG: invalid range operation %u expr->right->etype == EXPR_SET_REFcmpBUG: NFT_MAX_EXPR_RECURSION limit reached objrefBUG: unsupported expression %u connlimitBUG: unknown stateful statement type %d dynsetmasqredirBUG: unknown nat type %d stmt->nat.proto == NULL(mappings)->etype == EXPR_SETnat_stmt->type == STMT_NATnat_expr/proc/net/netlink%*x %d %u %*x %*d %*d %*x %*d %*u %lu /procstmt->type == STMT_PAYLOADexpr->etype == EXPR_BINOPBUG: Missing icmp type mapping desc->base == expr->payload.base[unknown numgen]numgen %s mod %uttl loose ttl skip osf %sversionosf %sname@%s,%u,%uip ip6 rt %s%spayload base is invalid for this familyambiguous payload specification: no %s protocol specifiedright->len / BITS_PER_BYTE <= sizeof(proto)right->len / 8 > 0desc->base <= PROTO_BASE_MAXbase->length > 0(stmt_a->expr->right)->etype == EXPR_SET(stmt_a->expr->right)->etype == EXPR_LISTleft->etype == EXPR_PAYLOADbase == left->payload.basebinop->etype == EXPR_BINOPbinop->left == leftexpr->left->dtype == &invalid_typeexpr->right->dtype != &invalid_typeBUG: unknown operation type %d nexthopnhihincreject icmpx codereject icmpv6 codereject icmp codesocket %s level %uover ct count %s%u packets %llu bytes %lluct helper set ct timeout set ct expectation set meta secmark set %s name prefix "%s" group %u snaplen %u queue-threshold %u level %s flags all flags tcp sequence%soptions flags ip options flags skuid flags ether flags %sbypass%sfanout to to 0 with tcp reset with icmpx with icmp with icmpv6 ip ip6 prefix to[]-[%srandom%sfully-random%spersistent device fwd %s to fwd to reset xt %s "%s" timestamp sack-permsynproxy mss %u wscale %u%s%ssynproxy%s%stunnel %sipsec inipsec outipsec (unknown dir %d) spnum %u (unknown key 0x%x) used dormantownerpersist %sBUG: unknown chain verdict src/statement.c }bridge# Warning: table %s %s is managed by iptables-nft, do not touch! table %s %s { chain %s { comment "%s" type %s hook %s device "%s" devices = { priority %s; policy %s; flags offload; } { type %s hook %s } priority %s; policy %s; }type <= NFT_OBJECT_MAX && obj_type_name_array[type]%sflowtable%s%shook %s priority %s%s%s%sdevices = { }%s%s%sflags offload%s%s%scounter%s%s}%ssrc/segtree.cmeter size %u { secondminuteweeksack-perm%s%s%spackets %llu bytes %llu%s%s%s%s%s%llu %s used %llu %s%s%stype "%s" protocol %s%sl3proto %s%s%s%sprotocol %s%spolicy = { %s : %s%sdport %d%s%s%stimeout %s%ssize %d%srate %s%llu/%s burst %u packetsrate %s%llu %s/%s burst %llu %smss %uwscale %u%s%s%sid %u%s%s%sip saddr %s%s%sip6 saddr %s%s%sip daddr %s%s%sip6 daddr %s%s%ssport %u%s%s%sdport %u%s%s%stos %u%s%s%sttl %u%s%s%serspan {%s%s%s%sversion %u%s%s%s%sindex %u%s%s%s%sdirection %s%s%s%s%sid %u%s%s%s}%s%s%svxlan {%s%s%s%sgbp %u%s%s%sgeneve {%s%s%s%sclass 0x%x opt-type 0x%x data "0x%s" unknown {%slimit rate %s%llu/%slimit rate %s%llu %s/%squota %s%llu %ssrc/tcpopt.c%s:%u: Memory allocation failure src/utils.csize != 0nmemb != 0BUG: missing type mapping s != NULLexpr_value(low)->len / 8 > 0%s:%d: json_pack failure (%s) {s:{s:s}}{s:s, s:s, s:s}{s:s, s:s}{s:s, s:i, s:i}offset{s:o}{s:s}dir{s:s+}{s:i, s:i, s:i}tcp option{s:i}dccp optionip optionsctp chunkmode{s:{s:s, s:i, s:i}}modwarning: expr ops %s have no json callback {s:{s:s, s:o, s:o}}right{s:[o, o]}@s+{s:{s:o, s:i}}[o, o]vmap{s:{s:o, s:o}}BUG: Unknown verdict %d. target{s:{s:o}}{s:n}jhashseedwarning: stmt ops %s have no json callback timeoutexpirescomment{s:s, s:s, s:s, s:I}rule without statements?! {s:s, s:s, s:i, s:s}prio[o, s]devsrc-ipv4src-ipv6dst-ipv4dst-ipv6{s:I, s:I}{s:I, s:I, s:b}invusedcontext{s:s, s:o, s:s}{s:o, s:s, s:o}{s:o, s:I, s:I, s:I, s:s}sizerate{s:I, s:s}perrate_unitburstburst_unitmss{s:i, s:i}wscale{s:i, s:o, s:o, s:i, s:i, s:i, s:i}toserspanindex{s:i, s:s, s:i}hwidBUG: Unknown tunnel erspan version %d gbpopt-typeclass{s:i, s:i, s:s}{s:s, s:i}{s:s, s:s, s:I}typeofmemoryinterval : %s%s%spolicy %s%s%s%ssize %u%s# count %u%s%sflags %sconstant%sdynamic%sinterval%stimeout%s%sauto-merge%s%s%sgc-interval %s%scomment "%s"%s%s%selements = # Warning: table %s %s was created by a newer version of nftables? Content may be incomplete! table %s %s { progname %s flags comment "%s" {s:s, s:s, s:s, s:o, s:I}iintervaldynamicgc-intervalauto-mergesym->refcnt == 1e1->etype == EXPR_VALUEe2->etype == EXPR_VALUEtmp > 0e2->len / 8 > 0stmt->expr == this(expr_value(end))->etype == EXPR_CONCAT(expr_value(start))->etype == EXPR_CONCATr1->len / 8 > 0r2->len / 8 > 0str_len > 0metainfo{s: {s:s, s:s, s:i}}json_schema_versionCommodore Bullmoose #7release_name1.1.6nftablestable %s %s mp-capablemp-joindssadd-addrremove-addrmp-priomp-failmp-fastclosemp-tcprstmptcp option subtypefastopenkindmptcpsubtypemd5sigtsvaltsecrmaxsegnopeol13reqidpathwatcheroptstripemergalertcriterrwarnnoticedebugaudittransparentwildcardcgroupv2ct helperct timeoutct expectationrawmangledstnatsecuritysrcnatflow{s:{s:s, s:s+}}{s:{s:I, s:I}}{s:{s:I}}{s:{s:s, s:s}}looseskipspnumct count{s: {s:o, s:o}}{s:o, s:o}val_unitused_unit{s:I, s:I, s:s}snaplenqueue-thresholdalltcp sequencetcp optionsip optionsfully-randompersistentnetmaptype_flagstcp reseticmpxbypassfanout{s:s, s:o, s:s+}{s:s, s:o, s:o, s:s+}{s:o, s:o, s:i}{s:I}[o]src/parser_json.cMalformed object (too many properties): '%s'.Expecting string or array in '%s' property.Invalid flag in '%s' property array at index %zu.Invalid payload base '%s'.Payload length must be between 0 and %lu, got %dUnknown payload protocol '%s'.Unknown %s field '%s'.Invalid payload expression properties.Unknown payload tunnel protocol '%s'.option length must be between 0 and %lu, got %dsack%uUnknown tcp option name '%s'.Unknown tcp option field '%s'.Invalid tcp option expression properties.Expected concatenation, got %sConcatenation with %d elements is illegalInvalid log level '%s'.empty interface nameDevice name %s too longInvalid device at index %zu.arrayrealtruefalsenullUnknown constant '%s'.%lldUnexpected JSON type %s for immediate value.List expression only allowed on RHS or in statement expression.List expression not allowed as primary expression.Parsing list expression item at index %zu failed.Boolean values not allowed in this context.STMTPRIMARYDTYPESET_RHSExpression type %s not allowed in context (%s).Unknown expression type '%s'.[o, o!]Invalid set elem at index %zu.Invalid counter reference.{s:b}Invalid quota reference.Invalid limit reference.Invalid secmark reference.Invalid tunnel reference.Invalid synproxy mss value '%d'Invalid synproxy wscale value '%d'Invalid synproxy referenceInvalid ct helper reference.Invalid ct timeout reference.Invalid ct expectation reference.Invalid queue num.Invalid datatype '%s'.Invalid datatype at index %zu.Invalid set datatype.Illegal TCP optstrip argumentIllegal reject expr.Unexpected concat object type %s.Parsing expr at index %zd failed.Value of add command must be object (got %s instead).Create command not available for rules.Unknown object passed to add command.Value of list command must be object (got %s instead).Unknown object passed to list command.chainsmapscountersquotasct helperstunnelslimitsrulesetmetersflowtablessecmarksValue of reset command must be object (got %s instead).Unknown object passed to reset command.rulesValue of flush command must be object (got %s instead).Unknown object passed to flush command.syntax error, unexpected %sInvalid osf ttl option '%s'.Invalid osf key value.Invalid socket key value.Unknown ip option name '%s'.Unknown ip option field '%s'.Unknown sctp chunk field '%s'.Unknown sctp chunk name '%s'.Unknown dccp option type '%d'.Unknown %s field %s.Invalid exthdr protocol '%s'.Unknown ct key '%s'.Invalid direction '%s'.Direction not supported by CT key '%s'.Unknown numgen mode '%s'.Unknown hash type '%s'.Invalid jhash expression.fib: need either saddr or daddrfib: saddr and daddr are mutually exclusivefib: iif and oif are mutually exclusiveInvalid fib result '%s'.Invalid binop type '%s'.Failed to parse LHS of binop expression.Failed to parse RHS of binop expression.{s:o, s:i}Invalid address in prefix expr.Invalid low value in range expression.Invalid high value in range expression.Unknown verdict '%s'.Illegal map expression key.Illegal map expression data.Illegal vmap statement.unsupported xtables compat expression, use iptables-nft with this rulesetUnknown statement object '%s'.Unexpected object type in stmtParsing set statements array at index %zd failed.Unsupported set statements array at index %zd failed.{s:o, s:o, s:s}Invalid relational op '%s'.Invalid LHS of relational.Invalid RHS of relational.Invalid mangle statement keyInvalid mangle statement valueInvalid mangle statement key expression type.Unknown flow offload statement op '%s'.Illegal flowtable reference in flow offload statement.Illegal dup addr arg.Illegal dup dev.Unknown set statement op '%s'.Illegal set statement element.Illegal set reference in set statement.{s:s, s:o, s:o, s:s}Unknown map statement op '%s'.Illegal map statement element.Illegal map reference in map statement.{s:s, s:o, s:o}Invalid meter key.Invalid meter statement.Invalid family '%s'.Unknown rt key '%s'.Unknown xfrm key '%s'.Invalid spnum'%d'.Invalid fwd dev value.Invalid fwd addr value.Unknown nat type '%s'.Invalid nat addr.Invalid nat port.Invalid addr.Invalid port.Either name or handle required to delete a table.Unknown family '%s'.Either name or handle required to delete a chain.{s:s, s:s, s:i}Invalid chain hook '%s'.Invalid chain dev.Unknown policy '%s'.Value of property "expr" must be an array.Unexpected expr array element of type %s, expected object.Parsing expr array at index %zd failed.Either name or handle required to delete a set.Invalid set type.Invalid map type '%s'.performanceUnknown set policy '%s'.Invalid set flags in set '%s'.Invalid set elem expression.{s:s, s:s, s:s, s:o}Invalid set.Either name or handle required to delete a flowtable.Invalid flowtable hook '%s'.Invalid flowtable dev.Either name or handle required to delete an object.Invalid secmark context '%s', max length is %zu.Invalid CT helper type '%s', max length is %zu.Invalid ct helper protocol '%s'.Invalid ct helper l3proto '%s'.Invalid ct timeout protocol '%s'.Invalid ct timeout l3proto '%s'.Invalid ct timeout policy.Invalid ct timeout policy value for '%s'.Invalid ct expectation l3proto '%s'.Invalid ct expectation protocol '%s'.Invalid erspan version %uBUG: Invalid CMD '%d' Handle is required when replacing a rule.Listing ct helpers requires table reference.{s:{s:s, s:s, s:s, s:s}}newnameValue of property "nftables" must be an array.Unexpected command array element of type %s, expected object.Schema version %d not supported, maximum supported version is %d Metainfo verification failed.Parsing command array at index %zd failed.You can only specify this once. This statement is duplicated.Cannot create new %s section inside another tunnelinterface name too longStack nowsyntax errorsyntax error, unexpected %s, expecting %ssyntax error, unexpected %s, expecting %s or %ssyntax error, unexpected %s, expecting %s or %s or %ssyntax error, unexpected %s, expecting %s or %s or %s or %s"end of file""invalid token""junk""CRLF line terminators""newline""colon""semicolon""comma"".""==""!=""<"">"">=""<=""<<"">>""&""^""!""/""*""-""@""vmap""+""include""define""redefine""undefine""fib""check""socket""transparent""wildcard""cgroupv2""tproxy""osf""synproxy""mss""wscale""typeof""hook""hooks""device""devices""table""tables""chain""chains""rule""rules""sets""set""element""map""maps""flowtable""handle""ruleset""trace""path""inet""netdev""add""update""replace""create""insert""delete""get""list""reset""flush""rename""describe""import""export""destroy""monitor""all""accept""drop""continue""jump""goto""return""to""constant""interval""dynamic""auto-merge""timeout""gc-interval""elements""expires""policy""memory""performance""size""flow""offload""meter""meters""flowtables""number""string""quoted string""string with a trailing asterisk""ll""nh""th""bridge""ether""saddr""daddr""type""vlan""id""cfi""dei""pcp""arp""htype""ptype""hlen""plen""operation""ip""version""hdrlength""dscp""ecn""length""frag-off""ttl""tos""protocol""checksum""ptr""value""lsrr""rr""ssrr""ra""icmp""code""seq""gateway""mtu""igmp""mrt""options""ip6""priority""flowlabel""nexthdr""hoplimit""icmpv6""param-problem""max-delay""taddr""ah""reserved""spi""esp""comp""flags""cpi""port""udp""sport""dport""udplite""csumcov""tcp""ackseq""doff""window""urgptr""option""echo""eol""mptcp""nop""sack""sack0""sack1""sack2""sack3""sack-permitted""fastopen""md5sig""timestamp""count""left""right""tsval""tsecr""subtype""dccp""vxlan""vni""gre""gretap""geneve""sctp""chunk""data""init""init-ack""heartbeat""heartbeat-ack""abort""shutdown""shutdown-ack""error""cookie-echo""cookie-ack""ecne""cwr""shutdown-complete""asconf-ack""forward-tsn""asconf""tsn""stream""ssn""ppid""init-tag""a-rwnd""num-outbound-streams""num-inbound-streams""initial-tsn""cum-tsn-ack""num-gap-ack-blocks""num-dup-tsns""lowest-tsn""seqno""new-cum-tsn""vtag""rt""rt0""rt2""srh""seg-left""addr""last-entry""tag""sid""hbh""frag""reserved2""more-fragments""dst""mh""meta""mark""iif""iifname""iiftype""oif""oifname""oiftype""skuid""skgid""nftrace""rtclassid""ibriport""obriport""ibrname""obrname""pkttype""cpu""iifgroup""oifgroup""cgroup""time""classid""nexthop""ct""l3proto""proto-src""proto-dst""zone""direction""event""expectation""expiration""helper""label""state""status""original""reply""counter""name""packets""bytes""avgpkt""last""never""tunnel""erspan""egress""ingress""gbp""class""opt-type""counters""quotas""limits""tunnels""synproxys""helpers""log""prefix""group""snaplen""queue-threshold""level""limit""rate""burst""over""until""quota""used""secmark""secmarks""second""minute""hour""day""week""reject""with""icmpx""snat""dnat""masquerade""redirect""random""fully-random""persistent""queue""num""bypass""fanout""dup""fwd""numgen""inc""mod""offset""jhash""symhash""seed""position""index""comment""xml""json""vm""notrack""exists""missing""exthdr""ipsec""reqid""spnum""in""out""xt"'=''{''}''('')''|''$''['']'$acceptstmt_separatoropt_newlineclose_scope_ahclose_scope_arpclose_scope_atclose_scope_compclose_scope_ctclose_scope_counterclose_scope_lastclose_scope_dccpclose_scope_destroyclose_scope_dstclose_scope_dupclose_scope_espclose_scope_ethclose_scope_exportclose_scope_fibclose_scope_fragclose_scope_fwdclose_scope_greclose_scope_hashclose_scope_hbhclose_scope_ipclose_scope_ip6close_scope_vlanclose_scope_icmpclose_scope_igmpclose_scope_importclose_scope_ipsecclose_scope_listclose_scope_limitclose_scope_metaclose_scope_mhclose_scope_monitorclose_scope_natclose_scope_numgenclose_scope_osfclose_scope_policyclose_scope_quotaclose_scope_queueclose_scope_rejectclose_scope_resetclose_scope_rtclose_scope_sctpclose_scope_sctp_chunkclose_scope_secmarkclose_scope_socketclose_scope_tcpclose_scope_tproxyclose_scope_typeclose_scope_thclose_scope_udpclose_scope_udpliteclose_scope_logclose_scope_synproxyclose_scope_tunnelclose_scope_xtcommon_blocklinebase_cmdadd_cmdreplace_cmdcreate_cmdinsert_cmdtable_or_id_specchain_or_id_specset_or_id_specobj_or_id_specdelete_cmddestroy_cmdget_cmdlist_cmd_spec_tablelist_cmd_spec_anylist_cmdbasehook_device_namebasehook_specreset_cmdflush_cmdrename_cmdimport_cmdexport_cmdmonitor_cmdmonitor_eventmonitor_objectmonitor_formatmarkup_formatdescribe_cmdtable_optionstable_flagstable_flagchain_block_allocchain_blocksubchain_blocktypeof_verdict_exprtypeof_data_exprprimary_typeof_exprset_block_alloctypeof_key_exprset_blockset_block_exprset_flag_listset_flagmap_block_allocct_obj_type_mapmap_block_obj_typemap_block_obj_typeofmap_block_data_intervalmap_blockset_mechanismset_policy_specflowtable_block_allocflowtable_blockflowtable_exprflowtable_list_exprflowtable_expr_memberdata_type_atom_exprdata_type_exprobj_block_alloccounter_blockquota_blockct_helper_blockct_timeout_blockct_expect_blocklimit_blocksecmark_blocksynproxy_blocktype_identifierprio_specextended_prio_nameextended_prio_specint_numdev_specflags_specpolicy_exprchain_policytime_spectime_spec_or_num_sfamily_specfamily_spec_explicitchain_specchainid_specchain_identifiersetid_specset_identifierflowtable_specflowtableid_specflowtable_identifierobj_specobjid_specobj_identifierhandle_specposition_specindex_specrule_positionruleid_speccomment_specruleset_specrule_allocstmt_liststateful_stmt_listobjref_stmt_counterobjref_stmt_limitobjref_stmt_quotaobjref_stmt_synproxyobjref_stmt_tunnelobjref_stmt_ctobjref_stmtstateful_stmtxt_stmtchain_stmt_typechain_stmtverdict_stmtverdict_map_stmtverdict_map_exprverdict_map_list_exprverdict_map_list_member_exprct_limit_stmt_allocconnlimit_stmtct_limit_argscounter_stmtcounter_stmt_alloccounter_argscounter_arglast_stmt_alloclast_stmtlast_argslog_stmtlog_stmt_alloclog_argslog_arglevel_typelog_flagslog_flags_tcplog_flag_tcplimit_stmt_alloclimit_argsquota_modequota_unitquota_usedquota_stmt_allocquota_stmtquota_argslimit_modelimit_burst_pktslimit_rate_pktslimit_burst_byteslimit_rate_byteslimit_bytestime_unitreject_stmtreject_stmt_allocreject_with_exprreject_optsnat_stmtnat_stmt_alloctproxy_stmtsynproxy_stmtsynproxy_stmt_allocsynproxy_argssynproxy_argsynproxy_configsynproxy_objsynproxy_tssynproxy_sackprimary_stmt_exprshift_stmt_exprand_stmt_exprexclusive_or_stmt_exprinclusive_or_stmt_exprbasic_stmt_exprconcat_stmt_exprmap_stmt_expr_setmap_stmt_exprprefix_stmt_exprrange_stmt_exprmultiton_stmt_exprnat_stmt_argsmasq_stmtmasq_stmt_allocmasq_stmt_argsredir_stmtredir_stmt_allocredir_stmt_argdup_stmtfwd_stmtnf_nat_flagsnf_nat_flagqueue_stmtqueue_stmt_compatqueue_stmt_allocqueue_stmt_argsqueue_stmt_argqueue_exprqueue_stmt_expr_simplequeue_stmt_exprqueue_stmt_flagsqueue_stmt_flagset_elem_expr_stmtset_elem_expr_stmt_allocset_stmtset_stmt_opmeter_stmtmatch_stmtvariable_exprset_ref_exprset_ref_symbol_exprinteger_exprselector_exprprimary_exprfib_exprfib_resultfib_flagfib_tupleosf_exprosf_ttlshift_exprand_exprexclusive_or_exprinclusive_or_exprbasic_exprconcat_exprprefix_rhs_exprrange_rhs_exprmultiton_rhs_exprset_exprset_list_exprset_list_member_exprmeter_key_exprmeter_key_expr_allocset_elem_exprset_elem_key_exprset_elem_expr_allocset_elem_optionsset_elem_time_specset_elem_optionset_elem_expr_optionsset_elem_stmt_listset_elem_stmtset_elem_expr_optionset_lhs_exprset_rhs_exprinitializer_exprcounter_configcounter_objquota_configquota_objsecmark_configsecmark_objct_obj_typect_cmd_typect_l4protonamect_helper_configtimeout_statestimeout_statect_timeout_configct_expect_configct_obj_alloclimit_configlimit_objerspan_blockerspan_block_allocerspan_configgeneve_blockgeneve_block_allocgeneve_configvxlan_blockvxlan_block_allocvxlan_configtunnel_configtunnel_blocktunnel_objrelational_exprlist_rhs_exprshift_rhs_exprand_rhs_exprexclusive_or_rhs_exprinclusive_or_rhs_exprbasic_rhs_exprconcat_rhs_exprboolean_keysboolean_exprkeyword_exprprimary_rhs_exprrelational_opverdict_exprchain_exprmeta_exprmeta_keymeta_key_qualifiedmeta_key_unqualifiedmeta_stmtsocket_exprsocket_keytunnel_keytunnel_exproffset_optnumgen_typenumgen_exprxfrm_spnumxfrm_dirxfrm_state_keyxfrm_state_proto_keyxfrm_exprhash_exprnf_key_protort_exprrt_keyct_keyct_key_dirct_key_proto_fieldct_key_dir_optionalsymbol_stmt_exprlist_stmt_exprpayload_stmtpayload_exprpayload_raw_lenpayload_raw_exprpayload_base_speceth_hdr_expreth_hdr_fieldvlan_hdr_exprvlan_hdr_fieldarp_hdr_exprarp_hdr_fieldip_hdr_exprip_hdr_fieldip_option_typeip_option_fieldicmp_hdr_expricmp_hdr_fieldigmp_hdr_exprigmp_hdr_fieldip6_hdr_exprip6_hdr_fieldicmp6_hdr_expricmp6_hdr_fieldauth_hdr_exprauth_hdr_fieldesp_hdr_expresp_hdr_fieldcomp_hdr_exprcomp_hdr_fieldudp_hdr_exprudp_hdr_fieldudplite_hdr_exprudplite_hdr_fieldtcp_hdr_exprinner_inet_exprinner_eth_exprinner_exprvxlan_hdr_exprvxlan_hdr_fieldgeneve_hdr_exprgeneve_hdr_fieldgre_hdr_exprgre_hdr_fieldgretap_hdr_exproptstrip_stmttcp_hdr_fieldtcp_hdr_option_kind_and_fieldtcp_hdr_option_sacktcp_hdr_option_typetcpopt_field_sacktcpopt_field_windowtcpopt_field_tsopttcpopt_field_maxsegtcpopt_field_mptcpdccp_hdr_exprdccp_hdr_fieldsctp_chunk_typesctp_chunk_common_fieldsctp_chunk_data_fieldsctp_chunk_init_fieldsctp_chunk_sack_fieldsctp_chunk_allocsctp_hdr_exprsctp_hdr_fieldth_hdr_exprth_hdr_fieldexthdr_exprhbh_hdr_exprhbh_hdr_fieldrt_hdr_exprrt_hdr_fieldrt0_hdr_exprrt0_hdr_fieldrt2_hdr_exprrt2_hdr_fieldrt4_hdr_exprrt4_hdr_fieldfrag_hdr_exprfrag_hdr_fielddst_hdr_exprdst_hdr_fieldmh_hdr_exprmh_hdr_fieldexthdr_exists_exprexthdr_keyStarting parse Entering state %d Stack size increased to %ld Reading a token Now at end of input. Next token isShiftingReducing stack by rule %d (line %d): $%d = ./../File not found: %sredefinition of symbol '%s'too many levels of nestingunknown table option %ssrc/parser_bison.y((yyvsp[-1].expr))->etype == EXPR_LIST((yyval.chain)->dev_expr)->etype == EXPR_LISTmap data type '%s' lacks typeof serializationprimary expression type '%s' lacks typeof serializationunknown chain hookunknown datatype %sunknown chain type%s + %llu%s - %lluyou cannot set chain policy twicecomment too long, %d characters maximum allowed(yyvsp[-1].stmt)->type == STMT_CONNLIMIT(yyvsp[-2].stmt)->type == STMT_CONNLIMIT(yyvsp[-2].stmt)->type == STMT_COUNTER(yyvsp[-2].stmt)->type == STMT_LASTinvalid log level(yyvsp[-3].stmt)->type == STMT_LIMITpacket limit burst must be > 0(yyvsp[-4].stmt)->type == STMT_QUOTAwrong rate format, expecting {bytes,kbytes,mbytes}/{second,minute,hour,day,week}Wrong time format, expecting second, minute, hour, day or weekunknown identifier '%s'; did you mean identifier '%s'?unknown identifier '%s'invalid ttl optioninvalid context '%s', max length is %u You can only specify this once. This statement is already set for %s.invalid name '%s', max length is %u (yyvsp[-2].obj)->tunnel.type == TUNNEL_ERSPAN(yyvsp[-6].obj)->tunnel.type == TUNNEL_GENEVEInvalid data array %s (yyvsp[-2].obj)->tunnel.type == TUNNEL_VXLANraw payload length %lu exceeds upper limit of %luraw payload length cannot be 0unknown raw payload baseunknown ip option type/fieldCould not find a tcp option templateexthdr_protocols[proto]-> $$ =Error: discardingError: poppingmemory exhaustedCleanup: discarding lookaheadCleanup: poppingroute--scanner backing up --accepting rule at line %ld ("%s") --accepting default rule ("%s") --(end of buffer or a NUL) --EOF (start condition %d) flex scanner jammedfatal flex scanner internal error--no action foundn > 0an >= bn0 <= i && i <= und > 0u1 >= GMP_LIMB_HIGHBITu > 0(r << (GMP_LIMB_BITS - binv->shift)) == 0gmp_default_realloc: Virtual memory exhausted.size > 0gmp_default_alloc: Virtual memory exhausted. %scnt >= 1cnt < GMP_LIMB_BITS__cy == 0limb_index < dnvc == 00123456789abcdefghijklmnopqrstuvwxyzsize > 0 || u->_mp_size == 0limb != 0i == un/etc/nftables/osf/pf.osOpening OS signature file '%s' Failed to open file '%s' Loading '%s'. Wrong input line '%s': cnt: %d, must be 8, i: %d, must be %d. %.*s,%.*sout of dynamic memory in yyensure_buffer_stack()start-condition stack underflowout of memory expanding start-condition stackout of dynamic memory in yy_create_buffer()fatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowinput in flex scanner failedout of dynamic memory in yy_get_next_buffer()Include nested too deeply, max %u levelsFailed to glob the pattern %sToo long file path "%s/%s" tokennterm%s %s (: .BUG: Unknown statement type %d %s%s%scomment "%s"/proc/%lu/fd//proc/%d/fd/%ssocket:[%lu]/proc/%lu/stat%*u (%m[^)]payload->etype == EXPR_PAYLOADunknown expression type '%s'family %d (((e->len) + (8) - 1) / (8)) > 0%s %s @%s + %llu - %lluBUG: Unknown expression type %d %s: range argument not supportedconflicting statementsBUG: invalid byte order conversion %u => %u %-30s %20llu %-30s 0x%.*llx DeletingBUG: key must be RANGE_VALUE, not %s !next_key || next_key->etype == EXPR_RANGE_VALUEset->key->len / 8 > 0(dev_expr)->etype == EXPR_SET(ctx->purge)->etype == EXPR_SETtcpoptunsupportedstmt_evaluate_verdictstmt_evaluate_payloadstmt_evaluate_meterstmt_evaluate_nat_mapstmt_evaluatereject_payload_gen_dependency_familystmt_reject_gen_dependencycannot determine ip protocol version, use "ip nexthop" or "ip6 nexthop" insteadexpr_evaluate_prefixexpr_evaluate_unaryexpr_evaluate_binopexpr_evaluate_concatexpr_evaluate_listexpr_evaluate_setmapping_expr_expandexpr_evaluate_mapexpr_evaluateexpr_evaluate_relational__binop_transferbinop_transfer_handle_lhsbinop_transfer_onebinop_can_transfer__mapping_expr_expandmap_set_concat_infoset_automergesetelem_overlapset_overlapinterval_set_evallist_member_evaluateconstant_binop_simplifyproto_ctx_find_conflictpayload_gen_icmp_dependency__expr_evaluate_payloadexpr_evaluate_bitsll_conflict_resolution_gen_dependencyexpr_evaluate_stringbyteorder_conversionerec_printerec_add_locationdatatype_freeinet_service_type_parseip6addr_type_parseipaddr_type_parsempz_get_be32lladdr_type_printstring_type_printmpn_set_str_othermpz_set_strexpr_chain_exportsymbolic_constant_printsymbol_parsedatatype_printnft_cmd_collapse_elemsft_cache_findobj_cache_findset_cache_findlist_rule_cbchain_cache_findtable_cache_findobj_filter_setupdo_command_insertdo_command_replacedo_command_deletedo_command_getdo_command_flushdo_command_renamedo_commandipopt_init_rawsetelem_keysegtree_needs_first_segmentset_to_intervalsautomerge_delete__adjust_elem_left__adjust_elem_rightsplit_rangesetelem_delete__set_deleteset_deletesetelem_expr_to_rangeset_to_rangeinterval_expr_keyremove_overlapping_rangesetelem_automergeset_sort_splicemerge_rangesmpz_importmpz_get_be16mpz_get_uint8mpz_get_uint16mpz_get_uint32mpz_get_uint64fib_expr_allocsctp_chunk_init_rawexthdr_init_rawrange_expr_value_highrange_expr_value_lowset_expr_removeset_expr_add__set_expr_addset_expr_allocset_expr_set_typeset_expr_destroyset_expr_clonecalculate_delimset_expr_printlist_expr_to_binoplist_expr_addlist_expr_alloclist_expr_destroylist_expr_clonelist_expr_printconcat_expr_addconcat_expr_allocconcat_expr_build_udataconcat_expr_cloneconcat_expr_printconcat_expr_destroyrelational_expr_pctx_updateflag_expr_allocbitmask_expr_to_binopsconstant_range_expr_print_oneconstant_expr_spliceconstant_expr_allocvariable_expr_destroyvariable_expr_cloneexpr_cmpexpr_freeexpr_getexpr_family_infercmd_evaluate_listevaluate_device_exprset_type_compatibleset_evaluateset_expr_evaluate_concatsetelem_evaluatemnl_nft_obj_addnft_dev_arraynft_dev_addmeta_key_parseexpr_msort_valueconcat_expr_msort_valueload_cmdline_varsstmt_verdict_eqmerge_concat_stmts_vmapmerge_stmts_vmapmerge_concat_natmerge_natrule_build_stmt_matrix_stmtsobj_type_to_cmd$ "table_getcmd_evaluate_addcmd_evaluate_deletecmd_evaluate_getcmd_evaluate_resetcmd_evaluate_flushcmd_evaluate_rename(@ Pm[I@I$I @$Icmd_evaluatenetlink_parse_set_exprnetlink_parse_concat_keynetlink_parse_inner netlink_parse_concat_exprnetlink_list_setelemsnetlink_parse_concat_elemnetlink_parse_interval_elemnetlink_delinearize_setelemconcat_elem_exprnetlink_delinearize_setjBl(__netlink_gen_concat_expand__netlink_gen_concatnetlink_gen_chainnetlink_gen_range_value__netlink_gen_data__netlink_gen_concat_keynetlink_gen_concat_keynetlink_gen_keynetlink_gen_prefixnetlink_gen_rangenetlink_gen_constant_data__netlink_gen_concat_datanetlink_export_padnetlink_gen_raw_dataalloc_nftnl_setelemtrace_gen_stmtsnetlink_event_range_cacheproto_ctx_updatepayload_expr_expandstmt_payload_expr_trimpayload_expr_trimpayload_expr_completeget_stacked_descicmp_dep_type_matchicmp_dep_to_typepayload_expr_pctx_updaterule_optimize_printstmt_nat_exprbuild_verdict_mapmerge_concat_stmts__merge_concatmerge_expr_stmtsmerge_vmapmerge_verdict_stmtsmerge_stmts__stmt_type_eqnetlink_gen_nat_stmtnetlink_gen_stmtnat_addrlennetlink_gen_stmt_statefulnetlink_gen_objref_stmtnetlink_gen_unary_opnetlink_gen_unarynetlink_gen_bitwise_boolnetlink_gen_concatnetlink_gen_mapnetlink_gen_exprnetlink_gen_bitwise_mask_xornetlink_gen_rangenetlink_gen_lookupnetlink_gen_relationalnetlink_gen_cmp_opnetlink_gen_inner_expr__release_register__get_registerexpr_postprocess_concatrelational_binop_postprocess__expr_postprocess_stringstring_wildcard_expr_allocexpr_postprocess_valueexpr_postprocess__binop_postprocessbinop_adjustbinop_adjust_onepayload_match_expandpayload_icmp_checkpayload_match_postprocessdatatype_jsonsymbolic_constant_jsonverdict_expr_jsonlist_expr_jsonset_expr_jsonconcat_expr_jsontunnel_erspan_print_jsonset_print_jsonxstrdupxmalloc_arraytcpopt_init_rawchain_verdictinterval_map_decomposeinterval_to_stringadd_intervalconcat_expr_removeconcat_range_aggregateexpr_to_set_elemget_set_interval_findexpr_valueconstant_expr_joinpayload_do_mergecmd_alloc_obj_ctget_set_intervalsalloc_setelem_cacheget_set_decomposenetlink_get_setelemdo_command_list_jsondo_command_listflowtable_freeflowtable_getflowtable_allocobj_type_nameobj_freeobj_getobj_allocdo_command_add__do_add_elementscmd_freecmd_alloctable_freechain_freechain_getscope_releaserule_freerule_allocdo_set_printset_freeset_getset_alloc json_parse_cmd_add_objectparse_familyjson_unpack_stmtboolean_type_jsonstring_type_json&kIE6REv|%B eGGHm6N0H8B66}={UVeBB:$IIKnprs_vxI{|w#II%+)*56 p6>  BD "({Xj<k;)RS[dk^JXZNXY_]32^_klm`aklmk}XlQRqk+AX]]`` ]rj;k*>6/0klm6!ILB*f B>cXfV]klm247jk[k>CkC<3Gkw1kk t6 b6&']xwB_='EB';JxZkx;R"#$Kn-prxc{* +Ck;kw( l"nk&"#WuuX+Z ak=;-H} W kZ}+6STU[)BjklxfExgh}' "x[0~ )}-y/Y*+-yyiiy}i y $6!Zy#nBWXYrdx{;}Xa}u m8 8k}|'ck QR U+.$x-Vx}k-xDwrf} wjkl8>{8k-* k]=x ms!]X] L$8uX%*CbCw8(k)k)k(5B%-GIrstuC8{XBZZi Gj-Ma 6j.Vy BWXYji  ff% k( y"-<6 R{{ x}87"BkfgG() a"]` "u|8&X8 _sy  4 )f )st'{()*+,tu8 Q)q +8.jijL  ?@TUVWXrEFH*+=Qm+AB.F=~A|q=>?@Ax{66-xxxEFf(f-EFjk; x{ujk{BkxGJu*x/w-i fuif\]y /+./{{A|stk+EF.jEF~jk~&|u567b(dbjisCn i{ xyst~Xyf+i(.--jk{|sty346678kbc66 wy w6q`ust(j6(-r]x-jXfdstjklByBGj{G?j-.12jjk-rjjjXXghi(ky|l} j jja(xu|wQde/1[\]68 j<yklm12j efghi(  x/0xx(egy-k(-noppxrsWXYh67YZ[D]FxH*JxMyjGuwxyzX CjjdDxFHJkMjjddxj-dj-irry fyjjjjcj{j jxxxx j6-KLMNO602D45DB<={j]dX d X)*+,-ir{jx_x-x, yj-X4+kx/C1kGujj   ?@HI%^  d $%&'1%%j)-fj1kw-11k3yfk$%&'jqwww-nj1j{jMNOjjjjy*jXjddMNOdx { +rk rjj5wjyyl<x/xxx%kxx?@1xx+xdyxxdxxkrxxo ryx(x y jkjtukwjz qjw ij 5{jjjyjk.-,N/Di-!  "y w x* 4d%;Z '%r11q-efXstGGXX %$ %drpkk1r|1IrNe-b V]WdWX 6kyz{B% 1st|}~i y           X     %- * *      5 1: ? ~ G I J K L M N O P Q R S T U XXc N O P kkt u v ud r* XXikJkvy|fRSTUVW{ceukvwx zX}~ 'klm/1k3* 678:* %1u  stX* * kqOPQ  aktu%zDFHJM8 9:( * i%y8*+,*st w(i/y* BGI(i%&yiwy'*/X1678:jk$%&'-1\]^_ad-MNOu $./013Dfrt{i{0Cy * ii,yy((-/B*BGGI i \]^_yad%u'816d8:*PQrw(*jt\]^_ad]^_audjuw         (-BG%1N O P i-'y(/1/3678:(?@-BGI(-BGklnyBiGq{yi yiyJMNOPQRZ\]^_`abcefghikoqstuvwz|DEHI('X//13678:kBnGIidprswn !"#$%&')*+,-! %&'w.6ABFIRSTUVW%a1eg(jklm/pruv{BGpIrv{0,     i(y-/<BGMNPSTUVZ]^_`deimpqstvwxyz}!X%&'.6knABFIRSTUVWIaOegjklmpruv{klmrv{ !"#$%&'*+, I     (-/#&'<-BGMNPSTUVZ^_`deSTimpqvxyz}!%&'}.6kABFIRSTUVWptrauveg{jklmpruv{          IMN(W-/<BqGMNPSTUVZ^_`deimpqvxyz}!%&'.6ABFIRSTUVWprva{egjklmpruv{*     ]^_ad(w-/u<BGMNPSTUVZ^_`deimpqvxyz}!%&'6ABFIRSTUVW*egjklmprv{0(-]^_adBGuiiyy'168:     k(-/<BGMNPSTUV(Z-^_`dempqBvGxyz}stwi!&y     IOXZ(jklm/prvI{MNBWGIqiy!"#$%&'*+,'I,/0125689:<     eghi#&'-/!&=MNSTI`Odepnoqz}jklmprv{(/6789:BGIJ     #&']-/!&stwMNSTI`Odenoqz}jklmprv{ !"#$%&'*+,I     #&'-/!&MNSTI`Odenoqz}jklmprv{     #&'-/!&MNSTI`Odenoqz}jklmprv{      IO#&'-/jklmrv{MNST`denoqz}IOjklmrv{#&'-IOSTVjklmrnov{xz}#&'-STVInoOxz}jklmrv{#&'-STVnoz}!%&'6AB#F&'I-RSTUVWegjklmprSTvV{noxz}     (-/!&<BGMNPSTUVZI^_`Odempqvxz}jklmprv{     #&'-/!&MNST`denoqz}jklmprv{!&     jklmprv/{MN`depqxz}     IO/jklmrvMN{`depqz}!&'Zkprv{#&'-STVnoxz}     !(&/BGIMNZ`depqprv{     /MN`'de/13pq678:?@ACDEFGHIJKLMNOPIORSTUVWkqjklm{rv{IOjklmrv{IO(-/#&'-jklmBrGvI{STVno#z&'}-STVnoz}#&'-STVnoz}$  ? 3 8< )(   > Tu[[[[[[[[[[[pvIy nYPdq 7 zB% j  t5 x  uqq`V"  (k&,w.. 6 >` P[>~p_Xo yxil 0 ! j  ,!!!! P!! K(3 5=*!Qy R!@:^_bkbf$$$$$ !$hR!!!  (p1  (A3d!"-' #$&*,!  8 !!!!n!-O0ry!7P.rw~!!w!H!!!!!Z!!!!u{!!P d$$$$$$$$e%$$ v i= imp jl- 5!! !b b!$57> ]]!!s!JP$e%      W#   W#  V \7=  rw! !qq7 .3! ;ad j  kg  g  5h -''  !   %&(./12 tW#T"  :         +?;AC@W#i   UW'  1 S  \jW#Y^ c h op[v      s;     W*W     x"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTVWXY[cry  !%)-17=AHLT[bls| #'.26<@DHOUVXY\`dhlptx| !%)-15;BHPV^ghklmnopqruvyz{~ (3AKLMNOPQV_ijkr~        ! " % & ' ( ) , - 0 1 4 5 6 7 < A R i w     ! " & 0 1 2 3 7 A B C D H S X Y Z ^ h i j k o y z { |     ! , 2 6 9 ? M R [ \ _ ` c d e h x y | }     # * 1 ? C J N T ` f m s z       " % + 4 5 7 = A D I P V W Z [ f g j p t w *03HIJMNQXY\jqr  !1DJKQRXYZ[\]^_`abcdefijntu{| "&*/6;CHQRXYZ]^bflmpvz} #,789:;<=>?@ABCFGHILjklmpqrstw{~ '(+17;>SW[eilryz{|}"/7?EIMQU\alz #'+12348CIMQX`gosy$+29@CDEFGHILPTX\`fgquy  "=BGMNQUijklosw}~     !"%+,-./289:;<=>?@CGRYZ[\]^_`abcdghijmnopqtz{|}~     $,-08@ADHOPQT[bcdefghijknsx} "',37=>?@CKLOPQRSTUVY_`cijklou{symbol_putsymbol_getexthdr_find_proto'/13678:?@ACDEFGHIJKLMNOPq{(/BGI%lk-%3'/1678:(/BGI3'/13678:(/BGI7',/0125689:<eghi(/6789:BGIJ34678(67G/168<eg1!&jklmprv{     /MN`depqz} "$&(*,.2468CKMOPRTVXZ\^`<jkl<'/13678:(/BGIk] ";gh"#$%'6ABFIRSTUVWeg(-/<BGPSTUVZ^_mvx)*+-./0123456789:>?ABEFHIPQVW`adefgh}~  9wwl)&] "% &] "(((/((/0(] ;&1((/knopst"#$Nstuuwxyzst|}~stwuwu>st!tuw#%')+-:uD "$&(*,./013CKM7u15LuqSUWYQw[]u_kIWqstw!"#$%&'*+,I >wWabatuk&0245<=_jjjX)Afk] )))C)XXXki'5jE@*+CDHG=>?@AJKEFRYEFSXQcIOXZrv{#&'-=STnozopqrstuwxyz{|  ()ijXWXYX[\]| 8 rv{Vz66x(xkxxxxx")l);;;;;-(/ uAk)rr(j;<=j/1EJ~~st bbjs{*xxCxxSx{X{dx6666 6{{{{{{XyxjjjDk.Qr MjjjLKj[]^jR{{XXt| 8XZ=jjj{xx;| {{jyjkxxxxxxjjjxjjxkjjudA?B@>IGHHuFjjststjjcjrxxxxjYj{{]`'(<=j{{{{6{X[-{(BG?AFQW]`'NOk+DZD\k+Tkububub{{{{oopqrjtov{{X X  {{<={jj)y'k'168:(/BGIy'.auy  ')*\]^_aduy',4*]^_uy',+.(yxxx=fjst+y'w0y'[]y'y'Ty'{{x5{{-UVky)KLMNO_jj^_HUbbIb{{{y,yj)!k] "!!!!!wRS  fwbcjkYZ[]4wkwfyyyyyyyyjjyay']dy'uy'jjstjjstjjZ\U{y{O*kj{Xy=mj!!!xk  yyyjwjjlxxx5T{ynxxxxxxxxxx+'Zk(BGIZZjkuxyymxxxyk]  jk3y4ywhynyyyyyyyyyy-. jjyjjjj12jyyywj5j!wZMu<Fv:3N#&+k7h"/01KY[j.lo01V $  sDJOMNHMZ X 23>5HDEF6Wjklmnopqrstuvwxyz{|}~d^ghiq89:&''9:A)*+deHIJXYK=U[p^v_ @3 4 /9k] NG M? L: dF\>?/012L478j?$8'4<J !!3HNVdlq{ ^   *  D 0)D:hn9lL\oCm]@dd_RSL[^UTd! ") HE1p8#a/`Uo* ,0  SmQ?vQ.|^='7!pM.JqwkAV?DEM  !%           !"#$%%%%&'(())*++,,-./01223333334444455555555555555555555555677899:;;<<<=>?@@AABCCDDEFFGGHHIJJKKKKKKLMMMMMNNOOPQRRSSSTTUUVWXYYYZZ[\\]]^^_____`abbccccccccdeeffffffgghiijjjjkklmmnnooooooooooooooopppqqrrsstuuvvwwxyzz{{{||||||||||||||}}~            !!!!!!!!!"##########$%%%%%&''()))*++++,----....//////////////00011223344556677789::::::::::;;;;;;<<<<<============>>?@@ABCCDDDEEEEEEEEEEEEEEEEEEFFFGGGGHHHHHIIIIJJJJJJJJJJJJKKLLLLMNNOOOOOOOOPQQRSSSSTUVWXYYYYZ[[[[[[\]]^_____`aaaaanft_parse   EDHCXZ*A_IJKLMN#/QR    "V   efghijklmnopqr5wxyztuvpqrstuvw!' y^`GFv!&-K`lm] >  ';+P$F,.c(6<t((- "$&'.0/ ?B\`:9rt*A_ y^`<bca =$,3<bcd =$,3O ,P}~84no877 77 7 9:  7675 lijk17}7|56"00000zy7&%3"%FGM?@>HI]BKDEJAC<=[Z\3 N"!.0&&' %sST< =$,3WUvvvbF%% @2  "(,.NOADEL_/ ((k |{uw  9:51(+,XW<-M`qxvvvzFv 7**m &,*!"%' (#$)+84 <9:;=>?@ABCDEFGHIJ[2g~12803{xLOPRQST U9 vs P$x,_3n<U =$,-?A;>T1$%#)*;95012364/QT5yzx !#%(-dZY@An<-M` $,3`  472/301-.5XWYZ`NOPQ]RSTUV^_abcdef7ML\14:;$()"` }cjelpoGB&*%)+5 :8%% 56!K $,@JS<H43:>?5=VXBCHGIaebgi^_`a)*)<Y7[6^/._ON aba}{|KhVWXY) 0,+*" utwv~=QT$,zy|{I3qsEFC 9 b--UVNLPMOKDQR=I87Z[\]^SUWM77/7or*A_rrrrr+(+'^]+\op7n=>@?<0784ZYWesuvwy={ #/-   ~[dpwxkf]mrc7 <RYjhrrrh235[,1PQXLVf |95higzJdf}-M`sxilm)q;<& $,3%$I!Kcd~}.hgnpstqruj}gH#BC DFEGSU7k|{~kjJ"T77}<   =$,3Rml+i  o -47v(RQyikO3-].Mp5edvx->iP&m>j(z{z%'qD22}c~1q.wNlVxa} 6EgP66BD{_c~Ku3%A@@|BN b |9A_ ,  J~b r88ii9;l{UV;<=^"(  .mB"7C5?@k9ZB,#|2,,:#}~_} ~/K`;<= :\V9b9G 9+T@%m5 & : n9o| -6CBC67s  w:,`aBO  c B &rA;- d! 6(P  j EN ^hhO n;>W:h|})9:h(p[\n=}~?:\ kzl,@m66666c6?~@=6*6N *9y Mxz mY  r>EFG@y;{|`:G a QBCIMyb%SLz+YGnng o{ |y( x' E} } 7( )?le,0v) =45:89:;<12 YzV ,yz{Z# f.[JK/L/ 0 34 k#$"*9%:%cE\yFGzY&A67,8H{I|&66666666666n ]t?@(  /0   WXYMwl12$T  )* +34HIg./0@ 6y1yOA DEzR63zYV0QYSD1HIdeg{{|T|L`STUX Y k l  a2 V+=b6f,-./jft{S66l3Ts ( efB 8B g)hijk@AwvBu>? 4'/012;C RahmksD IGJKLM| SbinttM !"#%$5 &-.56*79C K>@ABP bjptc OPQRST0Z1=( &%HIJKL)U(*5+<] =t yE2; PVry:3  &  a' 6 < C  # b"6$A$C,6=F%iiGJKYacirP-7>m&px % 7 4( _  ; ?  @  B * . 2 _ |}C~` a #e ~ g  $i j %m  q&6CIM>?< $ W ,6= &     F&&Jo-7>U|}~e`UGQRrsef L tH uvw[ A5fxyz55)XCA   Wp0ZY[t  1Xu   1  hh2 ) + , 3OPQRSTU8 = E  Rahms} 9 > F  ^ Sbintd f h n o p q r s ,6=w x y z { 4 -7>  u #$ NOPS #%&: 4567BC\]^_`abc DEF(os((:5&&&&&&&;Tcjou& !)*- B555555;5  5dWXYefZ[\]^_`abU ghiCDv c VQ LWMNXYOPQRZ c[\.8?]O^Rfghiku<_(I q&&&&&&&&&&&~ySS `zTYU .8?{V|WX55555555555((((((( ( wx &Z&&5&&5y Tcjouz[Y\]5{|55.8? y  zyYzY{|W{|#$4]%@44CCCGK 4&h(((((((((((44CCCG44CC4CCGC4CCC'4CCC4'( )!"#$%&'*&+,<(( 54CC((( GHVWIXYJKLMZNOPQRS([\TU)*]^+,-pC4_CVWXYZ[\]^_`abc" def  g h GHI(JKLMNOPQRSTU # VWXYZ[\]^_`abcdefgh GHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefgh GHIJKLMNOPQRSTU  VWXVYZW[XY\]Z^_`abcde[\fghJ ]^GHIJKLM NOPQRSTUy_zY{|R  VWoXYZ[\]y^_`abzcYdef{g|h    L  mnopqrstuvwx yz{|!"}~rq    r!" s!"Q!"  F !"#F !"#$h%; $!"#h% $!"#%GHIJKLMNOPQRSTU$<%VWXYZ[\]^_`abcdefgh!"h !"#$h%  !"NOPSC#$%& !"# '(!C")#*+,$ %!"#$%$%}z{w~x|y  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuv     !"#$%&'()*+,-./01246789;>?@CDFGHIJKLMNOPQSUVWXZ\]^_`abdeghijklmnopqrstuxyz|}~  !"$%*+,-0123456789:;<=>?@CDEFGHJKMOPRSTUVWX[^`adeghknprtvxz|}  !$&()*+,-023456789:;<=>?@CEHIJMNPRTUWX[]_djoyrstuvwxyz{|}~ \ ^ \! jk^ #    -&'&'(oNmn" O^ .b z h C D $]%EFW]G)*+, \     ^ JK  r\9 \:\ ]]wx^  ]] y . ]\\E! F^^"/041^#&'c (_v\$%)L^* +,-M&'o m t]/.0]  1C234D\ 56EFz\  ^HIHJIK^JKZQ\234  G56789:;<=z >?^@qAB]PNF ]QRS{|OB > }~: ]]\\789:;L<=\>?@MAB^^]P!QR^S_6 ````````a\b c 6\bbbdbb e # stf]^u! \gv w^c\xyooooooooa:^\o\ ^ oooooo\^]^{|*\~ 6^\ \ ?^\@]\ ^A ]^\\  ^^: \^\< ^   \\^ ^  \\^^ \^ ^\7$\ \ \&^&\8&^1\ ^3^^^\^stu vw\x^y\\\\ ^\3^ ^^\\^ ^ \ ^^s u v\w^xy\ {\ ~^] ] ^ \\^\   \ \{^^ ^\}~ \\\^^\^\> ^^^\\^ ^ \^\^N]U\] ^ ^\ \X\^]Y\] ^]  ^\^ \^\]"\^]\]u^ #^d {%b ^}~$^ (tuZ \v'w{x\+y-)~X \\,^\ /^0^\]\^1 2]^\\;34^^]465 ^6g]^\] {|=\}~P \{| >^B}~\\^C^\N \D\ \^^\H\^\^^L^G^M{|\^O ^}~ ]Q\P^{S\i]G ]T~ eR f\\^6g^ {S \ \}~V ^^{|[T~9 ^\^{|5`\}d\\{f7 \^}~  ^\^^\he^j \r^\^  n\ ^\\zm^   ^s^^v{st u v\w\ x|y{|\}~~^^ |\\6}~^\\ \ > ^^\{ \^^]}~^]^e ^ \ \_ a^8\^\\ :e \f^^\^ga^ ^  ; ;  \\\\\\\ \\ w ^^^^^^\^\^^^\^\\\\\\\^\u n ^ :\^^\ \\\  ^^^ ^\^B ^ ^^^^\\\^ \\\ \> \` ^^: ^\\\^^ ^ ^^\\\\^\^^^ \ \ \\\^\^\^^^ $!\\^ ^"#^^^&%^\^\+\-,\('^^)*.\\\\\\/ ^^\^\\^\\\5\\0^^^^^^ 178:^\^^;^^^6\^^\ @D\\\9?<>^B\>=\\^\^\ ^^^AG  F^CE^^\N^J\^ \\\; H\\IKL\^\\; ^   ^^^P ^\^OM  ^\^^\$RWTU\^\S\V\\^Y\^\ [\\Xe \\^^\^^^\\\^\^\\^^a]^^ _\^b`M ^\^^ ^\^^dc\\ej^fg\ ^k^ha\^ ^ \ni\\ ^l\ \\ \^\m\p^\o ^^\^+^O^\u^ ~^q^\\^xrts^\|z\w^\^\^^}\\\\ ^\ ^\^^ \^^^^^^\\\^\\\\\\\\\ > ; ^8 ^^\ \^^^8 ^^^^^^\^^\\\\\i \\^\\\\^^(e .\ ^^^^^^\^^^\^\\\^\^\ \\^\\^\^"\\ ^\^\^^\^^^\^^ ^^^\\\^ \\ \\^ ^^;  ^\^\\\8 ^^\\^^^^\\ 8 9\^\\\^\ 7^^\$^^^\^(^\\^\\\^\^\\\^\\\\ ^\^^ \^\^^^^^^^\^\^^\\\\\\\^\ \^\ ^\^\\^^^^^p^^^l  \^m^^  \_^\ ^\\\ ms e\  ^f^^(^g ^\\\\\\| \ ^^f \ \g ^^^^^g^^\\\\\\>^\^^ ^  \p\\ \^^^^#^m^\m ^$ \%(^&\\\^\\'\^^^\^^\\ )(!*\3^\"\\^+,\^^\\\ l \\\^-^ ^^\\.^\/^^^30^^^8142\:;657^^\^\9\<\\\\\\\^ \s \=\ ^?^\^ ^^^^>@^^^\E^B^F^C\IAH^\D\\\\G\L^J\K\\^\\\M^^^N^^^1O\P^^^TUQ^^^Y\RS\\Z\VW[\^\^X]\\.\\\\\^ \^\\^_\^^\c \^^a^^^^^e c^`^^fb\^&ge^d^h\\j\\\ki \\ \\^\l\e \ \^^\^^^m \n^^q^^\^t^s^op^wr^ \\\u^\\v\^\\y\ \\ \z^^^ \^^\{~^^^\^|^^}^\\\^\^\^"\\\\\^^^\^1\^3\\ ^^^^^\\^\^^^\\\\\\\^\^\^\\%#^^\\^^7\^^^^\^^^\\^^\1^ \\| ^\\\ \\\ ^^\^3-^^&^%^^^^^\\\\^\e\\\\\\\^1^^^ \^\\\\^ ^^^^^^\\\^\^^^^\\&\\^^^\#^\\^\^\\\^^\\^\^^ ^\\^^^\\^^\\^\\\\\^\^\\\^^\ \\^^ ^^^^ \^\^ ^^^\^^^\E\^\^\\\x^\\ 3^\\^\\ ^\^\^^\^^\\^^ ^^\^^\\ \^\\O\^^\\\^\\\^^7^\\^^^LE ^^ ^\^^^ \\\^^\\\\\^\\\^^\^L \^^^^\^\ \\^^^L\^^\\^\^^^\\\\\^\\\^ ^\\^\\  ^^^^^ \^^ ^\\\^^^^{iZ^3^^^\\9e^^U _ f i   ge   f <  g        ********\\(\\\\\e\\f\)\g\^\^\^^^^^E ^:=^l ^F8?^ ^^B ^;\$>%%%%%%%%&@aAN'\\C\\^\''''''++++++++^^D^^,^\H\\P,,,,,,--------EL R ^\.^^\[M  ......22222222I^ JY^3\\\\  V3333334G555555556^^^^\7\\T\ \\777777\QKL\\O\\^\^^S^\^^\\\V\\^T\^^\^^\^UY\^\^^^^^\WX^\`^[\^\Z^a\^^\_\]\\^\\\^< ^c^yb\\> \\^^\^^\^^^\ijhd\fk\^^e^^mg\^\\^p\p^\s \l^nl^\os\ \k^\^^\\^wq^v^r\at\^y\^u^{x^}\^^\Iz\\\|^\^\^\\& ~\^\^\^^^\\^^\^^\^\^^\\\^^\\\^\^\^\^^^z\^^\\^\\^\^\ \\^\\^q> ^^\^^\\l^\^^^\^^i\\^\^^\^\\^\\}^\\^\U ^\\\^\\^ ^\^\^^^\^^^^^^\\^[^\\\^\\\| \\Y\^^W\\ ^\\^^\\^\^V^^^^^^\U^^O\^^\^\\T\\\ \\^\^\^\^^^^\^\\^^\ \^  ^\^ \\^\ ^^\ ^^\^\ ^^\ ^~\^\\ \^\^\\\^ \\\^\e^^f^\^g^\^^ \^^^\^\\\\ ^\\\^\^\\\^ \^^^^ ^^^\ ^\^^^^\\\\\ \ ^^\\\\\ ^\^\^ ^^^~\\ ^^^\^^\\^\^\\\^^\^ \\^^ ^\ ^^^\ \ \^\\^^\\\^ \ ^ \^\^ ^^ \  ^^\^\\^\\^\_ ^\ ^\ ^^^< ^^i ^  >^  ^    W                \  E L U _ \>      "^  "((((((((.^////////<<<<<<<<\\\\\\A \\ &&&&&&&&^^^^^^'FCHI\^^''''''$B))))))))&D \^*\\\ J******++++++++^i ^^^,\K\\N R,,,,,,1E222222223^ ^^ 4\\\\\ L4444448G99999999:^^^^^;\U\W aO;;;;;;4M========6^ ^\\>\\\ \ >>>>>>????????^^\^^^@\^\ \\\@@@@@@P\Q\ST^XV ^\^Y^^^\\\\ \\\\^\Z\[ ^] ^\\\ ^^^^_^^^^\^ ^\e \`\^^^\b\fcid g\\^\hk^lj^\^ n\^\^\ \\m\^^\^\o\p \^\q\^t^\^r^^u^\ ^\^s^xw^v^z^\{\^\\y \|^\^\\\\\\}~\ ^ ^ ^^ ^\\\^\^^^^^^\\^\\\\^^^^\\\^^\ ^\\ ^\ ^^\\H\^ ^\\^\^^^R\^\ ^ ^ ^\\^^ ^\\\^\^\\\^^\\\\^\^^\^\^\^ ^\  ^^\^^\^\\^^\^\\^\\\^\\^^^\  ^\^\^ \\^^^\^^\\H^\\\^ ^^^\\\^\\\^^\^\^\ ^ \\\ ^^^\^^^\^\\^\^\\^ ^^\ ^\\^\^^^\^^\ \^\^^ \^\ \ ^\\ \^^\\^\\^\^^\\ ^^^\ ^^^^\ ^\\\\^\^\ ^\\\^ ^^^^\^\\^ \ ^^ ^\\\\\^ ^^\\\^\\\ \\^^^^ ^ ^^^\\^^^^^\\\\\\ ^^\\^^^ ^^ ^  ^^ "\ ."\ ^\\\ ^ ^^^\\  \\^^ \ ^^ ^\\ \13 ^^^\ \\\  ^\^^^ \\  ^ ^^ \ \8        : ^\ ^\\ \               ^ ^^ \^" $       \^\\\\^\ !\\\\\\^^^^# ^'%&\\^ \\\ \^^^^^\\ \\)+\ (^^\,^^^*^\\\./^^1^^\ ^-2\3^\\0\\ ^^^4\\\7\\^5\\\^\6^^\^^8 \\\^^^\^^\ ^^^\^<;9^:\\?^^^\\\^> ^=\@A^\ \B\\^^ \C ^^^\GD ^E\\^F^I^^\ K^ H\\\^ \JL\\^^O\\\MQ^R NP ^^^\S^ \^^U\\^^^\\\ V\\T\\ ^ W^\\\^^\\ ^^^XY^^\^^[\^\]\^^^\\^^Z_\\\\ `^ \\^\\\^\ \^^\\ ^^^^abec^^ ^^^ ^d^\\^^fj\\\\\\no\\h g\i \ ^^\\ \^^^^^^\\^^m\k^vq^r l^^p^\ts\u\^^w\\^z\ \\\x\\\\ ^y\^\^ \ ^^\ ^~^^^\^^^^{ ^ ^|^ }^\^  ^\ ^ \\\\\ \ \^^ ^^^^^   \\\\\ \\ ^^ ^^^^^  \\\\\   ^^^^^\  ^ \    ^  \\\\\ \\^^ ^^^\^^\\\\\\\\\\^\\^^^^\\ \\\^^\\\^^^^\^^\ ^^^\^^\\^^\^ \^\\^\\\^\ ^^\^\^\\\^^\ ^^^^\\^ ^\\^^^\\^\\\ \^^ \\\^^\ ^^\^^\^^\\\^^^ ^\\\^ ^\^^\^\\\^^^\\\^\\^^\^\^\\\^\^ ^^\\\^ ^\^ ^ ^^ ^\\ ^^^  ^\^\^\           ^ ^ ^        @     \  ^ A         !!!!!!!! """""""" \\#\\\ \\\######$$$$$$$$^^ ^^^%^^^ \C\%%%%%%))))))))B \*^ ^  ******++++++++^,,,,,,,, \\-\\ \\------........^^ ^^\/D^^ //////00000000^1111111122222222H33333333 \\4\\\ \\44444455555555^^ ^^^6J^^ G 6666667E888888889\::::::::< ========>\\\\^?\\\\ \\??????\ F\ ^^^^\ ^^^^\^^\M\\\ ^LN^IOP\\^KQ\ \^VR^\^^^S\ \\ \U^^\\ ^X^\T\W^Y\\\^Z^^[^\\ ^^\\ \^ ^\\\^^^\]be\\^^^` ^_^fad^^^c\ ^ ^^ \\jghissssssss^kqqqqqqqq^^ r\\\\ \rrrrrr  tttttttt ^ ^^^u^\ \\\uuuuuuvvvvvvvv ^\w^^^  wwwwwwxxxxxxxx ^yyyyyyyyzzzzzzzz{{{{{{{{ \\|\\\ \\||||||}}}}}}}}^^ ^^^~^^  ~~~~~~    \\\\ \\ ^^ ^ ^^^  \  ^\\\\\  ^^^^^    \   ^j l  \   7^9 < > \\\\ \\\^\^^^\^^\\\\^^ \\^\\^^^   ^ l \\\^^^^ " ! # ^^^% $ & \q s ^\   ^ s \  ^\z | ^ * \^'   \\\\\ \ ^^ ^^^/ ^1 \\\ 3 4 \ ^^^                ^         \(  \\  \              ^ ^^\ ^               ^        2  \\ \\ \\ ^^ ^^\ ^^         ^                5                           \\ \\ \               ^^ ^^ ^                                            \\\\\ \\  \ ^^^^^ ^^> > > > > > > > \) + , - . ^0 \ 6 < < < < < < < < ^ = \\ \^\= = = = = =  ? ? ? ? ? ? ? ? ^^ ^@ ^\\ \\\@ @ @ @ @ @ A A A A A A A A  ^^B ^^^ B B B B B B C C C C C C C C  D D D D D D D D E E E E E E E E  F F F F F F F F | \\G \\ \G G G G G G H H H H H H H H ^^ ^^\I u | ^ I I I I I I J J J J J J J J ^K K K K K K K K L L L L L L L L  M M M M M M M M N N N N N N N N  O O O O O O O O  \\P \\\  P P P P P P Q Q Q Q Q Q Q Q ^^ ^^^R 0 1 \R R R R R R S S S S S S S S T T T T T T T T ^U U U U U U U U V V V V V V V V  W W W W W W W W X X X X X X X X  Y Y Y Y Y Y Y Y  \\Z \ \ \  Z Z Z Z Z Z [ [ [ [ [ [ [ [ ^^ ^t ^\ ^ u v \ \ \ \ \ \ ] ] ] ] ] ] ] ] ^ v _ _ _ _ _ _ _ _ ` \a a a a a a a a c d d d d d d d d e  ^f \\\ \f f f f f f j k k k k k k k k l ^^^ m ^  m m m m m m n o o o o o o o o q r r r r r r r r s  t \   t t t t t t u v v v v v v v v w ^x x x x x x x x z C { { { { { { { { | E x }   } } } } } } ~ ~ ~ ~ ~ ~ ~ ~   \ ^      \ \\ ^ ^^ \  ^ \  ^ \ ^ E y  J L  L  ^ ` c S e U \ \ ^ ^ 2 3  j l U   n q ] s _   u w z | _     g i     i                                                                                                          ! ! ! ! ! ! ! ! " " " " " " " $ $ $ $ $ $ $ $ % % % % % % % % & & & & & & & & ' ' ' ' ' ' ' ' ( ( ( ( ( ( ( ( ) ) ) ) ) ) ) ) * * * * * * * * + + + + + + + - - - - - - - - . . . . . . . . / / / / / / / / 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 4 4 4 4 4 4 4 6 6 6 6 6 6 6 6 7 8 8 8 8 8 8 8 8 9 \: : : : : : : : < = = = = = = = = > ^? \? ? ? ? ? ? C D D D D D D D D E F ^  F F F F F F G s H H H H H H H H J K K K K K K K K L M \  M M M M M M N O O O O O O O O P ^Q Q Q Q Q Q Q Q S T T T T T T T T U V  V V V V V V W W W W W W W W X Y Y Y Y Y Y Y Y Z [ [ [ [ [ [ [ [ ] ^ ^ ^ ^ ^ ^ ^ ^ _ `  ` ` ` ` ` ` a a a a a a a a b c c c c c c c c d e e e e e e e e g h h h h h h h h i j  j j j j j j k k k k k k k k l l l l l l l l m m m m m m m m n n n n n n n n o o o o o o o o p p p p p p p p q q q q q q q q  \ r \\ \\r r r r r r s s s s s s s s ^ ^^t ^^ t t t t t t w z { 7 9 < > \ C ^ E  G J L  N P S U  X  Z ] _  b  d g i                                                                          ! " " " " " " " " # $ $ $ $ $ $ $ $ ' ' ' ' ' ' ' ' ( ( ( ( ( ( ( ( ) ) ) ) ) ) ) ) * * * * * * * * + + + + + + + + , , , , , , , , - - - - - - - - .  . . . . . . 6 7 7 7 7 7 7 7 7 9 9 9 9 9 9 9 9 : ; ; ; ; ; ; ; ; = = = = = = = = > ? ? ? ? ? ? ? ? A A A A A A A A B C C C C C C C C E E E E E E E E F G G G G G G G G I I I I I I I I J J J J J J J J K K K K K K K K L L L L L L L L M M M M M M M M R R R R R R R R  S S S S S S S S U U U U U U U U V V V V V V V V W W W W W W W W  X X X X X X X X Z Z Z Z Z Z Z Z [ [ [ [ [ [ [ [  \ \ \ \ \ \ \ \ ] ] ] ] ] ] ] ]  ^ ^ ^ ^ ^ ^ ^ ^ ` ` ` ` ` ` ` ` a a a a a a a a  b b b b b b b b c c c c c c c c  d d d d d d d d f f f f f f f f g g g g g g g g ! h h h h h h h h i i i i i i i i # j j j j j j j j l l l l l l l l m n n n n n n n n o p p p p p p p p x x x x x x x x 6 y y y y y y y y z z z z z z z z { { { { { { { { : | | | | | | | | } } } } } } } } ~ ~ ~ ~ ~ ~ ~ ~ >         B F     m  o                  XXXXXXXXXXXXXZZZZZZZZZZZZZ]]]]] ]] ]]ppp p     2222222222222                ! ! !!! !""" "''' ',,, ,/// /000 0777 77! ! !!! !# # ### #$$$ $*** *0 000 0444 4555 5666 6;;; ;;>>> >>! ! !!! !                                               ### #&&& &''' '--- --444 44; ;;; ;;??? ??lll lnnn nooo ouuu u||| |              ]]]]] ]] ]]                                 ]]]]] ]] ]]7 7 7 7 9 9 9 9 : : : : @ @ @ @ G G G G P P P P Z Z Z Z b b b b b f f f f g g g g h h h h m m m m m p p p p p p t t t t t y y y y y y } } } } } ]]]]] ]] ]]       ]]]]] ]] ]]                          # # # " " " " , , , + + + + 5 5 5 4 4 4 4 ; ; ; ; ; ? ? ? ? @ @ @ @ A A A A F F F F F I I I I I I M M M M M R R R R R R V V V V V \ \ \ \ \ \ ` ` ` ` ` f f f f f f j j j j j r r r r r ]]]]] ]] ]] } } } } ~ ~ ~ ~ ]]]]] ]] ]]                                                   % % % % % % & & & & / / / . . . . . 4 4 4 5 5 5 8 8 8 < < < @ @ @ D D D H H H N N N O O O O P P P P Q Q Q Q T T T T Y Y Y Y _ _ _ _ e e e e k k k k q q q q q q r r r r w w w        q       A A   9  $$$  99!!=! !=!  ] ]EE''&& &'E K++. K.+.1+0 0011,QIIQQI?,k? ?k"3"2"2233 (S((SS;""; ;;"2DD" D"[((2G2G[GG(,G[,[,MaaMMMM%a%%%% D %%%%,,%%%%,%)))O),)O )))O ))O)*4*45*4575557 55557777<78< 8<8__****5*_45***_:**:*4:46>6>6>8@<@+8@< +<<8888B8BJ:BJ]FJF6>F6 6::66@>6666H]H@UHL@ULLB UFFBNUJNJ N JPRPFRPRT(THTH(uHHL^VH^VL^VdNdi\dN\iP\uN PNNRiPRiRP 2`T`V^`TVT2 W WhV\hW^hVWWW\ dWWX\X\X`` b b`bgf`fghfgghghhXhXllXlXXX bbXXYYYYYYY/ YbYY/YYZjfZjZjmml nmmnpmnppl D >| D>>ZjZZZZjZZZZZjIZZjInnnnnpy v?r k ?j vh v3f 3++e 7799d 9b ;J;,` _ x,J^ \ Z wxJY wxX V w)T *)F*S FFQ yP yO M K y/ + ) ' &        S S   S        33333    O O O@z@{=z$$= z$${|$= {||   ~   ~            ~    & &&& &      "!!%!!!'!## "## #"# "%*"%'+%"'""' '10%%%*''0*+0 *+} *0+4o 10**7*11+++;m ;1;k 4;1;447777B 4:7<7?4A 77:788"::::@88:8"88<8?><<CC<??>CC@C<C?A>A?HA@ @? @@@AAGGMPPGGHGGGHHPLPL; MHLHLHLMM1 M/ M________`( ````````` }`&   ``````` `}`ddddddddd}}d }ddddddeeeeeeeeffffffffgggggggg  N N# NN#N  fiiiiiiiiiiiiiiiooooooooooooooo tutu              { {   * *  h        |  g f  |  b      \  /W "/!U # $%"&R ')*! ,/"#.!$%"60%&$'%)1'*60,#/23.*$&%))04.,8M )16/.//;523/K 7:9<;4=I 8;16833D 253B @67:59<47=5:;=5>5AB559;<@CDE:KFGHIJ= ?; : >9 AB>8 @L?PCDE7 KFGHIJAFFFBFO  KDLCPQRIFFGHJSTU VYOPLWX^\QRQ[STUOSVUYRWZX^\]TT^U\[V_TUW`VYaXWXXZ[\c],bZde_sg,`kZa]]fma,cj_b`hdbeisgckaodfkmkfjsfghdegijlhkz|iohmhnhqihhopuolz|lll|ntqvwxnpullznpppnnnqnn~tvwxppyuw}xw? t~vw@ v? yx}y@ ~y}}}}~ywrpo n -ml1- - ('&% F 3  F 3  3  G O   G O P m P m Y Y p t p t                Z  !Z " #  $!"#%& ')(" *+ ,-$.#/ 0  1%&5')($ 6&*+),-7.,/+0'(10*5489:-6;<.4=7?>5C @B4A689: D;<E7:=?><FC8@B9>AG;HI=DJAEK?A@DCBFAELMTNPG6HIOy J5RK4USFGSy KILMTNPVHWLOJXPR0OUSY[UR\^MN]_`VaW,'bXcdW%$"Y[ef\^1g]_`Vah\^bXcd[a`]ikefj0_g lm/} hncpo qstg} ikerjf.(ilmjh'n"pomqstukvwxrqynonlpzs{r|t}~uvwx! yuxz! {|w}~vy{|}~ Z "  "  Q4* 2*       {rM-    +    +        t $s  qF  I  F p$I  hb$&')a&')#^ &M )3 #* Z#M 3 *4 X!"%(4 V!"%(+,-T./01(!"23%54+6,-+.7/089:0;<1R,=23>54?6/4@Q7AN89:K;<B13=C<>6D?E5E@=7A:F;H8GIBJKLC B=DBE6@MN OPF.HQGIRJKLSJKIDTGLUMNFOPNHVQWXRQY-SZR [MTO)U\PT]R ^(V_WX`aYXRZW[SbUc\Zd]V^\Y_^e`af[ghi]bajcbkdlm_`neofepghiqrcjghkslmkjtnuompvwyqrzxpl|sn{tr}usxqo~vwyzx|{zt{}w ~}x ~V V y\ xw\ vusqoecC                 `   ` f j t f j t <!!!    8!!    <!$$$$$$$$*8********44444444:@A>I98;N!########:@A>I9#>:@AB;N######%9%%%%%%%%%;CB%F=KB%%%%%%&&&&&&&&C% F=K&DCP?F% K&&&&&&-=---------DP?-GREO\D------2?222222222GREO\2]O`R2\G2222225E555555555]q `JL5HMQ5Sq 55555566666666JLTHMQ6USWVXY666666HWJZLMTSQU[WTVXY^_abcdefZhUgVYX[kli^_abZcdefjhgmdn[oklip^qf_icgrsjthkmljnuonvpwqxy{mzrs~t|op}uqvtwxry{uz~|szy}x|}{                 ACDA!!!CD!!         !##(#((((((((E##......../#////////BEGFI!1111111188888888BEGFIHJB#&&&&&&&&&&F&GKLHJM&&&&&&++++++++++HKL+MLOQ N++++++2 222222222 OQM2NSOPTR22222233333333NSV3PTRUW33333377777777VPR7UWVX7UY7777779999999999X[9Y\^9`999999::::::::[\^:Z`[^::::::<]<<<<<<<<?Z?????????_abc]?d?Ze??????fghij_abc]dc_aklemonpfghijsqrtfiueklvjmongpwxymnsqprtzulq{rv|}o~wxytxzu{w|}~{~"$"$ %&)(* %&)(*(   +#,./ +#,./0# 0         1 0               1!2-34'!2-354'6789:;!'4-<=>?5@A6789CBD6EF:;GH9I<=>?J@A75KCB@DLEFMNGHOIADPJ=BQRKCGSTULVMNWIOXKJOPYZ[QR\MSTUQVR]^WUXP_`XYZ[ab\cSd[eVf]^Yghi_`l \abjc^dke bfmn`oghi lierspjdpkqfjqmntovnuoguzorsp{r|kwqxwmx}tsvyu~y}zt{|w{x}vzy~|~         ADA@B        D@BBC@EFIJ          CEFI JKCLMN              KG LMNL              GGPOQRTVkPOQRTOVkPZ][]gSZ][gS[ZgS!U!!!!!!!!$ $$$$$$$$$ U$bhWH $$$$$$)U)))))))))bhWH)bh)))))))+H++++++++.W..........\.......0000000002\222222225 555555555 \55 5555557777777788888888899999999:::::::::<<<<<<<<==========j=^_`=XY======>>>>>>>>ajc^_`>dXYefij>>>>>>_XYa^c`defi eeca fd iqqqqqqqqqqqqqqqqqsssssssssv vvvvvvvvv v vvvvvvxxxxxxxxxzzzzzzzzz} }}}}}}}}} } }}}}}}   ! ! " $ ' " $ ' # ( ) + # ( ) # + , * . 0 . 3 , * . 0 * 3 0 / 4 /  / 4  4 % & % - &  % 6 - &  - 6    u 6    u     v z |  v z  | z     {  v { v { w w w   1 2 3  1 2 3 1  2 3  2 q q 2 u q 1  2 u u 1  1          r          r    r                                                         x                       x                    x                            5  y               5  y       5 < < < < < < < < < < y < < < < < < < > > > > > > > > > A A A A A A A A A A A A A A A A A C C C C C C C C C E E E E E E E E E H H H H H H H H H H H H H H H H H J J J J J J J J L L L L L L L L L N N N N N N N N N Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q T T T T T T T T V V V V V V V V V X X X X X X X X X [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ ] ] ] ] ] ] ] ] ^ ^ ^ ^ ^ ^ ^ ^ _ _ _ _ _ _ _ _ _ ` ` ` ` ` ` ` ` a a a a a a a a a c c c c c c c c d d d d d d d d d d d d d d d d d e e e e e e e e e e e e e e e i i i i i i i i i i i i i i i i j j j j j j j j k k k k k k k k k k k k k k k k k k l l l l l l l l l l l l l l l n n n n n n n n o o o o o o o o o q q q q q q q q r r r r r r r r r r r r r r r r r r s s s s s s s s s s s s s s s u u u u u u u u v v v v v v v v v w w w w w w w w x x x x x x x x x z z z z z z z z { { { { { { { { { { { { { { { { { { | | | | | | | | | | | | | | | ~ ~ ~ ~ ~ ~ ~ ~         ~ - - - . . . t t 0 t 0 0 s s s                                                               % % % % % % % % ' ' ' ' ' ' ' ' ' ) ) ) ) ) ) ) ) ) . . . . . . . . 0 0 0 0 0 0 0 0 0 2 2 2 2 2 2 2 2 2 6 6 6 6 6 6 6 6 7 7 7 7 7 7 7 7 8 8 8 8 8 8 8 8 8 9 9 9 9 9 9 9 9 : : : : : : : : : < < < < < < < < = = = = = = = = = = = = = = = = = C C C C C C C C D D D D D D D D D D D D D D D D D D G G G G G G G G H H H H H H H H H J J J J J J J J K K K K K K K K K K K K K K K K K K N N N N N N N N O O O O O O O O O P P P P P P P P Q Q Q Q Q Q Q Q Q S S S S S S S S T T T T T T T T T T T T T T T T T T W W W W W W W W X X X X X X X X Y W Y Y Y Y Y Y Y Y Z Z Z Z Z Z Z Z [ [ [ [ [ [ [ [ [ ] ] ] ] ] ] ] ] ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ a a a a a a a a b b b b b b b b c a c c c c c c c c d d d d d d d d e e e e e e e e e g g g g g g g g h h h h h h h h h h h h h h h h h h l l l l l l l l n n n n n n n n n p l p p p p p p p p s s s s s s s s s s s s s s s s s s                                                                                                                         ! ! ! ! ! ! ! ! " " " " " " " " " # # # # # # # # $ $ $ $ $ $ $ $ $ ( ( ( ( ( ( ( ( * * * * * * * * * , ( , , , , , , , , 6 6 6 6 6 6 6 6 7 7 7 7 7 7 7 7 7 9 9 9 9 9 9 9 9 : : : : : : : : ; ; ; ; ; ; ; ; ; = = = = = = = = > > > > > > > > ? ? ? ? ? ? ? ? ? A A A A A A A A B B B B B B B B C C C C C C C C C E E E E E E E E F F F F F F F F G G G G G G G G G J J J J J J J J L L L L L L L L L R R R R R R R R R U U U U U U U U W W W W W W W W W U [ [ [ [ [ [ [ [ ] ] ] ] ] ] ] ] ] [ a a a a a a a a c c c c c c c c c a g g g g g g g g i i i i i i i i i g l l l l l l l l m m m m m m m m n l n n n n n n n n o o o o o o o o p p p p p p p p p x x x x x x x x { { { { { { { { ~ ~ ~ ~ ~ ~ ~ ~                                                                                                                 ! ! ! ! ! " " " " # # # # $ $ $ $ % % % % & & & & & ' ' ' ' ' ( ( ( ( ( ( ) ) ) ) ) * * * * + + + + , , , , - - - - . . . . / / / / 0 0 0 0 0 1 1 1 1 2 2 2 2 3 3 3 3 4 4 4 4 4 5 5 5 5 5 5 6 6 6 6 6 7 7 7 7 7 7 8 8 8 8 8 9 9 9 9 9 : : : : : : : : : ; ; ; ; < < < < = = = = > > > > ? ? ? ? @ @ @ @ @ A A A A B B B B B C C C C D D D D D E E E E F F F F G G G G H H H H I I I I I J J J J J K K K K K L L L L L L M M M M M N N N N N N N N N O O O O P P P P Q Q Q Q R R R R S S S S T T T T U U U U V V V V V W W W W X X X X Y Y Y Y Z Z Z Z Z [ [ [ [ [ [ \ \ \ \ \ ] ] ] ] ] ] ^ ^ ^ ^ ^ _ _ _ _ _ _ ` ` ` ` ` a a a a a b b b b b b b b b c c c c d d d d e e e e f f f f g g g g h h h h h i i i i j j j j j k k k k l l l l l m m m m n n n n n o o o o p p p p q q q q r r r r s s s s s t t t t t u u u u u v v v v v w w w w w w x x x x x y y y y y y y y y z z z z { { { { | | | | } } } ~ ~ ~     DHR`+]"b fA1| |$=a=M9xN=  g1 9&an/NE*Lc[dfm"|M{gSN`L ~r=wr=jZ2E8r=r=r=r=r=r=r=r=jr=L_r= r=r=r=T{f 4yr=r=r=o 1EGO0]g9}pz{zNEY.fQ0XDGSbh\(qP "32A;E)MRUia+]M0};#*\,xo 46DE0LSgex]r=r=r=r=r=#a@.2 r=r=r=r=r=<r=l^ ABl>!)EU Sr !b"X5R7NjcVW`abegmrpts~Nr=&         $   ,  4 5 3 > A B E I [ / d _ c i e k r t u    E  t   ( ) 2 ? 9 D 5 G E N H K i 0Z k l s t u x y z { | w u   % 1  9 3 c J : L M N i ( S) l a [ cQr t u z w   \H h lf q r= Z ? *  . t 4  C 1 u  2    " ' + , 8 ; = > B G E F J K L W X i [ q t v x y z { ~  !"$%')+.r=17>KLMPQUXW]a^[gjrz|}U#%'*+,(356G8H9ILSU\]beflqprv|w  +01379:;=DEFJNTVX`gimYrsuvw{|~ker=U+I$IeA0 Wr= -F|@bc_ACDx   !%*-578;>@FIKNQRZ]`hknoptwyz   )*3094;7=>@DEIJMNP^dgikmntpuy~!#%&(/03418:CDJNOQVUWe_djspvxy~$B^r=| &Xv=TsWY'u    )-0268?@BIMOQSVT[`Y]bdhor}   !$&'.02678:;@GILMQUVY[^fghjklort{y|  !$&'+*F:;GHLMNvv:Br=9WsKO\]607QTjmnq     $3',49:A;EGIJNT\[cijknqrvwx "%'+,1/265738><ajRKEi  'N1 Omw+LAEc|GFHIJd  "'+,01248;@ABENOUV[\^`bejkluyo~ } t UhA 7J AK? gqy+   ^+5^=Gc  1 F]Y" Z \^ab       r= A 7 _ { ! !!5!{ Q! [!V e!;o!K I = : !_ ! + ! !4 !} F! " """0 '"1"M"p 7  8 V - X Y !Z \ u x y z 2! j! !K"L"+!.!!,!F"G"H"["!]"b"e"f"0!!g"D" ) ' " "gm" " "B " # # # '# C#K#U#]#g# o#y## t #### $$ !$+$G$ c$m$u$$- $$$U $z $m $$ 3!{"!o"!|""y"x"""""B##$"#$#$$$#$#$##Z$#$b A 4 $%%B%^%1 z%%! %%% %%%% %%& 4&<&F&N&X& `&j&& r=& & &B : & & &', $' .'2m8'w T' ^' h'r'y ''''' ''' #### %%###>$#=$&%@$$A$&&E$$'=% x t r q (o (r y )(K G(Q Q(| [(> w(? (2 ( D ( r=( ( (n ( ((()) )!)=) { Y)u))); ))o )))v ***'*/*9*U*q*y****j***m *v *u *Lp!*'$?%'F$$[%9%$(%:%X%h Y F +%+D A+K+@ S+]+" y+++++++++++++,,',/,9,A,K,r=g,q,{, ,yt,,!|",>,e,"",-d#- --(#%7- S-]-g-%k&q---------Y%%&\%-'>(--%.(..X .*.4..r=<.F.P.r=X.b.l.rt.|......][*.. .../f$/./6/@/1H/R/n/v////./////////0 0*0&'40]%%3&''%&%r=P0Z0b0l0t0~0000000000000001r= 111 y(19'\(t21<1((`D19N1X1"))`1j1t1):*|111*+1111111&&:)<)&w1z1x2ur=2c2Zr=2W$26r=,23622>2F2P2X2b2j2t2|222222222222222333"3_*343>3&+^+,|&}&&r=F3P3r=X3`3j3r=r3z33r=333r=333r=r=33\3P*323133 44}4t"4mJ,444@4H4R4H,,&&r=Z4Mr=b4r=j4r=r4r=z4 444444444444445 555(5m&-.25:5B5J5R5r=Z5Sb5 j5~55O5W555&-r=r=r=r=r=555556'6&r=yU$63r=J6W6b6i6u6|66666666666666666677777*70767>7D7J7P7V7\7g7m7s7y77777777777777777777778 8888#8+81898?8E8K8Q8W8]8e8k8q8w8}8888888888888888888899999$9*90969<9B9H9P9V9`9g9m9s9y999999999999999999999: ::: :(:.:6:<:B:H:N:T:Z:`:f:n:t:~:::::::::::::::::::::; ;;;;%;+;1;;;B;H;N;T;\;b;j;p;x;~;;;;;;;;;;;;;;;;;;;;;< <<<<%<+<1<7<= ? @ @ A B B C D D E F G H I J K L L M N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N O P Q R S T U V V W X Y Z [ [ \ ] ] ^ _ _ ` a b b b b b b b b b b b b b b b b b b b b b b c d e f g h h i j j k l l m n n o p q r s t u v w w x y y y y y y y y y y y y y z { | } ~  !'%* $#( & Z  = 3 MPO<sutV 8@="Cw45;6  P=;qmUXW&#{Hn9K5NJ}W?>:k)_z79nn5t:1:p}'$9Y`npXGF8|kchai~9xp834v1EGRS,U6\  ?[TOljZLAFR[fjm0sq2r)"%Rzyay^7d<iKAB+]HMoDENQ@ofg\{YywSbI/hJPcLQ_-x.`uxT(DC>Ib^]>v:~|eerV 0gdl-!,2B/;}.+*    !!!!!!"""""""""""""""""#""$%&'()*+,-./0123456789:;<=>?@ABCDEswitch_byteorderbyteorder_conversion_opexpr_set_to_listexpr_opspurge_elemremove_elemsetelem_to_intervalmnl_nft_setelem_batchbyteorder_switch_expr_valuestmt_payload_binop_pprule_getstmt_ops     mpz_exportmpz_abs_sub_uimpz_xormpz_iormpz_andmpz_abs_sub_bitmpz_abs_submpn_addmpn_limb_get_strmpn_limb_size_in_base_2mpn_div_qr_1_invertmpn_invert_3by2mpn_common_scanmpn_lshiftmpn_submpn_sub_1mpn_add_1gmp_default_alloc$(& 8-& H,& X+& h*& x)& (& '& && %& $& #& "& !&  & & & $& 0& 8@HP\hp|  8H\ht    -L8 XB , X` )+@` ) &  C #  a5D" 1( 5C  48 -]E DH %E PX Q ld a   t (D  D  ٵ0  0H (0 I L@H0Px&L7\dpdhx L7 @L R   (4I 0I @00 p I 00  ,@P\p   8 L d x   " P t@    , ! !,! L> = < H< ; : D: 9 8 @8 7 6 <6 5 .@&& 9) '&& BB ##@ `& De & ' ',' ' '@'&T'`'p',''&' ' ' ' #' ' D '' 5CM'')mAݴi}ܓ Hy Ht s s  H 0 I R I ܎ t D| `S $S H v hH ,H G G xG Hs s r | ę C h5 -)-{U1z)8S[ JuY9eqQ M-} 9}Y~9ɂ~u<%5MQ9}zI HM QA ]*ܓܓ } 9,9m@A AA#$A0A)0 ) (0 ( lf $ tf `  $f T$ `  \  X T Th _|f q)ASfMGX!]K݋KV5խYU$<|8< ɃNdlt Qȓ H ܓ]-R4I|5qLffffff$effDQ] mG-==lQeBPVD@ &<%9E9Ef # f fH @ȓf4fTgXXXgjg$g2,gd8g$g8dP`,8g*+ ++ +*(+ ́܁  ,48@HLPX`hptx|ȂЂ؂  ,4@LT\ht|ȃЃ؃  (4@LXdlt|̄Ԅ$0<LXhtą̅؅4<DLX`hpxȆԆ܆$,8DLT\dlt|ćЇ܇$,8@HPX`hpẍ؈ 4@LX`hpxĉ̉ԉ܉  08HX`h|Ċ̊؊$4L\ltЋ؋ (08DPXdpxȌԌ܌ (4@LT`hxčЍ؍ ,8@HT`lxĎ؎$0<HPX`lt|ďԏ܏  (4<HP\dpxȐАؐ +$0@P`tԑ(8L\lĒؒ(<P`tГ 0H\pȔܔ(8@LT`lxؕ̕,<HT`lxĖTԖl,@T\hxЗ $0@PhxȘؘ(8DTd0tDșԙ̚'x(4D0XdtȚؚ,<HTh|Л 0DXpĜԜ ,8HT\ht̝؝$4H\htОܞ 0@L\pП,@P\l|ĠԠ$4@Xh|ȡ8ԡ  0@P\htԢ LL ,<Td|ȣܣ(@P`tȤԤ$8L\lxХ 0<Lp\l|̦ܦ 0<HThȧԧ ,8HP8$X`lxȨب 0@P`p|̩ܩ ,<L\l|Ԫ 0@Tdtīث(<P`pȬ 0<L\hxȭح$4HPQP|PpP8P])YHhalQm4QE!$QQܓ%QX _h DQȓݓx48Y'ِ8E @ @ xx<x<x x,,()#**ܓjBl(~ t K l L Pp  k n i @g d y b t` w U 0^ [ S ()#**W0h@hLh@d98hh$hA h/dL` dk'#kkkkLlddht(H(|ĔԔ<В&l(t|܎ Ĕ܎ Ԕ܎ 2܎ <3܎ В܎ &:܎ ll܎ !܎ (܎ tD| 8}p998a)^dt_Ut _qt_}Hu hɟM`Yh,Y4%%%%%$GG<@ iD@9aa88@AȓAfAfAg AA4ATA"A<@ ip D@9pa@1apApȓApfApfAg AAp%4App PappTAqApȓAppq8aa<@ iD@9aaPap  ̴ t Ȳ 8 *(8&x*%%%%%h rg)ȓqs\4t@g}X%$y\1dlt|5gfxf%ygyPAܓyg1Ywdh9|Tvv )LX&PtU & a""$<~8B(<~0<8<~ dhDB ALB =̑~@ $ w !5R5 չȕ 9V MZmU}e}]Eui1A ѧYIE"a/1a59Im ` L 8 | !Aę %t  l 0 IѦ )V 9Ym 0]% %61&&'e 9MmY- 8 i}]܎ -  H  y JWyi1ŠE) 5ђqm-ݴݬQBHt t QKEYzV ~ | 9Hy v ME9L  LD| | Mԇ }+q=*MͿq{ ťYA  H M @ }!Yq ů x LF F A=Փ]P )y 9m 9A x ̴ t Ȳ Z1 9 =Qy11'i2&)/)!]& 85Q4i)@A4پ!M5 %C XB F  L YAI hH !ue  aQiŎEM9&!:8A5=^<`5\Y=e?u`BA])Bm{Uٚm=A!5]m%P( UVcIL!i$}Q'DyEECEDEE=FaC1m}(͢EF C97L )=+M]yE[ 0^ J ,H 5I@g A:QݹE8[ $ 9Pp R aNO` $ yl h 0   է y%l   T 0   @ ,   iyDqM\}^^19]Ű@E_S U Ij +q1E!~" @ q Ũ՗Um ! K k n i d b t` 8 MQѩ X  $ Ͱ E=i7t E=iARap`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 1p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 $ 07070101AE22FD0000A1FF0000000000000000000000016A426C2800000014000000FE0000000000000000000000000000001900000000usr/lib/libnftables.so.1libnftables.so.1.1.007070101AE22850000A1FF0000000000000000000000016A426C2800000011000000FE0000000000000000000000000000001600000000usr/lib/libblkid.so.1libblkid.so.1.1.007070101AE2283000081ED0000000000000000000000016A426C2800006582000000FE0000000000000000000000000000001600000000usr/lib/libe2p.so.2.3ELF4t4 (pZZ_ooP000((QtdRtd_ooPP )6DL 4 @EooXt  j ptpppp ppZp pooooCZ(OHBWQ&8.0R1 F4C;3,<%) 65D#A/$N" ?!'J@G IPL-+= :*297KV>MEY UTSX4  ~y0 r,N t#m f+ % $* 4 y  s M- )M Q u" Q$- @E q*X 1*@  N]"" } * 7M+ + m B(  Q- *  EgE_"^ EoDSDD}$ BD].U } D.V  `DDDpD`D)! ;PD  X @D0Dh DD#a DD4C})i CCC$ C"XCCUCJ] pC`Cp0 PC "%J @C,Q 4" 0CC CC` "CmB B_init_fini__cxa_finalize__deregister_frame_info__register_frame_infoe2p_feature_to_stringsprintfstrncpye2p_feature2stringe2p_string2featurestrncasecmpstrcasecmpstrtole2p_jrnl_feature2stringsnprintfe2p_jrnl_string2featuree2p_edit_feature2strlenmallocstrcpyfreee2p_edit_featurefgetflags__stat_time64__errno_locationopen__fstat_time64closeioctlfsetflagsfgetversionfsetversione2p_hash2stringe2p_string2hashiterate_on_dirpathconfmemsetopendirmemcpyreaddirclosedire2p_mntopt2stringe2p_string2mntopte2p_edit_mntoptsparse_num_blocks2strtoull__lshrdi3parse_num_blocksprint_fs_errorsfputsprint_flagsfputcprint_fs_statee2p_is_null_uuide2p_uuid_to_stre2p_uuid2stre2p_list_journal_superntohlfprintfe2p_os2stringe2p_string2ose2p_percente2p_encmode2stringe2p_string2encmodefgetproject__stack_chk_guard__stack_chk_failfsetprojecte2p_str2encodingstrcmpe2p_encoding2stre2p_get_encoding_flagse2p_str2encoding_flagsstrtokstrncmpe2p_errcode2strlist_super2__ctime64strcatgetpwuidgetgrgidlist_superstdoutlibuuid.so.1libgcc_s.so.1libc.solibe2p.so.2GCC_3.0GLIBC_2.06P&y Xii `oooooooooooooooooooop ppp(p,p0p4p8pDpHpPpTp\p`phplptpxpppppppppppppppppppppppqqqqq q(q,q4q8q@qDqXq`qhqpqxqqqqqqqqqqqqqqrr r8rDrPr\rhrtrrrrrrrrrrrrsss(s4s@sLsXsdsps|ssssssssssst tt$t0tjl"@PrLaXHJe @:eg𸙰Te Mg@:ee Z5a@@X  j4`0r2`D"XhJ H@:egT e@:eJeJ66MXHJPL@@:ee"$L@:e𸙞egTIM@:e{d Jj @2ide\g!`X4.JQ@PH@:eB@e@:e"ge"g@8eQgvdXiJejy @2iedؘHN'': : QQ j @2iedgPP@?eDdeeee%x Y$%x X$%x W$%x T$%x S$%x Q$%x M$%x J$%x H$%x G$%x E$%x D$%x C$%x A$%x ?$%x >$%x =$%x ;$%x :$%x 8$%x 7$%x 6$%x 5$%x 2$%x 0$%x /$%x .$%x -$%x ,$%x )$%x &$%x $$%x #$%x "$%x !$%x $%x $' 'FEATURE_%c%dFEATURE_noneclearHASHALG_%dHASHALG_MNTOPT_%dMNTOPT_ContinueRemount read-onlyPanicUnknown (continue), --- not clean with errors%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xcrc32cunknown %s Journal users: %s Journal features: %s (none)Total journal size: %uk %uM Journal block size: %u Total journal blocks: %u Max transaction length: %u Fast commit length: %u Journal first block: %u Journal sequence: 0x%08x Journal start: %u Journal number of users: %u Journal checksum type: crc32 Journal checksum type: %s Journal checksum: 0x%08x Journal errno: %d (unknown os)ENC_MODE_%dENC_MODE_utf8-12.1utf8UNKNOWN_ENCODING_%d-nostrictUNKNOWN_ERRCODE_%un/a Filesystem volume name: %.*s Filesystem volume name: Last mounted on: %.*s Last mounted on: Filesystem UUID: %s Filesystem magic number: 0x%04X Filesystem revision #: %d (original) (dynamic) (unknown) Filesystem features: Filesystem flags: signed_directory_hash unsigned_directory_hash test_filesystem (none) Default mount options: Mount options: %.*s Filesystem state: Errors behavior: Filesystem OS type: %s Inode count: %u Block count: %llu Reserved block count: %llu Overhead clusters: %u Free blocks: %llu Free inodes: %u First block: %u Block size: %u Cluster size: %u Fragment size: %u Group descriptor size: %u Reserved GDT blocks: %u Blocks per group: %u Clusters per group: %u Fragments per group: %u Inodes per group: %u Inode blocks per group: %u RAID stride: %u RAID stripe width: %u First meta block group: %u Flex block group size: %u Filesystem created: %sLast mount time: %sLast write time: %sMount count: %u Maximum mount count: %d Last checked: %s%d month%s%s%d week%s%s%d day%s%s%d:%02d:%02dCheck interval: %u (%s) Next check after: %sLifetime writes: %llu kB %llu MB %llu GB %llu TB %llu PB Reserved blocks uid: %u (user unknown) (user %s) Reserved blocks gid: (group unknown) (group %s) First inode: %d Inode size: %d Required extra isize: %d Desired extra isize: %d Journal UUID: %s Journal inode: %u Journal device: 0x%04x First orphan inode: %u Default directory hash: %s Directory Hash Seed: %s Journal backup: inode blocks type %u Backup block groups: Snapshot inode: %u Snapshot ID: %u Snapshot reserved blocks: %llu Snapshot list head: %u FS Error count: %u First error time: %sFirst error function: %.*s First error line #: %u First error inode #: %u First error block #: %llu First error err: %s Last error time: %sLast error function: %.*s Last error line #: %u Last error inode #: %u Last error block #: %llu Last error err: %s MMP block number: %llu MMP update interval: %u User quota inode:%-26s%u Group quota inode:Project quota inode:Checksum type: %s Checksum: 0x%08x Encryption PW Salt: %s Checksum seed: 0x%08x Character encoding: %s Orphan file inode: %u UNKNOWNEIOENOMEMEFSBADCRCEFSCORRUPTEDENOSPCENOKEYEROFSEFBIGEEXISTERANGEEOVERFLOWEBUSYENOTDIRENOTEMPTYESHUTDOWNEFAULTInvalidAES-256-XTSAES-256-GCMAES-256-CBCLinuxHurdMasixFreeBSDLitesSecure_DeletionuUndeleteSynchronous_UpdatesDSynchronous_Directory_UpdatesiImmutableAppend_OnlyNo_DumpANo_AtimeCompression_RequestedEEncryptedjJournaled_DataIIndexed_directoryNo_TailmergingTTop_of_Directory_HierarchiesExtentsNo_COWDAXFCasefoldInline_DataPProject_HierarchyVVerityDont_Compressdebugbsdgroupsuser_xattracluid16journal_datajournal_data_orderedjournal_data_writebacknobarrierblock_validitydiscardnodelalloclegacyhalf_md4teajournal_checksumjournal_incompat_revokejournal_64bitjournal_async_commitjournal_checksum_v2journal_checksum_v3dir_preallochas_journalimagic_inodesext_attrdir_indexresize_inodelazy_bgsnapshot_bitmapsparse_super2fast_commitstable_inodesorphan_filesparse_superlarge_filehuge_fileuninit_bguninit_groupsdir_nlinkextra_isizequotabigallocmetadata_csumreplicaprojectshared_blocksverityorphan_presentcompressionfiletypeneeds_recoveryjournal_devextentextentsmeta_bgmmpflex_bgea_inodedirdatametadata_csum_seedlarge_dirinline_dataencryptcasefoldfname_encodingCIRPITTTTUUU$U,U4U\U<LYN   O RX^I2H8W/?9[E#VZ   @&A0 n%9 #, = !"( u $. ]$> 4 - $ /#* .u $ 6 "< P "  A )4 I"( F#( V9  $1 ~!* ( 9 $ . ]y o % $( q"< e#. :=. 1& tU$> ]   E  8 ?- Q $ Y] a u n!,   ] IM q8 ]" ? U &X&&i9 %h%%]!  %"6 !#E E%%  ~ %q  ; /%p%``%"JP%Q@%1 0%P1 "a!  % -!  4"P _init_fini__cxa_finalize__deregister_frame_info__register_frame_infocallocsocketfreemnl_socket_get_fdmnl_socket_get_portidmnl_socket_openmnl_socket_open2mnl_socket_fdopengetsocknamemnl_socket_bind__errno_locationmnl_socket_sendtomnl_socket_recvfromrecvmsgmnl_socket_closemnl_socket_setsockoptmnl_socket_getsockoptmnl_nlmsg_okmnl_nlmsg_portid_okmnl_nlmsg_seq_okmnl_nlmsg_nextmnl_nlmsg_get_payloadmnl_nlmsg_sizemnl_cb_run2mnl_cb_runmnl_nlmsg_get_payload_lenmnl_nlmsg_put_headermemsetmnl_nlmsg_put_extra_headermnl_nlmsg_get_payload_offsetmnl_nlmsg_get_payload_tailmnl_nlmsg_fprintffputsmnl_nlmsg_batch_startmallocmnl_nlmsg_batch_stopmnl_nlmsg_batch_nextmnl_nlmsg_batch_resetmemcpymnl_nlmsg_batch_sizemnl_nlmsg_batch_headmnl_nlmsg_batch_currentmnl_nlmsg_batch_is_emptymnl_attr_get_typemnl_attr_get_lenmnl_attr_get_payload_lenmnl_attr_get_payloadmnl_attr_okmnl_attr_nextmnl_attr_type_validmnl_attr_validatemnl_attr_validate2mnl_attr_parsemnl_attr_parse_nestedmnl_attr_parse_payloadmnl_attr_get_u8mnl_attr_get_u16mnl_attr_get_u32mnl_attr_get_u64mnl_attr_get_strmnl_attr_putmnl_attr_put_u8mnl_attr_put_u16mnl_attr_put_u32mnl_attr_put_u64mnl_attr_put_strstrlenmnl_attr_put_strzmnl_attr_nest_startmnl_attr_put_checkmnl_attr_put_u8_checkmnl_attr_put_u16_checkmnl_attr_put_u32_checkmnl_attr_put_u64_checkmnl_attr_put_str_checkmnl_attr_put_strz_checkmnl_attr_nest_start_checkmnl_attr_nest_endmnl_attr_nest_cancellibgcc_s.so.1libc.solibmnl.so.0LIBMNL_1.0LIBMNL_1.1LIBMNL_1.2GLIBC_2.0Py`/5a/5$b/5ii ??????@' '<'!'@@@ D@  ($$@ '<'!@@$  ($jU @2iedgҐPml@:eҞe""g mMT l@:e@Je*0g@8ejvde @ Bj @2ide\gmXJ@:eDdj @2ide\gXJ@:eDdej @2ide =8 u [$9 na  =  % d8  }  X  j$8 $  %V D - &  MQn &&&&&&p&`&3P&@&"Q0&e &&"&."%_fini__cxa_finalize__deregister_frame_info__register_frame_infolh_urlencodecalloclh_urldecodeisxdigitlh_header_attributestrlenstrchrstrncasecmpfprintffputsfputcreallocmemcpyvasprintfsnprintflh_mpart_initlh_mpart_newlh_mpart_set_callbacklh_mpart_set_size_limitlh_mpart_parse_boundarystrcasecmplh_mpart_parselh_mpart_freelh_urldec_initlh_urldec_newlh_urldec_set_callbacklh_urldec_set_size_limitlh_urldec_parselh_urldec_freelibgcc_s.so.1libc.soliblucihttp.so.0GLIBC_2.0ii ???????????????????????????????|@' '<'!'@@|@| Dl@l t,$$@ '<'!@@$ t,$/TEg `!T1aDMkfm# j_t`~t`"<" j8a\gpXg@:eeRjK \gPP$L@:ee*J^Zajyd;r` r` raH r`gHi HJ*" `%"va\vaKyMKLq`jK ҟeeeeeej @2ideFg"$gg$\g3X7JMIg@\gpH$M@:evdjU @2iedgX&gD JggpH@:eIeJ aP DL@8evd老 T`.lPX @:eIeej @2ideҤ2g&kH2IlJ e(1% luK `p@@:eel" JLiK*jwdiH2I㊚LQC`IC``iC@@:eD2iH2Ij㌚elll$x KH2i"XDJpHdM@:e HM@8eXdJjj @2id$gҚe$ggpH dM@:e HM@8e] "~ ӑg@:evdjj5 @2iedgPHg $g:e@ Je* jOXؘB JNgBH m@:eg8e@mxd j@xH2Ki ӅP\𸘝AML@:eP Ҟe@=e J" ej @2ide tg)` Tg`AD)" t,`ؘNHmLH@:ePgdd t`HDJ_Z`ؘNHHH Hj @2ideg$gjKHBOjFm@?ePgddj @2iedgpP$g|ml@:e0g8ee@gud e]aܠeju @2ie d* ؙX B JNmg@:eHo J JH nXgJ@:e er\gBOajCm I$2)H2Il#J c" mz rXg*jKLC* r`g}jra rXg*kcXؙB JoNmg@:eJ "ؙ NؙmN "j jT @2i dejgDܜ$\gg8 IM@9eeiJa""E%%jAA aA)gnZXg\ggXBJ@:ee*jwd j\goXBJnmg@:e*ej @2idgҚe$\gP@=ee$\gP@=eeG@'@iJ!IҀ$\gP@=ee IJa\ggP@=evdej4 @2ideFg"$gg$\g3X7JMIg@\gpH$M@:evdj @2iedgX&gD JggpH@:eIeJ aP DL@8evd老 T`.lPX @:eIeejt @2id$gҚe$ggpH dM@:eHM@8eM "n ӑg@:evdjj @2iedgPHg $g:e@ Je* jOXؘ JNgHm@:eg8e@mxd j@xH2Ki ӂP\𸘝AM L@:eP Ҟe@=e J" ejS @2ide%g&2H2IkhJ$2! 0huG`\gp@@:ee6"FHiG/"$2 )H2I㆚HQC`IC``iC\g@@:e$2 )H2If㈚lhhvdj @2idgte `\e`?,eAjKlE\gؚXN Jomg@:eeeV"jMe|gj8Ҥ Ionmg@9ejonmg@9eme|ggO@?eeE=s8g!&s`S`lm"HIC`\gؚNXJg@:ejxdt`t`\gؚNjLn\gXm J:e@g&rXge "J *ejl&"H'"k %#i |gm8؛ INg9e@ e|g ؛ Nmg@9ee &"*ok\gؚX JNmg@:ee )m\ggO@?ej&ramJ*mkmEeAjmE\gmgO@?ee&r`R`kO#kmc`\gؚNIn\gm8g I@9eJe"ejl&"H("k &#i |gm8؛ INg9e@ e|g ؛ Nmg@9eeJ*ok|g؛X N Jmg@:eRearR a\gؚ N)Wejs @2ideg $gjOCm@?ePgddej3 @2iedgpP$g@,;:\"/[]?=State %d (%s) -> %d (%s) %s=(%lu)[] setappendBuffer %d (%s) %s Callback %d (%s) Out of memoryAt %s, byte offset %lu, %sERROR\r\n\t\x%02X%cmultipart/boundaryBODY_BEGINexpected '-' but got '%s'expected '\r' but got '%s'expected '\n' but got '%s'PART_INITexpected '%c' but got '%s'found header continuation line without preceeding header nameContent-TypeHEADER_NAMEHEADER_VALUEthe name exceeds the maximum allowed sizethe value exceeds the maximum allowed sizePART_BEGINthe value exceeds the maximum allow sizePART_DATAPART_ENDexpected '-' or '\r' but got '%s'BODY_ENDEOFexpected EOF, but got trailing junkparser is in unrecoverable error stateParsing bufferboundary 1boundary 2boundary 3start of multipart bodystart of boundarystart of header namereading header namefinding header name endstart of header valuereading header valuefinding header value endstart of part datareading part datastart of part boundaryreading part boundaryfinding part boundary endend of part dataend of final partend of multipart bodyparser error stateTUPLEthe key exceeds the maximum allowed sizeNAMEVALUEstart of tuple namereading tuple namestart of tuple valuereading tuple valueend of body ` **+(*4*@*L*d*x******++0+H+`+|++++,(,<,T,h,+|@ a $&&&&&&p&`&P&@&0& &&&%|@07070101AE227F0000A1FF0000000000000000000000016A426C2800000010000000FE0000000000000000000000000000001500000000usr/lib/libuuid.so.1libuuid.so.1.3.007070101AE1D1F000081A40000000000000000000000016A426C280002646B000000FE0000000000000000000000000000001C00000000usr/lib/libmbedtls.so.3.6.6ELF4p4 (p4X4X^nnS00000QtdRtd^nn ((() ) `R pFnn`$ () pPQppp ppppoo0Qoo$N2c46#.@yLi,U3}\HNL!BAx0]my!97- }O lR&'>FGPE%DX<=?; 'x2;T 0, sYw9rn7:E$-`1BM .g O8>f{  %4:)u+|JK i"[MDp$bvWW/5&hQawU(|VH\^3IRquAgC~Czh e#]mSakoc_ZQIj+(nNq*1{[ 6^8f)/"XbKSlJrPvTtV?5`j<@_Zp*~=YkeGddFotsz`R & F b p S "` 2 ܟ   e; n .a` a d M'5 "< `H | 8  tIX \ 4k 8 f$    L[T pF > f< @ $3$ 0( L' #   ].   E. 6^( ^ g 44   x'; \4 g,a    ' W8 M wZX k     ,)D I | $ l t  xc F@ %8  8U 1 '|- 4 Xt , 4X   dp ` %p, l  kh !<  F,   \ 4 ?8, `R &H6   IAd U$ '$2 )  B` D0S, f\ 8    { | WH F  V Р tS h  H" PxO K@ @ $ У [H H Kh #P H$D !$ HP : n3\    g H  &: &3D Pm  t `m 4X  0$ l$x &<5 @m 24 $q MH  4 # TaT @! $ oD aXB ȫP 4T 0<`  o#\x l !P . ( H0 -"  X 9  iq 2p 8  (( ppP M8 (    3hN OD` D Q ȩ< l P  ,     t, E  k     U >  ԡ` 4n@ [ W  V, H kQ P q8 , \\S, {   &%   n4  roP Tn #Կ| ^ fd zet T 4H3@ O%(  ` $ '2  T0 r v%@ , '& `$ T]x <x   *&% ' x8 $pL b ̦l bc x  %< $< |V l8 `XD @ <  #(* S    >h  m"@ n `P  DP -H T  Q38 ,   t L t  Y f&$H mdP G( 7  O# %U   ( FX H $ %$ 1   ] y     [   t 0  X| d`     $ X  !   Ip( |< @T PFI@Fl0Ff FFFFEEE E EE E] EpE `E PE-@E"0E E* EBED [D!D1DDD"D!D(pD"S `D(PD$@D" 0D DD4D C(CTC"C CXCUCC: pC`CPC @C%X  j"0C" Cw!C CBnBB;BHBTB B." BpB(`BPBj@B"^!0BK BBQ"B(A AA AA!A!AtA-pA} `ABPA! @A0A( A>#Ay% A$@ @@ @@>@u @:@q(p@"`@!P@@@s0@T @ @_fini__cxa_finalize__deregister_frame_info__register_frame_infombedtls_mps_reader_initmbedtls_mps_reader_freembedtls_mps_reader_feedmemcpymbedtls_mps_reader_getmbedtls_mps_reader_commitmbedtls_mps_reader_reclaimmemmovembedtls_net_initmbedtls_net_acceptgetsockopt__stack_chk_guardrecvfrom__errno_locationfcntlgetsocknamesocketsetsockopt__stack_chk_failmbedtls_net_set_blockmbedtls_net_set_nonblockmbedtls_net_pollmemset__select_time64mbedtls_net_usleepmbedtls_net_recvmbedtls_net_recv_timeoutmbedtls_net_sendmbedtls_net_closembedtls_net_connectsignalgetaddrinfofreeaddrinfombedtls_net_bindlistenmbedtls_net_freeshutdown__time64mbedtls_ssl_cache_initmbedtls_mutex_initmbedtls_ssl_cache_getmbedtls_mutex_lockmbedtls_ssl_session_loadmbedtls_mutex_unlockmbedtls_ssl_cache_setcallocmbedtls_zeroize_and_freembedtls_platform_zeroizembedtls_ssl_session_savembedtls_ssl_cache_removembedtls_ssl_cache_set_timeoutmbedtls_ssl_cache_set_max_entriesmbedtls_ssl_cache_freembedtls_mutex_freembedtls_ssl_ciphersuite_from_stringstrcmpmbedtls_ssl_ciphersuite_from_idmbedtls_ssl_list_ciphersuitesmbedtls_ssl_get_ciphersuite_namembedtls_ssl_get_ciphersuite_idmbedtls_ssl_ciphersuite_get_cipher_key_bitlenmbedtls_cipher_info_from_typembedtls_ssl_get_ciphersuite_sig_pk_algmbedtls_ssl_get_ciphersuite_sig_algmbedtls_ssl_ciphersuite_uses_ecmbedtls_ssl_ciphersuite_uses_pskmbedtls_ssl_write_client_hellombedtls_ssl_get_hostname_pointermbedtls_ssl_session_set_hostnamembedtls_ssl_start_handshake_msgmbedtls_ssl_write_versionmbedtls_ssl_validate_ciphersuitestrlenmbedtls_ssl_get_extension_maskmbedtls_ms_timembedtls_ssl_write_sig_alg_extmbedtls_ssl_tls12_write_client_hello_extsmbedtls_ssl_add_hs_hdr_to_checksummbedtls_ssl_finish_handshake_msgmbedtls_ssl_tls13_write_binders_of_pre_shared_key_extmbedtls_ssl_tls13_finalize_client_hellombedtls_ssl_send_flight_completedmbedtls_ssl_write_handshake_msg_extmbedtls_ssl_flight_transmitmbedtls_ssl_tls13_write_client_hello_extsmbedtls_ssl_get_ecp_group_id_from_tls_idmbedtls_ssl_tls13_write_identities_of_pre_shared_key_extmbedtls_md_hmac_resetmbedtls_md_hmac_updatembedtls_md_hmac_finishmbedtls_ssl_cookie_initmbedtls_md_initmbedtls_ssl_cookie_set_timeoutmbedtls_ssl_cookie_freembedtls_md_freembedtls_ssl_cookie_setupmbedtls_md_info_from_typembedtls_md_setupmbedtls_md_hmac_startsmbedtls_ssl_cookie_writembedtls_ssl_cookie_checkmbedtls_ct_memcmpmbedtls_ssl_set_timermbedtls_ssl_check_timermbedtls_ssl_encrypt_bufmbedtls_ssl_get_mode_from_transformmbedtls_cipher_cryptmbedtls_cipher_auth_encrypt_extmbedtls_ssl_decrypt_bufmbedtls_cipher_auth_decrypt_extmbedtls_md_get_typembedtls_md_get_sizembedtls_md_updatembedtls_md_finishmbedtls_md_clonembedtls_ct_memcpy_ifmbedtls_md_startsmbedtls_ct_memcpy_offsetmbedtls_ssl_flight_freembedtls_ssl_update_handshake_statusmbedtls_ssl_dtls_replay_resetmbedtls_ssl_dtls_replay_checkmbedtls_ssl_dtls_replay_updatembedtls_ssl_update_out_pointersmbedtls_ssl_flush_outputmbedtls_ssl_update_in_pointersmbedtls_ssl_reset_in_pointersmbedtls_ssl_reset_out_pointersmbedtls_ssl_get_bytes_availmbedtls_ssl_check_pendingmbedtls_ssl_get_record_expansionmbedtls_ssl_get_output_max_frag_lenmbedtls_ssl_get_current_mtumbedtls_ssl_transform_freembedtls_cipher_freembedtls_ssl_set_inbound_transformmbedtls_ssl_set_outbound_transformmbedtls_ssl_buffering_freembedtls_ssl_recv_flight_completedmbedtls_ssl_write_recordmbedtls_ssl_resendmbedtls_ssl_fetch_inputmbedtls_ssl_prepare_handshake_recordmbedtls_ssl_handle_message_typembedtls_ssl_handshake_wrapup_free_hs_transformmbedtls_ssl_write_change_cipher_specmbedtls_ssl_send_alert_messagembedtls_ssl_send_fatal_handshake_failurembedtls_ssl_close_notifymbedtls_ssl_writembedtls_ssl_handshakembedtls_ssl_get_max_out_record_payloadmbedtls_ssl_read_versionmbedtls_ssl_check_recordmbedtls_ssl_read_recordmbedtls_ssl_session_reset_intmbedtls_ssl_parse_change_cipher_specmbedtls_ssl_readmbedtls_ssl_handle_pending_alertmbedtls_ssl_pend_fatal_alertmbedtls_cipher_setkeymbedtls_ssl_ticket_initmbedtls_ssl_ticket_rotatembedtls_ssl_ticket_setupmbedtls_cipher_setupmbedtls_ssl_ticket_writembedtls_ssl_ticket_parsembedtls_ssl_ticket_freembedtls_x509_crt_initmbedtls_x509_crt_parse_dermbedtls_x509_crt_freembedtls_md_info_from_ctxmbedtls_ssl_conf_cidmbedtls_ssl_set_cidmbedtls_ssl_get_own_cidmbedtls_ssl_get_peer_cidmbedtls_ssl_tls_prfmbedtls_ssl_get_extension_idmbedtls_ssl_optimize_checksummbedtls_ssl_add_hs_msg_to_checksummbedtls_ssl_reset_checksummbedtls_ssl_transform_initmbedtls_cipher_initmbedtls_ssl_session_initmbedtls_ssl_initmbedtls_ssl_session_reset_msg_layermbedtls_ssl_conf_endpointmbedtls_ssl_conf_transportmbedtls_ssl_conf_dtls_anti_replaymbedtls_ssl_conf_dtls_badmac_limitmbedtls_ssl_set_datagram_packingmbedtls_ssl_conf_handshake_timeoutmbedtls_ssl_conf_authmodembedtls_ssl_conf_verifymbedtls_ssl_conf_rngmbedtls_ssl_conf_dbgmbedtls_ssl_set_biombedtls_ssl_set_mtumbedtls_ssl_conf_read_timeoutmbedtls_ssl_set_timer_cbmbedtls_ssl_conf_session_cachembedtls_ssl_conf_ciphersuitesmbedtls_ssl_conf_tls13_key_exchange_modesmbedtls_ssl_conf_cert_profilembedtls_ssl_conf_own_certmbedtls_ssl_conf_ca_chainmbedtls_ssl_get_hs_snimbedtls_ssl_set_hs_own_certmbedtls_ssl_set_hs_ca_chainmbedtls_ssl_set_hs_dn_hintsmbedtls_ssl_set_hs_authmodembedtls_ssl_set_verifymbedtls_ssl_conf_has_static_pskmbedtls_ssl_conf_pskmbedtls_ssl_set_hs_pskmbedtls_ssl_conf_psk_cbmbedtls_ssl_get_mode_from_ciphersuitembedtls_cipher_set_padding_modembedtls_ssl_cipher_to_psambedtls_ssl_conf_dh_param_binmbedtls_mpi_freembedtls_mpi_read_binarymbedtls_ssl_conf_dh_param_ctxmbedtls_dhm_get_valuembedtls_ssl_conf_dhm_min_bitlenmbedtls_ssl_conf_sig_hashesmbedtls_ssl_conf_sig_algsmbedtls_ssl_conf_curvesmbedtls_ssl_conf_groupsmbedtls_ssl_set_hostnamembedtls_ssl_conf_snimbedtls_ssl_conf_alpn_protocolsmbedtls_ssl_get_alpn_protocolmbedtls_ssl_conf_max_versionmbedtls_ssl_conf_min_versionmbedtls_ssl_conf_cert_req_ca_listmbedtls_ssl_conf_encrypt_then_macmbedtls_ssl_conf_extended_master_secretmbedtls_ssl_conf_max_frag_lenmbedtls_ssl_conf_legacy_renegotiationmbedtls_ssl_conf_session_ticketsmbedtls_ssl_conf_tls13_enable_signal_new_session_ticketsmbedtls_ssl_conf_new_session_ticketsmbedtls_ssl_conf_session_tickets_cbmbedtls_ssl_set_export_keys_cbmbedtls_ssl_get_verify_resultmbedtls_ssl_get_ciphersuite_id_from_sslmbedtls_ssl_get_ciphersuitembedtls_ssl_get_versionmbedtls_ssl_get_input_max_frag_lenmbedtls_ssl_get_max_in_record_payloadmbedtls_ssl_get_peer_certmbedtls_ssl_handshake_stepmbedtls_ssl_handshake_client_stepmbedtls_ssl_handshake_server_stepmbedtls_ssl_tls13_handshake_client_stepmbedtls_ssl_tls13_handshake_server_stepmbedtls_ssl_handshake_freembedtls_dhm_freembedtls_ecdh_freepsa_destroy_keymbedtls_ssl_session_freembedtls_ssl_freembedtls_ssl_context_loadmbedtls_ssl_config_initmbedtls_ssl_config_defaultsmbedtls_x509_crt_profile_suitebmbedtls_x509_crt_profile_defaultmbedtls_ssl_config_freembedtls_ssl_sig_from_pkmbedtls_pk_can_dombedtls_ssl_sig_from_pk_algmbedtls_ssl_pk_alg_from_sigmbedtls_ssl_md_alg_from_hashmbedtls_ssl_hash_from_md_algmbedtls_ssl_check_curve_tls_idmbedtls_ssl_get_psa_curve_info_from_tls_idmbedtls_ssl_get_tls_id_from_ecp_group_idmbedtls_dhm_initmbedtls_ecdh_initmbedtls_ssl_setupmbedtls_ssl_session_resetmbedtls_ssl_context_savembedtls_ssl_check_curvembedtls_ssl_get_handshake_transcriptmbedtls_ssl_parse_sig_alg_extmbedtls_ssl_derive_keysmbedtls_ssl_set_calc_verify_mdmbedtls_ssl_psk_derive_premastermbedtls_ecdh_calc_secretmbedtls_ssl_write_certificatembedtls_ssl_handshake_wrapupmbedtls_ssl_write_finishedmbedtls_ssl_parse_finishedmbedtls_ssl_get_key_exchange_md_tls1_2mbedtls_ssl_tls12_get_preferred_hash_for_sig_algmbedtls_ssl_parse_server_name_extmbedtls_ssl_parse_alpn_extmbedtls_ssl_write_alpn_extmbedtls_ssl_session_copymbedtls_ssl_set_sessionmbedtls_ssl_get_sessionmbedtls_ssl_check_cert_usagembedtls_x509_crt_check_key_usagembedtls_x509_crt_check_extended_key_usagembedtls_ssl_verify_certificatembedtls_x509_crt_verify_restartablembedtls_pk_get_typembedtls_ssl_parse_certificatembedtls_ssl_export_keying_materialmbedtls_ssl_tls13_exportermbedtls_ecdh_make_publicmbedtls_pk_sign_restartablembedtls_ecdh_read_paramsmbedtls_pk_verify_restartablembedtls_pk_verify_extmbedtls_ssl_set_client_transport_idmbedtls_ssl_conf_dtls_cookiesmbedtls_ecdh_read_publicmbedtls_pk_verifymbedtls_ecdh_setupmbedtls_ecdh_make_paramsmbedtls_pk_signmbedtls_ssl_conf_preference_orderpsa_status_to_mbedtlspsa_generic_status_to_mbedtlspsa_to_ssl_errorsmbedtls_ssl_tls13_hkdf_expand_labelpsa_key_derivation_setuppsa_key_derivation_abortpsa_key_derivation_input_bytespsa_key_derivation_output_bytesmbedtls_ssl_tls13_labelspsa_import_keypsa_mac_computembedtls_ssl_tls13_make_traffic_keysmbedtls_ssl_tls13_derive_secretpsa_hash_computembedtls_ssl_tls13_evolve_secretmbedtls_ssl_tls13_derive_early_secretsmbedtls_ssl_tls13_derive_handshake_secretsmbedtls_ssl_tls13_derive_application_secretsmbedtls_ssl_tls13_derive_resumption_master_secretmbedtls_ssl_tls13_calculate_verify_datambedtls_ssl_tls13_create_psk_bindermbedtls_ssl_tls13_populate_transformmbedtls_ssl_tls13_compute_handshake_transformpsa_get_key_attributespsa_raw_key_agreementmbedtls_ssl_tls13_compute_resumption_master_secretmbedtls_ssl_tls13_compute_application_transformmbedtls_ssl_tls13_export_handshake_pskmbedtls_ssl_tls13_key_schedule_stage_earlymbedtls_ssl_tls13_hello_retry_request_magicmbedtls_ssl_tls13_generate_and_write_xxdh_key_exchangembedtls_ssl_tls13_fetch_handshake_msgmbedtls_ssl_tls13_is_supported_versions_ext_present_in_extsmbedtls_ssl_tls13_crypto_initmbedtls_ssl_tls13_check_received_extensionmbedtls_ssl_tls13_write_finished_messagembedtls_ssl_tls13_handshake_wrapupmbedtls_ssl_reset_transcript_for_hrrmbedtls_ssl_tls13_process_certificate_verifymbedtls_ssl_tls13_write_change_cipher_specmbedtls_ssl_tls13_process_certificatembedtls_ssl_tls13_write_certificate_verifymbedtls_ssl_tls13_process_finished_messagembedtls_ssl_tls13_check_sig_alg_cert_key_matchmbedtls_ssl_tls13_write_certificatembedtls_ssl_tls13_read_public_xxdhe_sharepsa_crypto_initmbedtls_pk_get_bitlenmbedtls_pk_sign_extpsa_generate_keypsa_export_public_keylibmbedx509.so.7libmbedcrypto.so.16libgcc_s.so.1libc.solibmbedtls.so.21GLIBC_2.0(ii )nn$n4nDnTndntnnnnnnnnnoo$o4oDoTodotoooooooooht' '#C!+8%(`%!+0VIG+D@샙!(%%  %0! >!(w+/@!3̂ %0 @ $ B+ b1#b+T-@  %<840,($ @'!##b%%8%%(+@!3̂$%` $ $$0P''%0@'9'i% ` 0# D#D'& @&8($%8`%( T$&%@@0B,@B&+P`++n%DDCCc$B$"P''% %09',@'04"&@܃%(8 % @%@ @0܃8 %(@%@&@0 % T'0$}2!(C&+Uw@c$%08! C %(8$!0%@!f38䂙T'8< %(`%@+@0p 8%@01@ &<! D+@+d!3b<+d@<!f3<̂1,%(L s& #0!C %%  #$0g< % <+0u`&3Cs$$< %(0 % '0 % % @0  % @ 0<@\'!'p0htld`\XTPL$ ӌ`%ŒÌ+ C#CČ+D@%% !cF07%@tE& &1@0$&B,@$U@+"@ C!B$+"@$<5 $W&+@+w!3b!û%0%(` % 0!uCԂ#CF`'%8%( D&%@q@0`q!F<@% Cc$!f& C'B8#8# % '%8#C'8$G$d%CB##%b'$0$$, # $+%@#8%%H&IB@#@#%%@`#I'@$H$H#%I!cc0%@&h#@#HB%@ #B#%%C$B$+`!"%`&"B##%QÏ'$6$q<#(@%eQPC$bh@b$!D^E$%`c$$Lbtplh`\XTP%dx'DCC,<`B$c$t&C+ C$#CF '%8`$E&9'q% 0BPG'%0d'9'% `E 0!F# d#d`'($ %8`%(  D&%@@0$$!@!u3̂B%##BPG'%0d'9'W% 0d@T&܃%(  % %@ @0܃%(` % %@@0 E  '0$&DB8#8#%%8`#D'8$G$ %D B#(BPG'%0d'% 9'tx| 0@DH d $C0@$XHB@D T0h'%  L0@E<x%  %0%@ @0ă@B&D%0%( % @%@Q@0 <t'0 E@ '0 E @0b$!DE$%`c$$%`%`b$B$䂙 'P%(  % %@q@0p % %@0k@ E%0! d %( 0 E@ % $0U<<Hă!S.$ B$D\%0@ %(%@@0Lt'1,!$@L  '\+@0@Ps&+=@ЂD <%@$@0<%( P%@@0%`H&CB # #% L@'%8%0 ' +v@0ăD$ !(%@@0 <0f E$=Xz$ E Pt0P D%@@0̃ D%@@0XTăD !(F%@@0ăL@ D%@@0@ D%@@0p D0< %@0+ E@\'% `%( 0 F@ % `@0% E % `0 E @0%Q#$P $0 <@Q'!'$ %삙%  삙 % $ ('@ 4$%R#t$C#% Xh!DD$l`TDt|pbc%C@$L$C|㎬' $$fL<G$PAbD%0U% @Db$B,@$T@$ $b$ b8`!ebB$B0b@ c% b8B,@+(D$$bP@$t$|`%+@!+@̂4$b C$^b쀙T@B,@% XhP!CHE$DlT!fp|tX耙% {@$3Cmd(i$g,c\ &_TC\`XYY =, `$#'&*):(2%g%0%i `;#=e$+0!#<f!+ %8`\D !(%@+@+4&+"@%'&&% $#&% #$FFEE DD1&C C'B$$#@&$#DDCC#8'C$ $$&$\DTY 8@8#00$$|$$<$< '!'$ $%%@@|$)b̀4H(< C$b`@@@@@@@@% B$$%  ('% B$B0@$ $$% $<'!'<840,($ @% Q$%"%$bЀx;$$$$$X  PiS$j% @`|RHQ$C$$<840,($ @'$P% @|2QVR$tB("@x+ %@+@!+@!3̂%0  % #Qx %( ~@x% %(% xSWB,@$b$@$-D̀t*d$ cb$x% E% $~C|@<840,($ @'t b`$HD$b$̀d$$>% @x${C$xt@8N@ BKQx% G@i<Cc` E$#$\d$tXBB0@$$P$$NC<L%x!QxF% 3n̂ $b̀Zx $:$$<'!@%'̀$%$C@ '$&0#^8'%0@%(M% %@$@08<+b @|":E|$%(<'8$&$ %8  $%( ! @08<D$x"B$bY % @d$3WC$%@$<< '!'0d`\XTPLHD@%",@%$% Y% %%@ @0d`\XTPLH%Dh'9'U% %@@0tb%|2"&Rb#%CX#C$Y % @d$% Y $@d$cY"b$cZ"bc["bl$$d#d#d#%$&$r&(<'$$ %8` $e& ! $%@@0<T$$$,%0%(@% %@@0X$r!q$b #(S+ E#r#D@0$#8*`0G+($h$t$@Q$ % @&#PB,2@&c4#$3%F|B0"ee# D$ b(@$ &|""" * &1,@$&+@̂+@!+N̂ $b7`#PB(@$2%00|&0#P*S``TB(@&| |#B#$$B($@#  &#Cc(|"`x"  %b|&s2#P*S@t3 `T%,( %`$0',@$ ||"#U,# "  &"&+E`&+`-&3F8#& $  JJII HH$G GB$+f@h"&3%(%`0$  HHGG FF$C CB$`$c,]h |"l"m`p abc%%d&$+ `T$ $% @@h"D h$%0 %(%@@3!0`$#PB,F@$%b%ct3`&#T+S7@T$ %(`% @@p"+T@!+@!3̂%(%0` %#TB, @&|"x"b#PB,@$||"##"&P&B#&9P"$,( %`$0'8#&3O-&!3 !$b#PR*@%||"##"+N@]&3bK%($ %(`% @;@"+P#@!+@!+N̂%( %0`%#T$ %(`% @$@p"+P@+!3̂%0` %(%3!3! h$삙 h$h @!3̂$$$@S `hKB$ bĂ % `%(@ % `T$ %&% @*@B+P@!+@!3!̂%0  %(@%,($ 0'3̂ hK&0Ă % %(@ % P$$<@< Ԝ'!'(%$, %%%<@,$Ă 1&C$!c,`+,($ $0', ($%0'*%(*%( <Ҝ'!,@$C,`Pc$!CB@B,@ %$$ +(|%(+(@(D|%E`dh$(0@lB4@$0@B%%<ќ'!0@XD%<ќ'!$ $C$ CFB$(KB$CKB$0KB$ KB$<<ќ'!C`c((`,@BB$C,`Pc$!C@$B@E, e4`cc$d, P$!dc+ b d4`@$@$+ b d BB$C,`Pc$!CB@$<@М'! BB$C,'`Pc$!CB, `cc$e,P$!ec+(b e4 `cc$d, P$!dc+ b d@$+ b d@$8 `"c`@+ Cb0%`%@b0<0Ϝ'!' $%@E,@$@# E`%Pc$b% @%$ ('% % v%@@+Q `#"+0 "% |@&$b(% $C$-@$$%  ('8 cb x+% %@@$h% $$b,% @$%@$cb$ %  ('09% 4"0% $<˜'!%'$ @% C$b$r@8Q% %$ ('T@$X@$$$<˜'!'8$ b "T@%% T CJ`삙PB@X 삙 P$ $$& 0$&L \$&L $&삙 l$p$ t%0삙삙%  삙 $1$% @d"@ T$삙 T$$ % $$ (' X$8B삙 T$8B `$$ (' @@% (삙 8(8)QTPLHD<840%@X'\@!&3Ẑl@!f3ĵ$3eG%!pc$ $<$'!$ %(<'!'H8<40,($%%%%%( L% n@$B$T B$X$ $$$`4C$'NB$%D$IHG FB$ihg fDc$$P$ '$%   @T$_% $$"$$$bPc$QB$4pPB$%$F<840,(@'$$2cX$+dpQB$$QB$$\$ $% %(`% B$T B$X$ $$$`4Pc$CPB$ &#c(8`|D$:f|+(C2F#+$+$@+D!+PN̂%0  %(@8c%d$#@p<840,(@'|:d|u".@&%0 %( % !@!Q3!$$1@|D@RD@%$ ?$+$@̂ %0R^@!P#b+pP`,#!b"e#T$!bd#!bP$ E! +@!+@!+@̂4"B$"%,($ 0'E|5@R@$tb@%% %($&tŠ%$'% $#"$" $b",B$($ "0',($ $0'C$f$+Fj@ D&+@^b$3B D&%%(@ $JI HGJIH GB$ K$c$+R@@B&3b% h$gf edgfe dc$GFE DhB$t@lBD&|+>@@Cl!3b̂l %0(0h%8` 0$8$% 9'(% @삙 %@TPLHD@<8%4X'v%0% b8>BF@$t cb$+F`!@!Eg$+8!8d$%g|c0! + B$$! !(%e|c0!D!C̀2$$% $($%@@(|$b$ e$$t̀$B$ bD%2% ~(8 bC$c,`B$B,@% `@(.@(BC$@c,`L"dbE$+`F!3̂  e$T(&$܂,C8(B@$#8!0L' $%@<@( eȁ% %@5@(L!T$$btB$$$y% %@"(8́UH%@@( C,`B$B,@8>C`|Cz`dcp`T'YL'%( % %@@(8 $ $ $C8d@|DaЁx(¢8R@L|DO$,e (e#$uAc$B$H'%(@%8 %0%@@(H |:|B$de$$"bԁ% B$B,܂,C$(B$L' $%@@(8,C$(B@$$ $%@@(]$td$tDЁB$+ b"d&3D h$&B$%!rB$% 44%8`$%0@+(Ư ǯ<`+9@+6̂4(%(@L%0% @((R&QB$!r4rb%Bcb|R2%bW&|+ B07D,`4!bB!\@ B @̀@$4C#B&B,T&@!w $$ BC̀! @n$p@e&f!,`B&j$8C8!F8$+e@+!+f@̂ #(BB0@̀@$8CVB.H@̀bc%C|B0C&?CB&~=2$ՎRb&8ՎL&Ă % (t8%0 %(@($@̀e$!R2$7b&!(E3ÈCd,B$8C B@$C̀cb/$B@̀@$8~ C${b$C̀b@($t8B@́@%$ cb̀($$% $($  $$!e$DF!d$F$UF$FB$B,@o$#B(@̀bd%D|c$B0# c* !bD8肙%0`D' $=@(8pU% 6@(%(% 0@( B$B,@$ c@b$84hTD+v@#vB(@$Ւ’%t؁|3<(243%@4@(0$D$($̀$ $$48@E$:b@̀C`̀/$C`B$~؃DB$4&%  D@(Dc&+bJ`̀CD%d|u0B$#u@SD<8܁!8C#T'H'%(`% @(؃4 % A@(4$EbDH%0`%( % (%@=`̀3$$% %`(CVb8삙 D8(@@ e% $@!3̂@!+@̂4%0U $ $& $+<@!3:̂tc`#B(@̀bd%D|c$B0#c*b@D;L$2$% $n(.Bt%0@%( $(@( $?b,@ B D%DB04 Db$̀F$$% $N(S*S@R&8삙 D(8$T %(`% @(@+R4@+D!3B̂%(@ %0`($l% %@)@(% $(Z $#B(x@̀bd%D|c$B0#c*b@$kD$ $̀n$$j% $(@!S3̂ $8s% %@c@(̀P$$U% ($4 $$:C$!C3'B,@̀/$ ̀/$$<% $($C $XB@b $%@$C$/`̀/`$/`/$$C$82B$B,@'B0$C'B,̀P$$% ($$̀P$$% ($$̀($$% $(X%  L( % @P@(DdH%8%0L' $%@(@U&4<%p:@“B0$C4@4Sďm@ V<%p׏ tޏ4$'#d!b%8%0%( 9'% @<2%B@( $%h@%@ $L%@@(|% @%@$x%@@(P% %@5@($%XQ%$8%@@(PT!C+ bd(% U$+ uTB%|2b$+T{@!8+0@H`#B(q@&+o@%|2#+Vf@% %C|H^0 % %@p@($!+4@0% t7c@%@ $`l[@%@$XlS@%@$P$R%$N%F@$H"$B$C% =@%@8@|B@BO@$7%t $c0b$C$$Bc$C8@% @(;% 1@(%@$($i% |`!bB,i@$$/$]% y$tB?@ $$p%@%@BB0@@D$%8!$j$@$C$$YT8Q$+Q7@b$+T4@% T$ %(% @(@Pb+Qf@+$!3"!4̂%(  %0(%+Q@#QB(@% 5&+U@4"%|2#U+T @!H`+@#B(@&+@%|2#+W@% %|H2<)$%0 $% %@@( $!%0%(I% %@@(|$2$Ұ% o($F$˰% $"&"&3D i$%`@!4+N̂+8@!3w6̂$t#@0삙HC<B$$bFb% uPC4c`CT$m% @%@8$BB0@$4 $l@$$/$% $($ $% $^+7|.z@% &+%w@$"% |B0&+bk`!+(Ehf&+Vc`#V+Wa@% ՏvĂ % H('TUHb B0O@`8$LH>C $% a@%@c$$TTE% 4($T\,% %@N@(`D@$% %@E@(x%(% (9'J% :@%@84ccC$2$$,$t%0%( % @(@<B4<+.% 8%De|U0uxb4s@pCp`BB0$C+%l@(*~8Bj@4gpe@B0$C`@4֓@( B<%C&8<c c%d\b4% f@(%3$a$bB0@$b8@T^+.% %C|2 z$B, @$B,@'ė-$B,@$%0%(V(ė$8<Ct%H<U@(%*F@(~@(< B$ef+`.^% &+[@$%C|3#+TQ@8삙 Ď($T %(% @(@®+U@+!+@̂%0 %(%(ަ0J%@@!+@̂4$A%@~{+$;%@V%+.% 8%D |<c0d&$ D$ DD0$$Db$B,@#0)% @(%$($% $$n$% $$%@< ͜'!' %($,%%% @$ $ %@@"&6`0$+(C+(ba%&+(e+(bV$$eg fegEEeGfG e FFc$E EdB$cb$&C+@@a +D@!P3̂%0 %(@,b&p$( 0'$+(C+(ba%&+(e+(b$$eg fegEEeGfG e FFc$E EdB$cb$&C+@a !+(E$+(E$!3B̂<$˜'!'\ $ % @  '<ʜ'!'($ ,%%(%%% @|$td c$$cD,($ 0'$ $+% $<,ʜ'!'09`+ @$$2$$ 'E$+@#0%E|B0+0$!+(#(H%(+HF #PF *%((|0+PE@+ $ J %H(!@++($h% '<ɜ'!`'<| "x@'<'$tw%%@@ t"b|x%@'8P'B@$%0` E8'% %@@ 8'B,% `4'"9'%0<@!S+u@ b*s@UB%8|D&c0@(E$q@Dm$DhB$؁40, 2%@%@S R$<%4؃%(hD $N@ (+<@b&B,9@$B&+4(BC%C|R0b&+R,@2$D'0,@$'%8`%( % +@ $J%(4d%8hF(D$ % @ `@<$% %@] $2$% $U $$ $<$3$% $F $P$% ? XB@|< U$ $$ U$ $$< U$ $$<3%d<4!dd,HWc$!CBLH' <Ŝ'!'D'$<840,(' $ % @<840,($@'8n`!"|rk@R+ ^<Lf$+DZ@8Pe3&&+ea@!f+@!3b!f̂ % `%+E@<#B(B@8X@b&+;`# F$+6`$DCF ED$+@@+!+G@̂ R&@#Sc$$%x =$%x <$%x ;$%x :$%x 8$%x 7$%x 6$%x 2$%x 1$%x 0$%x /$%x .$%x -$%x ,$%x +$%x )$%x ($%x '$%x &$%x %$%x $$%x #$%x "$%x !$%x  $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $' 'unknownTLS1-3-AES-256-GCM-SHA384TLS1-3-AES-128-GCM-SHA256TLS1-3-CHACHA20-POLY1305-SHA256TLS-ECDHE-RSA-WITH-CHACHA20-POLY1305-SHA256TLS-ECDHE-ECDSA-WITH-CHACHA20-POLY1305-SHA256TLS-PSK-WITH-CHACHA20-POLY1305-SHA256TLS-ECDHE-PSK-WITH-CHACHA20-POLY1305-SHA256TLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHATLS-ECDHE-ECDSA-WITH-AES-256-CBC-SHATLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHA256TLS-ECDHE-ECDSA-WITH-AES-128-GCM-SHA256TLS-ECDHE-ECDSA-WITH-AES-256-CBC-SHA384TLS-ECDHE-ECDSA-WITH-AES-256-GCM-SHA384TLS-ECDHE-RSA-WITH-AES-128-CBC-SHATLS-ECDHE-RSA-WITH-AES-256-CBC-SHATLS-ECDHE-RSA-WITH-AES-128-CBC-SHA256TLS-ECDHE-RSA-WITH-AES-128-GCM-SHA256TLS-ECDHE-RSA-WITH-AES-256-CBC-SHA384TLS-ECDHE-RSA-WITH-AES-256-GCM-SHA384TLS-PSK-WITH-AES-128-GCM-SHA256TLS-PSK-WITH-AES-256-GCM-SHA384TLS-PSK-WITH-AES-128-CBC-SHA256TLS-PSK-WITH-AES-256-CBC-SHA384TLS-PSK-WITH-AES-128-CBC-SHATLS-PSK-WITH-AES-256-CBC-SHATLS-ECDHE-PSK-WITH-AES-128-CBC-SHA256TLS-ECDHE-PSK-WITH-AES-256-CBC-SHA384TLS-ECDHE-PSK-WITH-AES-128-CBC-SHATLS-ECDHE-PSK-WITH-AES-256-CBC-SHAclient finishedserver finishedkey expansionDTLSv1.2unknown (DTLS)TLSv1.2TLSv1.3master secretextended master secret++DOWNGRD,0$(k 9}sw]aSIME+/#'g 3|rvE\`RHLD86mqg75lpf=52*.&{yu_cQKO=</1)-%zAxt^bPJN<oinhkejd;:9-; .,ڢ!h4b)Ngt ;"QJy4:C0+ m_7O5mmQE䅵vb^~LB7k \8kZ$|KI(fQ[=|cH6UӚi?$_e]#ܣbV R)pmg 5NJtl!|2^F.6;w,']oLR+X9I|j&rZhD't'D'D'D''D''D'D'D'D'D'D'''L'    0@  0@   A+,Ԅ0H $ԉdX̋ԙp$\ԏȣܨ Xh  ܮ0t(((((((((p((H((((( (((((((((((л((((((((((((((((((LDOWNGRD 0@  0@tls13 finishedresumptiontraffic updexporterkeyivc hs trafficc ap trafficc e traffics hs traffics ap traffics e traffice exp masterres masterexp masterext binderres binderderivedTLS 1.3, client CertificateVerifyTLS 1.3, server CertificateVerify@<@@@t@@p@@@@@@@@@d \\\\\\\\\d \\\ \\\\\\\\\\\\\\\\\\\\\\\\\\\\\x\\\\\T||| 0@  0@%""8#h###%$$P%p%% '''''H'D''%H'D'''H'D''% 0@  0@DOWNGRDIIHII 0@  0@!tae¢z^ Ȩ3RRF F FM FM GM LGM tGM  G G#G +H $@H ,hH HH'H /I ((I 0PI xI I I I IJ78J 8`J 5J6JhKht]TaL'"nnT\ȫUpVn``h $44t 8ȩ`У M0$ ,ԡܟ;HРHx@ o$qrp H"&$'  $n\tX0438̦3dH3q^aAxcQhNxO$fIF2K$3Sppp28U[tIYD`X XBԿ< PDt 8%%$:3$t<5H6&5;$22|-*@ 74PF@F0F FFFEEEEEEEEpE`EPE@E0E EEEDDDDDDDDpDS`DPD@D0D DDDCCCCCCCCpC`CPC@CX0C CCCBBBBBBBBpB`BPB@B0B BBBAAAAAAAApA`APA@A0A AAA@@@@@@@@p@`@P@@@0@ @@ht07070101AE228B0000A1FF0000000000000000000000016A426C280000000C000000FE0000000000000000000000000000001300000000usr/lib/libss.so.2libss.so.2.007070101AE2268000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001000000000usr/lib/dnsmasq07070101AE2269000081ED0000000000000000000000016A426C2800000485000000FE0000000000000000000000000000001F00000000usr/lib/dnsmasq/dhcp-script.sh#!/bin/sh [ -f "$USER_DHCPSCRIPT" ] && . "$USER_DHCPSCRIPT" "$@" . /usr/share/libubox/jshn.sh json_init json_add_array env hotplugobj="" oldIFS=$IFS IFS=$'\n' for var in $(env); do if [ "${var}" != "${var#DNSMASQ_}" ]; then json_add_string "" "${var%%=*}=${var#*=}" fi done IFS=$oldIFS case "$1" in add | del | old | arp-add | arp-del) json_add_string "" "MACADDR=$2" json_add_string "" "IPADDR=$3" ;; esac case "$1" in add) json_add_string "" "ACTION=add" json_add_string "" "HOSTNAME=$4" hotplugobj="dhcp" ;; del) json_add_string "" "ACTION=remove" json_add_string "" "HOSTNAME=$4" hotplugobj="dhcp" ;; old) json_add_string "" "ACTION=update" json_add_string "" "HOSTNAME=$4" hotplugobj="dhcp" ;; arp-add) json_add_string "" "ACTION=add" hotplugobj="neigh" ;; arp-del) json_add_string "" "ACTION=remove" hotplugobj="neigh" ;; tftp) json_add_string "" "ACTION=add" json_add_string "" "TFTP_SIZE=$2" json_add_string "" "TFTP_ADDR=$3" json_add_string "" "TFTP_PATH=$4" hotplugobj="tftp" ;; esac json_close_array env [ -n "$hotplugobj" ] && ubus call hotplug.${hotplugobj} call "$(json_dump)" 07070101AE22F90000A1FF0000000000000000000000016A426C2800000012000000FE0000000000000000000000000000001700000000usr/lib/libnftnl.so.11libnftnl.so.11.7.007070101AE2031000081A40000000000000000000000016A426C280000C336000000FE0000000000000000000000000000001B00000000usr/lib/libjson-c.so.5.4.0ELF4t4 (pXXXppppHHxxx00xxxQtdRtdxxx P ! d* x|8  L(ppp p]pp$po'ooo'ood%hpF~0Lq$ BP7uHvJjki:G{WT_DZrRsfe,<*zltA-[oV/`&Kx\^ ];w|"!3( =>UCa4SOX+ myEb.}g?6I 'n1d5cMY#NQ8)9@%2d* d* N 9} N 5. %/ X > > 9G i6 , -1  9 / X %< m. B /* ~=$ 1 | P %. qQ$ D =6 }X I X  Kݍ^ I, aEL ] 7* QK B$ >$ fy0J  !F || X b]  Q~  !x %< e tEH(  Q$ ; }$ j UF ViMN Jq+t 0 U< u2@ ! ݁@ < |P, 0UCB P$ QZH" m;  uf Y$ A a .* | I/ u8 y,t 0J JR YD mH @i=r M%0R E& MQ$ 2/ ZP u.x YN MO$ a+$ A1$ _^ U  | Xx 4ً qݏ\ 1C$ B8 HC e K  C* mM4 <   e =} w Wx 4 > X HH 03 $ I U N& NB 5& 3qO  ]F  )Q$ QX, A}& ^)H oB$ Q$ Tu< M& e, ? 0 U. uN: Nr y; j ]Y eP$ p  p ,\ $  q& O}P G A4 E/ hAD EL Z v %> M X0 e X 7݂v  <  Чv z 1 p``VP @H0 0 o Ц I  a ph`p P@<0Q   8( Х^G?w "!p `P @ 0N +  Y ФZ "$4"  p` P@ 0 _init_fini__cxa_finalize__deregister_frame_info__register_frame_infoarray_list_new2mallocarray_list_newarray_list_freearray_list_get_idxarray_list_shrinkreallocarray_list_put_idxmemmovearray_list_addarray_list_sortqsortarray_list_bsearcharray_list_lengtharray_list_del_idxmc_set_debugmc_get_debugmc_set_syslogmc_debugvsyslogvprintfmc_errorstderrvfprintfmc_infojson_c_versionjson_c_version_numjson_object_free_userdataprintbuf_memappend__stack_chk_guardstrlen__stack_chk_failjson_object_userdata_to_json_stringmemcpyabortstrchrstrstr__gtdf2strcat__tls_get_addrjson_object_double_to_json_stringjson_hex_charsjson_object_getjson_object_putprintbuf_freelh_table_freejson_object_is_typejson_object_get_typejson_object_get_userdatajson_object_set_userdatajson_object_set_serializerjson_object_to_json_string_lengthprintbuf_resetprintbuf_newjson_object_to_json_string_extjson_object_to_json_stringjson_object_new_objectlh_kchar_table_new__errno_locationjson_object_get_objectprintbuf_memsetjson_object_object_add_exlh_table_insert_w_hashlh_table_lookup_entry_w_hashstrdupjson_object_object_addjson_object_object_lengthlh_table_lengthjson_c_object_sizeofjson_object_object_get_exlh_table_lookup_exjson_object_object_getjson_object_object_dellh_table_deletejson_object_new_booleanjson_object_get_boolean__nedf2json_object_set_booleanjson_object_get_int__ledf2__gedf2__fixdfsijson_parse_int64json_object_new_int64json_object_new_intjson_object_new_uint64json_object_get_int64__fixdfdijson_object_get_uint64json_parse_uint64__ltdf2__fixunsdfdijson_object_set_int64json_object_set_intjson_object_set_uint64json_object_int_incjson_c_set_serialization_double_formatjson_object_new_doublejson_object_new_double_sjson_object_get_doublestrtod__eqdf2__floatdidf__floatsidf__floatundidfjson_object_set_doublejson_object_new_stringjson_object_new_string_lenjson_object_get_stringjson_object_get_string_lenjson_object_set_stringjson_object_set_string_lenjson_object_new_array_extjson_object_new_arrayjson_c_shallow_copy_defaultjson_object_get_arrayjson_object_array_sortjson_object_array_bsearchjson_object_array_lengthjson_object_array_addjson_object_array_insert_idxjson_object_array_put_idxjson_object_array_del_idxjson_object_array_get_idxjson_object_array_shrinkjson_object_new_nulljson_object_equalmemcmpjson_object_deep_copyjson_number_charsjson_object_iter_beginjson_object_iter_endjson_object_iter_nextjson_object_iter_peek_namejson_object_iter_peek_valuejson_object_iter_equaljson_object_iter_init_defaultjson_tokener_error_descjson_tokener_get_errorjson_tokener_resetjson_tokener_new_excallocjson_tokener_newjson_tokener_freejson_tokener_parse_exuselocaleduplocalenewlocalefreelocalestrncasecmpstrncmpjson_tokener_parse_verbosejson_tokener_parsejson_tokener_set_flagsjson_tokener_get_parse_endjson_util_get_last_errvsnprintfwrite_json_c_strerrorjson_object_from_fd_exreadjson_object_from_fdjson_object_from_fileopenclosejson_object_to_file_extjson_object_to_fdjson_object_to_filejson_parse_doublestrtollstrtoulljson_type_to_namejson_c_visitlh_ptr_equaljson_c_get_random_seed__sync_val_compare_and_swap_4lh_char_equalstrcmpjson_global_set_string_hashlh_table_newlh_kptr_table_new__muldf3lh_table_resizelh_table_insertlh_table_lookup_entrylh_table_delete_entrysprintbufvasprintfgetrandom__stat_time64__time64getenvjson_pointer_getjson_pointer_getfstrrchrjson_pointer_setjson_pointer_setfjson_patch_applylibgcc_s.so.1libc.solibjson-c.so.5JSONC_PRIVATEJSONC_0.14JSONC_0.15JSONC_0.16JSONC_0.17JSONC_0.18GCC_4.2.0GLIBC_2.0GCC_4.4.0GCC_3.0   %C ! 0>$I>$TI$_Tj_ ``' uii `^' P&y x| $,4<DLT\dlt|$,&4' 'j @2ideg$@g𸘀\UM@:eeP@8e<%'!'@@X@X D$@$ D$$@ '? \g pH@:ee*HhNImZXgj @2ide*Hn@jKJJJ*J@jKJJJ*Je? %}g `k'@h lHH<(N  *jexg_glrajG"e0DkJAgIg'}g`KjG%[6jGAIg/jGIg%}g`KjG%[#Ig/jGhge&]g`kjG"e0DJAgjG\gg@=e"e0DJAg\g \L@:ee"\gXJ ig']g`A @"e0D+ JAgig']g`/uaLgj*g0@=e\e` n@:eRe ach2iH2I k`"e0D+JAg@jKJJ"e_%]g `kjG"e0DJAg\gTEm@:ee *jom e]g`k! #%gel*e&oe eHCJ ZgnLeg0a(es0`Es.`'-s(`Kg"+s$`D *.s ajeDoFhgJFnM "j*@bgN "*ejJeHCJ Zoe`eojeDoh@+R`KL@K@#kkL K#kkLKX#gIg$}g`K %G@kkLKK+NKbg\g \@:ee"|gXJ ҂gPH@:ee "\g\ @:eeA*pXgҠ*clh2ikH2A"e0DlJAgdgJҤkNbg|j.j(igHE j@% J%FaBf"e0DJAg\gX6J "e0DJAgn*jom eh"e0D,JAgh"e0DJAg}ge` kg2(e"e0DJAgj@\g0@=ejeDC "e0Dk JAg"r`/ran` \g\@:eRe ach2 ikH2Ia`"e0D+JAg j@\g0@=ejeEjjj@jA\gL@:ecCh2iH2IeC *ljGle""e0DKJAgj@jA\gP(e j *igj@\g0@=e]g`K%e HK"e0DlJAg(ekNbgj"e0D JAggIg$}g`Kj Ҡj"e0DJAg r``igjAj@%J%j"e0DL JAgig}g`K gR a jGj e""e0DKJAgXg@F aBf"e0DJAg ? +?,al[xglg"e0DJAgCg}g g%`KAaSa@@-r`\gH@:eCCH3 IH2AeC?"jAj@"e0D,JAg%+T`K@K#kk K #kkK +kӤgg"e0D, JAgIg'}g`K%["e0DLJAgIg/%["e0DLJAgIg'}g`KjG%["e0DLJAgIg/jGIg}g j`K%g[\g%\@:eReach2iH2 Ik`]ga@`K %"e0DKJAgIg}g*j`Kg%H[g\g\@:eRe`ach2iH2 Ik`]g%`K "e0DKJAgJZa\gnMh"e0D,JAgh"e0DJAgkNbgIg%}g`K%[g\g\@:eRe ach2i kH2Ika kj"e0D JAgIg-%["e0DLJAgIg%}g`KjG%["e0DLJAgIg]g`%[\g%\@:eReacgh2ikH2IAH@:eeD"jAj@]ga@`K"e0DlJAgIg'}g`K%@[g\g\@:eReach2i kH2Ika k.Igm\g@@:ech2i kH2Ikea"e0D+JAgIg/jGzhgeIg&g`kkg~""e0DKJAgig}gJg`%{\g%\@:eRe@ aa2⋙H2A\g@@:ecCh2i kH2Ice?#kak`]gK`K %"e0DKJAghgeIg.kg٪Պgg$g`Ta]s`^Sais`}s ` Kg\`fl#F](``-sn`*gp\@:ee*P@:e@"re `Dgm"A@@0r `S2 H2ggA`\gH@:eCCH3 IH2Iԃe$%ll IH2A"e0D,JAg\g%\g@:eReaA@@-rapa]g!k`KklIr`@D+*@-ragpT@:ee*P@:e@"reaLbg jl*ch2ikH2A\gpXljl"%\g0H@:egen cj kӫҨ3㫙h3a\gaD@:eCCH3 IH2Iԃe_, jljGe"e0DlJAg@kkKK+gKg"e0D, JAgj"e0D,JAgD"A@Ғj"e0D,JAgD3 m`ie{_C'\gnM"e0DJAg\gnM"e0DJAg\gnM"e0DJAg\gnM"e0DJAgDg%% }g`ihـ#lgua `3h3mMIxgidgLsH@ `s``C`aB6?oZ56B3655@2mnm\g"e0DJAgj "jGj e>""e0DKJAgn"e0DJAgIge'}g`K jGgjl""e0DKJAge ']g`jG"e0DJAg\g\nM@:eRe aH ـZaZakLs`s`c `B5 kk5?nmoZ3`3g`x}g`Zn\g"e0DJAgjdg"e0D JAg``"e0DJAgAR?a+RaJj"j@ÁA`JRAaJM@FRaer`@D*CL\_`gl_ # "e0DMJAgjdg"e0D JAgjG"e0D JAgjeG"e0DlJAg%PgK%cJE ]gk `K"e0DKJAg}gn`XÁ\g"e0DJAg(ee gg']g`*IgkAnZXgknAd@ҟ+@-r `%n"e0DJAg%"e0D.JAgCn Km h2iH2Agi@lZ3m?klkkm@2}g`XnFclh2i kH2Aj@XgE%"e0DLJAgn)\g@m@:ech2i kH2I`es ` kak`%]gK`K%"e0DKJAgn"e0Dn JAgkӤgg"e0D, JAgR?`@@-r%`DI j@"e0D JAg j@"e0D JAg jG"e0D JAgjG>&"e0DKJAgLbg jl?" c k IjHh2iH2I k`"e0D+JAgjG"e0D JAg\gnM"e0DJAg jG"e0D JAgkӤgg"e0D, JAg jG"e0D JAg jG"e0D JAgLg j" vlgek ?#jGj ""e0DKJAg ejcG jk ӝ""e0DKJAg ejgE@Deej @2iedg<j @2ide\gXְJonm@:ecr `cR ` "knZXgEd JjEdX R2e7] Xg`j#T5LII`+ej @2ieda% b9abIB#a `@\gmX@:ee@\gX@:eAbajvdA\gXgqJ@:eJe*jK\gP@:ek`jKej @2iedg4p45@ -4 gPLg Ӏmg@:eZeag ҐP @:eReg#a\ @:e e@=ee g\ @:eҞe-`n*ydjKP@8e@k`j Aj7 @2ide$J Z f-v ưҰ.>N^nz !±"α ޱ\t�ERRNO=9u2i ,y;<]ݏi==%>ًݍAauB%uaE݂)Hi}JA1<>q+NMUCE%>MO./E/u.-,I/e,PQQBy,UqO4X]Ym;UQKYQZZ|!XXQ~q<5=u<MQ-m)Q1CqQNWЧp`P@0 Цp`P@0 Хp`P@0 Фp`P@0 407070101AE1D20000081A40000000000000000000000016A426C2800010247000000FE0000000000000000000000000000001D00000000usr/lib/libmbedx509.so.3.6.6ELF4p4 (p  000((QtdRtd   0>F *   XXh a X(ppp p=pppkoo8(oo&Y@dVp [vs9}oeFib_QkIB%2$SL f+j(gN*c4h=;)lzyEJ|m^?1tRTK`M]"n0 \WZx  &6!#GH3O8'u-{Xar~w><7qUA5CPD.,: /*   4d *9 <l  D Ȣ v:8 y   X W @ Qd ^S ;  HT w <  4q 3 M ԅ  {   p*   5 8X : +T 8XEp  3 | [      }0H    R K|i 8 Q0 G < PL X @ Ȋ >@ 8 `  ^ t 8, R  /f  |    j( PZ P\ ܔ\ (2 A   FU  (t ~G lp ({ LN  n  A G,  d v8X ,̳\ ]L l  < +( ,1 e @ iF 0L !s c|0 d  8w dtT +  d \p:8 | ] n X D S j Z0 F   "xhhQXH8(f@   Cx  hXHw8(  ^"8zo"M  VxhX H{  8( 4  ."$  x1hXHo8B(oGv_  xh XH 8 (\ s _fini__cxa_finalize__deregister_frame_info__register_frame_infombedtls_x509_time_is_pastmbedtls_x509_time_is_futurembedtls_oid_get_md_algmbedtls_md_info_from_typembedtls_md_get_sizecallocmbedtls_mdmemcpymbedtls_pk_verifymbedtls_asn1_get_tagmbedtls_asn1_get_intmbedtls_x509_get_namembedtls_x509_get_serialmbedtls_asn1_get_alg_nullmemcmpmbedtls_pkcs7_initmemsetmbedtls_pkcs7_signed_data_verifymbedtls_pkcs7_signed_hash_verifymbedtls_pkcs7_freembedtls_x509_crt_freembedtls_x509_crl_freembedtls_pkcs7_parse_dermbedtls_x509_crt_initmbedtls_x509_crt_parse_dermbedtls_asn1_get_lenmbedtls_x509_get_alg_nullmbedtls_x509_get_algmbedtls_asn1_get_algmbedtls_x509_get_rsassa_pss_paramsmbedtls_asn1_free_named_data_list_shallowmbedtls_x509_get_timembedtls_x509_get_sigmbedtls_asn1_get_bitstring_nullmbedtls_x509_get_sig_algmbedtls_oid_get_sig_algmbedtls_x509_get_extmbedtls_x509_dn_gets__stack_chk_guardsnprintfmbedtls_oid_get_attr_short_namestrchrmbedtls_oid_get_numeric_stringmbedtls_asn1_write_lenmbedtls_asn1_write_tag__stack_chk_failmbedtls_x509_serial_getsmbedtls_x509_sig_alg_getsmbedtls_oid_get_sig_alg_descmbedtls_x509_key_size_helpermbedtls_x509_time_cmpmbedtls_x509_time_gmtimembedtls_platform_gmtime_r__time64mbedtls_x509_get_ns_cert_typembedtls_asn1_get_bitstringmbedtls_x509_get_key_usagembedtls_x509_parse_subject_alt_namembedtls_x509_free_subject_alt_namembedtls_x509_get_subject_alt_name_extmbedtls_asn1_sequence_freembedtls_x509_get_subject_alt_namembedtls_x509_info_subject_alt_namembedtls_x509_info_cert_typembedtls_x509_info_key_usagembedtls_x509_string_to_namesstrlenstrncmpmbedtls_asn1_store_named_datambedtls_oid_from_numeric_stringmbedtls_x509_set_extensionmbedtls_x509_write_namesmbedtls_asn1_write_tagged_stringmbedtls_asn1_write_oidmbedtls_x509_write_sigmbedtls_asn1_write_algorithm_identifier_extmbedtls_x509_write_extensionsmbedtls_asn1_write_raw_buffermbedtls_asn1_write_boolmbedtls_x509_crl_infombedtls_x509_crl_initmbedtls_zeroize_and_freembedtls_platform_zeroizembedtls_x509_crl_parse_dermbedtls_asn1_get_boolmbedtls_x509_crl_parsembedtls_pem_initmbedtls_pem_freembedtls_pem_read_buffermbedtls_x509_crl_parse_filembedtls_pk_load_filembedtls_pk_get_typembedtls_pk_get_bitlenmbedtls_x509_crt_infombedtls_pk_get_namembedtls_oid_get_extended_key_usagembedtls_oid_get_certificate_policiesmbedtls_x509_crt_verify_infombedtls_x509_crt_check_key_usagembedtls_x509_crt_check_extended_key_usagembedtls_x509_crt_is_revokedmbedtls_x509_crt_parse_cn_inet_ptonmbedtls_pk_can_dombedtls_pk_verify_extmbedtls_x509_crt_verifymbedtls_x509_crt_profile_defaultmbedtls_x509_crt_verify_with_profilembedtls_x509_crt_verify_restartablembedtls_pk_freembedtls_pk_parse_subpubkeymbedtls_oid_get_x509_ext_typembedtls_asn1_get_sequence_ofmbedtls_x509_crt_parsestrstrmbedtls_x509_crt_parse_filembedtls_x509_crt_parse_pathopendirmbedtls_mutex_lockmbedtls_threading_readdir_mutexreaddir__stat_time64__errno_locationclosedirmbedtls_mutex_unlockmbedtls_x509_crt_parse_der_nocopymbedtls_x509_crt_parse_der_with_ext_cbmbedtls_x509_crt_get_ca_istruembedtls_x509_crt_profile_nonembedtls_x509_crt_profile_suitebmbedtls_x509_crt_profile_nextmbedtls_x509_csr_infombedtls_x509_csr_initmbedtls_x509_csr_freembedtls_x509_csr_parse_dermbedtls_x509_csr_parsembedtls_x509_csr_parse_filembedtls_x509_csr_parse_der_with_ext_cbmbedtls_x509_write_set_san_commonmbedtls_x509write_crt_initmbedtls_x509write_crt_freembedtls_asn1_free_named_data_listmbedtls_x509write_crt_set_versionmbedtls_x509write_crt_set_md_algmbedtls_x509write_crt_set_subject_keymbedtls_x509write_crt_set_issuer_keymbedtls_x509write_crt_set_subject_namembedtls_x509write_crt_set_issuer_namembedtls_x509write_crt_set_serialmbedtls_mpi_sizembedtls_mpi_write_binarymbedtls_x509write_crt_set_serial_rawmbedtls_x509write_crt_set_validitystrncpymbedtls_x509write_crt_set_subject_alternative_namembedtls_x509write_crt_set_extensionmbedtls_pk_write_pubkeymbedtls_x509write_crt_set_basic_constraintsmbedtls_asn1_write_intmbedtls_x509write_crt_set_subject_key_identifiermbedtls_x509write_crt_set_authority_key_identifiermbedtls_x509write_crt_set_key_usagembedtls_asn1_write_named_bitstringmbedtls_x509write_crt_set_ext_key_usagembedtls_x509write_crt_set_ns_cert_typembedtls_x509write_crt_dermbedtls_oid_get_oid_by_sig_algmbedtls_pk_write_pubkey_dermbedtls_pk_signmemmovembedtls_x509write_crt_pemmbedtls_pem_write_buffermbedtls_x509write_csr_initmbedtls_x509write_csr_freembedtls_x509write_csr_set_md_algmbedtls_x509write_csr_set_keymbedtls_x509write_csr_set_subject_namembedtls_x509write_csr_set_extensionmbedtls_x509write_csr_set_subject_alternative_namembedtls_x509write_csr_set_key_usagembedtls_x509write_csr_set_ns_cert_typembedtls_x509write_csr_dermbedtls_x509write_csr_pemlibmbedcrypto.so.16libgcc_s.so.1libc.solibmbedx509.so.7GLIBC_2.00ii W                  (08@HPX`hpx (08@\dlt|D' ' H<B$|% %@',b$@S`H$4%(@ % @+R`!#B q".@,"121:h%( % `@4@L$%(@ % r@+Rp`#Bt!04 %03dB$%%X&$\$$b!RP%( % 9@"&SU!=L6&_c,C`Q$#.J`!].E$LvB$2V0&!( d,OL0c$!]R&LCt+T@04!=4 l$%(%  L )@+P&`cs#!`|#R@$ %(@&%  $% "&$ C\$!=L#!]R&LptQ$+T@5$(Lctplhd`\XTPx'7c$7&XD$%0`%(@ % r@4#B!P$%(@ % @+R`#Bf!04#$8LD'J'<'%(@%  <%@b@ f%(@ % [@!P$S #Q!B @%@ !0Q0B$ ,b0$dc$R&BE,D07B$ ,b7$dc$R&1&bd@ % !(Q0B$ f,1&0c$b$+U@$"&B,@b!DBF,C07B$ f,1&7c$$Sss$$oC4T$%(@ % $e%c$ '!'%84$ % @+P@$% '$@@2@9@%b%0%0%h#  )!%E%d%I%h#C<`='!'`B$$c,[`$$!(p&%D+`R&b&!(t8'<'< t@8B.@ .#@<XP<B$B0@@%! EDL'C`B$0 % `$0 HD$, c,`B$$L'+@+!+"@+@!+@%0@ % 0 % `f$, c,`B$$,0$@!+@4p%0 %( @' @P%$0 \R$$%9L'$$ <'!'$ D$,@(!d&% %8@CrD$+@!+$@!03%0 %( %,($ 0'3"$$<'!'0,<84($%h%%%", &'04%(`% @ %0%8L%(`% @J@%@ !%(`8% @@@%0 %(`0$% @8@%@ !!T%(`8% @.@%0 %(`1$% @&@%@ ! @!T <1 !8%0%(` % @%@@0$%(` % @ @<!!U480,(%$@'%@<840,(%$@'%<'!'+E($%TP<840, _`#R+q\`%# Q+%%:`+@!3 %0 #RK`8C$1&%0 @%(@ % %@@$%(@ % %@@XB8+%8%0%(@ % @!q!!Q<840($ %`,@'+N<%@840($ %`,@'<%@840($ %`,@'$< '!'40,($ %%%%'&0$$%( % `%@^@&8$%( % `%@`@$%( % `M@#!!Rb @0$%( % `%@@@!B0'&%( % `%@6@8&%( % `%@E@$%( % `&@!!8!R%0@%( % `%@@0$%( % `@!!R41 !4%0,($ %8'%@40,($ %8'4%@0,($ %8'%@%<'!'HD%%%84(8TPL@<4$\ %@(\+C`\4#b!"%8$%( % @(+P`h#!"4&%(% @(+P`4`d\XhT#!" $%8$%( % @@(+P`4x|tpl#!B $%8<$%( % @@(+P`4#!B%8p$%(  % &u@(+Qr`#"!&&B4%8%0%( /@%  (#"! F&l%(`% [@+QZ T(#b!%04%( % N@+SM`T,BG (B$B BB +Q=@(;`#"<R@!4%8$%(  % %@.@(+Q+@p#2!&%(`&% %@@(+S@4#t`$%(` ! @+S`\#QT!d!tPLHD@<84!bX'TPLHD@<84$X'<'!$ %(<'!3' $%%0 $ L$0ȁ% < @$$ȁ %́$%  0Q0 % %$ ('<'!x'|xtplhd`,%<'H'T'<HT%%@%@@`%(` $%@@,+RH@!3+Q@!S3"!3%(@%0` % (','0$%0%( % @@,(# 0$%0%( % @%@@,(!c`#b&%(` % @@$CQ$ L8X% |xtplh`% d'+^NL&%8%0%(`% @%@@C,[`tB$&&&%(% U@,00$%0%(` % @%@i@,((4&!(% @%@@0,x#C,T&%(`% @%@@xl&%(`% @%@@$"$"8,b0$0'%(` % @%@X@$"8,$b-q8L!b%8%0%(`% @%@@ XH\ $@@L8HP D@|&%(`(% @%@h@,iS8% c$8% 1&|xtplh`% d'$ $@% @,0!"$+"@&4'8'$ZC,Q$4 8,$+"@@$ $@<®%@"$®0$%0 % @%@@4,,! b %(î® & % @%@@x &% @%@@, +$@8" 0®8Ѯ0$4& % @@,4ю!q+ q%`0$%0%(  % @@,8!b+ Q%@,qQ%`8$Hq%8&%(`% @%@@,!+ wV%`8'+4',8! %(%0 %(􁙏-@% @,8!C ,%0$%(@% @$C @,8!b+ W,2%@4))0$%0% @4 %(%0$@% @Q$ 8,8% $8% $8% }$8% x$s$%`m$k$8% i$< '!' TPLHD@<(ZX%x,'%% % ` % ` %0%(@% %@TPLHD<% @X'%!PB@$% ` TPLHD<% @X'4('%8@$$ % `%@@ (0,% #!B % `%@@  .% `@x $ $< '!' %'(,$%' % `@,%@(%$0'z% ȁ %@,(%$0'@PxY$%(RH@ <%"\ % 0% @TK%(`%@@ %B$TD,'XdhLXXB$0D&<A $X0 D&@ LbB4bT@dB@PB$$cD$C@LB@PB$$cD$Cy@L<$C\$4PV&<D%4@#C8,p& % %@@ B( @\@$% @ `@+W@ D % @ %@ FED%8%  %@@ 쁙E& % @ BGEDB@ %0 @%X0&@ X0&@ <$C,pE& % @ DB$D4@< B,_@ PLbB4bPH& %(@ L<%C`@%@TPp&<8"[@,%( 4$&U@ $ % @ $$$E$C@<"@B$$E$C@<  % @ %@ &%D% @%8 %@@ H%( % @ %u"'%$"@ %0@ X0l$&A s6X0T$&@ s68%( @ 1 %`L<%X%C4T$L8@@8,84@XP PV&4IQ,HX,8XX'B$!CdlChc4lC%",PV&pE& % @ Q?$"H  D %0 @ dh%%"x<lpt0!Q#R& %%8%0@%Ȁ % }@ b1&%C@b@|,BbTPLHD@<84%0X'c6\4<%b"4@<8%btc6LbB4bLb@B4vbXh%"0$`%Q&@B$% %,$$$0-WU0%0`%( % @  ,B0V $,$@'0$$ 1 "B0P"bH$%0` %(@ %$,l$b$C%@$0%(@S% %@ % @$ B0UH0 %0@ %16@l%c$ <'!'H%D@, 9'C,0'<`'!9'9@| x&%( (@DQĀ % $({@0$(T&X&B$((x@HĀ$($,C$x(% $v(Ā% $p($j($j(Ā% $d(<(ɜ'!'$9'%8$('<Ȝ'!' TPLHD@<WU%S%!B?@%x,' %  ('4%8@$$ % %@$  % TPLHD@%<X'4%8@$8$ % %@@ Ȁ0,%  %@ % $ Ȁ%0`%(@% %@TPLHD@%<X'$0 &$'%8%( % %@=@8%0%(%  %@%@4@&4%( % !~*@%@!^'+u`(1 !8%0%( % %@@0$%( % z@!u!S#Ѐ!%8$`$F% @$+t`%@$0 % Lc$c,`$LHD@<80,(%`4P'$ F$B,@L'(!F+@$'(+( H!CC,u`L$HD@<80,(%`4P'c$c,|`$0Ԁ$'&&%(,% %@@8%0@%(%  %@%@@|$$ $%@@$B$$$%{$'$%@<œ'!'$ ,(€%2C(-`%2$C0$À#b0$%(@ % %@@8%0@%(@%  %@%@ @$%(@ % @!!S%@,($ %0'€5B(@00 $$%(@ % %@@8%0@%(@%  %@%@@$<'!'P$%%( $$ 'N%,($ 0'$<8'!܀P$< '!ЀP$<'!'TH('<<'dXPLD@%%% @%(`\%$ $" &$' 0S%(@ % %@@ $$#(D('%0%8!(E % @%@@<Obd`\XTPLHD%@h'8$%(@%  $%@@%0%(@ % #@&"`!P8%0%(@ % %@@0$%(@ % @!!T#!^%8$h$% %@%@#!^%8$d$s% %@ <л'!'H<('41'D@TPL8(%%$ F (2`$>$'%(  % %@)@%@$%(  % %@ @!U8%0%(  % %@@0$%(  % $@!!U#" 1&%8@$l$"% `%@4bTPLHD@<%8X'%$'%$'%@ <8'!$9'%(<'!$9'$<'!'<B$$40(,@Ё%-'% $ '('$'$  @C$c,`$$$p$% 408'$$<<'!'D0$'$$'@8LH<4,(%%$%( % @+%%$ '%%@ BCU0%(@ % `%@@8%(@% ` !Q%@@$%(@% ` !Q%@@!Q%$$-bLD@<840,(%HP'8%0 %(@ % `%@@0$%(@ % `@!!Q $$t$T% %@%@ ;"\# %02X%s....SHA384???MD5SHA512SHA256SHA224SHA1 (%s, MGF1-%s, 0x%02X)%s key size+dNSNamerfc822Name %s %s %s otherName : %s hardware module name : %s hardware type : %s hardware serial number : %02X %s uniformResourceIdentifier : %s %s : iPAddress%u.%u.%u.%u%X%X:%X%X:%X%X:%X%X:%X%X:%X%X:%X%X:%X%X %s directoryName : %sSSL Client%sSSL Server%sEmail%sObject Signing%sReserved%sSSL CA%sEmail CA%sObject Signing CA%sDigital Signature%sNon Repudiation%sKey Encipherment%sData Encipherment%sKey Agreement%sKey Cert Sign%sCRL Sign%sEncipher Only%sDecipher OnlyCN ,=+<>#;"\UcommonNameCUcountryNameOU organizationNameLUlocalityR*H  OUU organizationalUnitNameSTUstateOrProvinceNameemailAddressserialNumberUpostalAddressUpostalCodeUdnQualifierU.titleU surNameUSNgivenNameU*GNinitialsU+pseudonymUAgenerationQualifierU,domainComponent &,dDC%sCRL version : %d %sissuer name : %sthis update : %04d-%02d-%02d %02d:%02d:%02d %snext update : %04d-%02d-%02d %02d:%02d:%02d %sRevoked certificates: %sserial number: revocation date: %04d-%02d-%02d %02d:%02d:%02d %ssigned using : -----END X509 CRL----------BEGIN X509 CRL-----truefalse Certificate is uninitialised! %scert. version : %d %sserial number : %sissuer name : %ssubject name : %sissued on : %04d-%02d-%02d %02d:%02d:%02d %sexpires on : %04d-%02d-%02d %02d:%02d:%02d %ssigned using : %s%-18s: %d bits %sbasic constraints : CA=%s, max_pathlen=%d %ssubject alt name : %scert. type : %skey usage : %sext key usage : %s%s %scertificate policies : The certificate validity has expired%s%s %sUnknown reason (this should not happen) -----BEGIN CERTIFICATE----------END CERTIFICATE-----%s/%sThe certificate has been revoked (is on a CRL)The certificate Common Name (CN) does not match with the expected CNThe certificate is not correctly signed by the trusted CAThe CRL is not correctly signed by the trusted CAThe CRL is expiredCertificate was missingCertificate verification was skippedOther reason (can be used by verify callback)The certificate validity starts in the futureThe CRL is from the futureUsage does not match the keyUsage extensionUsage does not match the extendedKeyUsage extensionUsage does not match the nsCertType extensionThe certificate is signed with an unacceptable hash.The certificate is signed with an unacceptable PK alg (eg RSA vs ECDSA).The certificate is signed with an unacceptable key (eg bad curve, RSA too short).The CRL is signed with an unacceptable hash.The CRL is signed with an unacceptable PK alg (eg RSA vs ECDSA).The CRL is signed with an unacceptable key (eg bad curve, RSA too short).%sCSR version : %d %ssubject name : %s%-14s: %d bits *H  -----END CERTIFICATE REQUEST----------BEGIN CERTIFICATE REQUEST----------END NEW CERTIFICATE REQUEST----------BEGIN NEW CERTIFICATE REQUEST-----UUU#UUU%`HB-----END CERTIFICATE----- -----BEGIN CERTIFICATE----- -----END CERTIFICATE REQUEST----- -----BEGIN CERTIFICATE REQUEST----- <pxl`xl`xl`xl`<XX  U%U   t# ! ! t++L\ ` \ lpt p          04 @D PT\ `h lh p | |   P @8T @h0D SS>9({,1Ȣ̳p:::R R ZUPZG MNXEAD {F |,Q]fdܔdHT]T(lp4q|iXts4`xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(D07070101AE1D1B0000A1FF0000000000000000000000016A426C2800000016000000FE0000000000000000000000000000001C00000000usr/lib/libmbedcrypto.so.16libmbedcrypto.so.3.6.607070101AE2280000081ED0000000000000000000000016A426C2800006152000000FE0000000000000000000000000000001900000000usr/lib/libuuid.so.1.3.0ELF4t4 (p888pPPPDXDX_ooZhhh00QtdRtd_oo  DRZ  pVoo(   0p ppp ppSp"poooooo CSI.2&CPB=-D(0,<'G: 5"*4#N $96)+Q%@A7J;E3!8 1HK/ > MLF? OR  pV1*. !( &Y" (L a( a*& =!$P != Y& pQ J& ', ]  gp\~  lA&D *. & *)# 1" zPVP)( %@V0Vw VVeVU-UUUU! tUU UpUU`U5PU@Ui0U U!U8UTzTTT")T=TcTTpT`TPT[@T0T " TTT4"R& S}SJ$a S SS~S_init_fini__cxa_finalize__deregister_frame_info__register_frame_infouuid_clearmemsetuuid_comparememcmpuuid_copyumaskfdopenrewindflockfscanf__errno_locationfclose__gettimeofday_time64memcpy__divdi3__moddi3fprintffflush__stack_chk_guardsocketioctl__stack_chk_failstrncpy__fstat_time64read__nanosleep_time64__uuid_generate_timepthread_atfork__time64connectwrite__uuid_generate_time_contuuid_generate_time_safeuuid_generate_time_v6uuid_generate_time_v7__udivdi3__uuid_generate_randomuuid_generateuuid_generate_md5uuid_generate_sha1uuid_is_nulluuid_parse_rangestrtoulisxdigituuid_parsestrlen__umoddi3uuid_timeuuid_typeuuid_variantuuid_get_templatestrcmpuuid_unparse_upperuuid_unparseuuid_unparse_lowergetpidgetuidsrandomgetppidgetrandomsyscalljrand48gettextexplicit_bzerolibgcc_s.so.1libc.solibuuid.so.1UUID_1.0UUID_2.20UUID_2.31UUID_2.36UUID_2.40UUID_2.41UUIDD_PRIVATEGLIBC_2.0     ZZ' g+ $pg+ $zp+ $z+ $+ $,Dii ooPq' '<0'!'`q@@ DЀ@Ѐ @X$$`q '<ߜ'!@dq$ @X$j{ @2ide\gnDm@:eDdeeeeej[ @2iedg%g0?e@0e g@?e Je`Cjayd]gnVJa]goWJa]gpXJan  @8eKejMMJraeeeeeeej @2iegdHg(nm@?e@jAddj{ @2iedgD$g:e@lpLegn@:e"gDe@:eAAe"L𸘑gM@:ee *pg@8ei+Qgvd @j @2iedgX @bB+X𘘢JML@:e e@Ra8𤘎@=ee m@@:eReEaj @R`aX𸘎@M@:eken|g؛xgL*mLێCXڎX+*noێ"p\@:e@ re`r`@@:e p@e@:e jKe@ XҎJ Hbg BgCglg cgdgm,*80DgmL@:exjleX"@ m@:eHlBCKXgieێL@m@:e hLBea* ca +* bCBa. *c`xXJl"XXk d\n@:eejK +*xD R`JDX k8 g6gUXXe YFggUYCT]Xg=gIB"@R?aJz+ Kg cc2xgI B 0Hg@:eghIcxge7HܐH4 l:e@g eBc @R\gX ;a8𤘎@=e 𸘎De MB تH@:eH񜙞e@:e𤘎񜙞e@=e em@8e`` X@ ~deee@@Bj @2iedgLn@m@Ll@:eRe"aDnmg@:ej 0De m@:eRe`p@@:eejK@n#@8e i B ap@@:eje  5Xn@:e0De1m@:eReAa V wm xm ym zm {m("dgJKC`CaJc`JC`[T\A]Bp@@:eje I}dej[ @2iedu?eAbg vb@wPgd耖@j @2ie d1@@2-I%gLn=1*17-%efgN-@b1|3 - m%glN9166 - Ti+%EGgn)B1>1@@2 - `I%gLn = 1 *17@- mefgNg @b0|3 m e8g!eglgN066 e8e9gg!I:eGgng B00@@2 IgLn775 }bgNb7t3mgnL766 ]CgnB7@2X2`IgNl775@}bgNb7t3 @mgnL766 ]CgnB7@2X2 IgNl775 }bgNb7t3gmgnL766]CgnB7@2X2 IgNl775}bgNb7t3`mgnL766@ Ign]27 7MFg=eglg005 8e9g!miB3P2 mImggN@b6`3l3 mgNn7676ggn775뷵]CgB7P2ImgN}@377mmgNy36b36 mڳmbgb55`3ԵmIgnU25MβIgn]@277MȲICgB6@26@2¶ImgNy3f36 mmgNu35m mbg@b7`3l3뱷mIgn]27B27M﫲IgnY2F26MIoB5X2ꟵIuMb5`3h3뚵gmmN@577On66@5 퍶oE926MImiB3@2H2 mꂳImM}@377m|mNb55@`3 vmOm65pYnB6@2H2jIoM@766d}Nb77@`3^mOm75 Y]nB7@2H2SIoM@766 M}Nb55@`39dabcI CexjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆj @2i deD3MC$ggd`eKe@b3meN2?kl>"GAJq@jkc|gXg"`IC``ICg@?evd0`GAQJCag@?eAe\gMP蚑g@?eAJeI@ZGAJg\g\`7`cagg@:eI`CgAKgA`QKcaAg@nL@:eAe\gMP蚑g@?ee@HJKc`g@A9KLc`mcej @2ideD?ngEN2KMe6eXggM20ML* g AXgb2egt2M24M%eB2eXg@2gMXgB2:eXge@2gML>eYggM gl. >eYg2eg2Mj2`3M&eB2eXg@2gMXgB2:eXge@2gMjL>eYggM g >e%Yg%2eg2M 10-'e"2eg 2M"2 1ML-#g Fgn9eYg%XgB4T2M45(2eg2M24MLgXgL e%Yg%2eg2Mj2`3M XgXgXgB2:eXgD2gjMg >eYg"2eg42M 20M XgXgXgB2:eXgD2g M g,n >eYg2eg2M*2 1M XgXgXgB2:eXgD2g*M g ixg6I3i35m b6d3 fg qg ;e ygB6eT6>egygme 0n4 gn n3;eg3m gN >e!ygxgb1t3m!J1@2- nn n"3;eg$3$gmNxg nfg9eyg13mxgj3;exg5`1ygmxg xgxgb3;exgd3g*mg>eyg3eg3m 30mxg xgxgb3;exgd3g mg>eIygI3eg3m3;e3gmenn n3;e3gmոg=e5ygB1T3m531mn nn3;e3gmԘg.N$%x =$%x <$%x :$%x 9$%x 8$%x 7$%x 6$%x 5$%x 4$%x 3$%x 2$%x 1$%x 0$%x /$%x .$%x -$%x ,$%x *$%x )$%x ($%x '$%x &$%x %$%x $$%x #$%x "$%x !$%x $' 'r+e/var/lib/libuuid/clock.txtclock: %04x tv: %lu %lu adj: %d clock: %04x tv: %016ld %08ld adj: %08d /var/lib/libuuid/clock-cont.txtcont: %llu cont: %020llu /run/uuidd/requestdnsurloidx500x.500/dev/urandom/dev/randomgetrandom() functionkрO0kрO0kрO0kрO00123456789ABCDEF0123456789abcdefd@Pq!)),q$A.I78QIQ9R+i.9PV)@V0V VVVUUUUU!UUUpU`UPU@U0U UUUTTTTTTTTpT`TPT@T0T TTTSS$SSSSPq07070101AE23A60000A1FF0000000000000000000000016A426C2800000012000000FE0000000000000000000000000000001900000000usr/lib/liblucihttp.so.0liblucihttp.so.0.107070101AE24FE000041ED0000000000000000000000036A426C2800000000000000FE0000000000000000000000000000000D00000000usr/lib/pppd07070101AE24FF000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001300000000usr/lib/pppd/2.5.207070101AE2502000081ED0000000000000000000000016A426C280000641A000000FE0000000000000000000000000000001C00000000usr/lib/pppd/2.5.2/pppoe.soELF4t4 (p8R8R_oo"x000  QtdRtd_oo (0 T CooP  C rppp pp[pp oo|ooC[G23X0+#!J,I '$1 4/SY@=C >Z7"H9 &%DE8<;QM*.AR)(-TW5UFN6?:BLVKPO T F T HtR C @tpCC1n C^C, ypCt`C<PC)@C0C C e 4CCB:BBB~I2 B=%p Bpxr,"BDBpBu`BPB@B0BM BBSBcA<9 A"cApGA+AMAPPtAtE ApA`APA"K@A0Am A."LtAA[@@^@F@15 $F h1 $@@@?@ _fini__cxa_finalize__deregister_frame_info__register_frame_infoslprintfppp_get_filepathppp_options_from_fileexitstrlenstrncmpsocketstrlcpyioctlclosethe_channelpppoe_channelppp_set_modemmallocnovmmemsetppp_set_devnampppoe_verbosentohshtonsmemcpypppoe_check_optionssscanfppp_option_errorlcp_allowoptionslcp_wantoptionsipcp_allowoptionsipcp_wantoptionsccp_allowoptionsccp_wantoptionsmemcmpsnprintfreallocsprintfplugin_initppp_add_optionsetherTypeEth_PPPOE_DiscoveryEth_PPPOE_SessionopenInterface__stack_chk_guard__stack_chk_fail__errno_locationfatalsetsockoptwarnbindparsePacketpppoe_printpktpppoe_log_packetinit_pr_logend_pr_logsendPacketdebug_onsendstrcmpsendPADTstrcpyconnectfreereceivePacketrecvwaitForPADOppp_get_time__select_time64ppp_signaleddiscovery1discovery2isxdigitpppd_pppoe_serviceppp_set_pppdevnamppp_set_session_numberppp_set_remote_numberppp_script_setenvgetpidpppd_versionpppoe_reqd_mac_addrOldDevnameHookppp_generic_establishppp_generic_disestablishlibgcc_s.so.1libc.sopppoe.soGLIBC_2.0ii 9oo p(p,p4pHpTppp|ppppppppppqqq8qDq`qlqqqqqqqqqqrr r(r0r4rxr|rrrrtPp9xp9@qHhqHrXrYrZ' '<0'!' t@@ D؀@؀ 4R$$ t '<'!(@($t$ 4R$ej| @2idegcؘҰH"NO Nmg@:eegLogl@:eZe `PHnom@:ee*P l@8e#cdj @2ie dgPH$g@:eZeaXnMg@:ee*I\nml@:eRe4agҰ\ng@:ep@e1m@:eReap@1m@:eReaTri` "p𘘱gL@?eej0T@:eeN"L"XnNJgҰ\Ng@:el@e1"𸘀=e@lDe8l@:enDٞe *P(L@=een$Pnmg@:eIjKeAB@8ezdjej{ @2idtҚe&gg]`\ `tl` t%`t`vdtZ`ta\g 𘚈 LH\g0L@Ra "\g p(L@?e ra`cxg#C`bAca``aa]g\gp\@:eZahb`Hlb`Lj\د\g HLp@?ejPء\g hL\glPXL@:eHȞe\g PX@:e@#eJ ` ICa\g Xg@:e` ICej @2iedgX8N7$  𸘰D M@:ere`P𘘨L@=eP el@8en gDDKMKêJaj^pndjJJDDIŤIۄ0F0FĐj@̐@XLTHX{dej @2i dtҚea$%x =$%x <$%x :$%x 8$%x 7$%x 6$%x 4$%x 2$%x 0$%x /$%x .$%x -$%x ,$%x +$%x *$%x )$%x ($%x '$%x &$%x #$%x !$%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x  $%x  $%x  $%x  $' 'options.%snic-Interface %s not EthernetPPPoE session dataPADS: Service-Name: '%.*s'PADS: Service-Name-Error: %.*sPADS: System-Error: %.*sPADS: Generic-Error: %.*s%x:%x:%x:%x:%x:%xcannot parse pppoe-mac option valueAccess-Concentrator: %.*sService-Name: %.*sCookie: %02x...Relay-ID:Max-Payload: %uPADO: Service-Name-Error: %.*sPADO: System-Error: %.*sPADO: Generic-Error: %.*s2.5.2PPPoE plugin from pppd %sInvalid ether type 0x%xCan't use interface %.16s: name is too longCannot create raw socket -- pppoe must be run as root.Can't open socket for pppoe: %mCan't set socket options for pppoe: %mCan't get hardware address for %s: %mInterface %.16s is not EthernetCan't use interface %.16s: it has broadcast/multicast MAC addressCan't get MTU for %s: %mInterface %.16s has MTU of %d -- should be at least %d.This may cause serious connection problems.Could not get interface index for %s: %mFailed to bind to interface %s: %mInvalid PPPoE version (%d)Invalid PPPoE type (%d)Invalid PPPoE packet length (%u)Invalid PPPoE tag length (%u)PPPOE Discovery V%dT%d PADIPADOPADRPADSPADTunknown code %x session 0x%x length %d PPPOE Session V%dT%d code 0x%x session 0x%x length %d Unknown ethernet frame with proto = 0x%x dst %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x (PAP Authentication Frame -- Contents not dumped) %02x %c. [end-of-listservice-nameAC-namehost-uniqAC-cookievendor-specificrelay-session-idPPP-max-payloadservice-name-errorAC-system-errorgeneric-errorunknown tag 0x%x %.*s... (length %d)]Send error sending pppoe packet: %mNO-SERVICE-NAME-NON-RFC-COMPLIANTWould create too-long packetSent PADTFailed to disconnect PPPoE socket: %d %merror receiving pppoe packet: %mRecv get_time (waitForPADO): %mget_time: %mselect (waitForPADO): %mBogus PPPoE length field (%u)Ignoring PADO packet from non-unicast MAC addressIgnoring PADO packet from wrong MAC addressIgnoring PADO packet with no AC-Name tagIgnoring PADO packet with no Service-Name tagAC-Ethernet-Address: %02x:%02x:%02x:%02x:%02x:%02x--------------------------------------------------Timeout waiting for PADO packetsget_time (waitForPADS): %mselect (waitForPADS): %mPPP session is %dAccess concentrator used a session value of %x -- the AC is violating RFC 2516Timeout waiting for PADS packetsFailed to create PPPoE socket: %mIllegal value for pppoe-host-uniq option%d:%x:%x:%x:%x:%x:%xIllegal value for pppoe-sess optionFailed to create PPPoE discovery socket: %mUnable to complete PPPoE Discovery phase 1Unable to complete PPPoE Discovery phase 2%02X:%02X:%02X:%02X:%02X:%02XConnected to %s via interface %sMACREMOTEACNAMEFailed to connect PPPoE socket: %d %mdevice namePPPoE device namepppoe-serviceDesired PPPoE service namerp_pppoe_serviceLegacy alias for pppoe-servicepppoe-acDesired PPPoE access concentrator namerp_pppoe_acLegacy alias for pppoe-acpppoe-sessAttach to existing session (sessid:macaddr)rp_pppoe_sessLegacy alias for pppoe-sesspppoe-verboseBe verbose about discovered access concentratorsrp_pppoe_verboseLegacy alias for pppoe-verbosepppoe-macOnly connect to specified MAC addresspppoe-host-uniqSet the Host-Uniq to the supplied hex stringLegacy alias for pppoe-host-uniqpppoe-padi-timeoutInitial timeout for discovery packets in secondspppoe-padi-attemptsNumber of discovery attemptsp2.5.2dchOtO".\tOOOO O\uOP\u(P DPXtPP|PXtP PPPQ QTt,QTQ`udQI`uQ Q pQRpR p%:0!tCC1CC,pC`CPC@C0C CeCCBBBBI2B=%BpxrBBpB`BPB@B0B BBBA9AApAAAPtAApA`APA@A0A ALtAA@@@@5$1@@@@t07070101AE2176000081A40000000000000000000000016A426C28000020CA000000FE0000000000000000000000000000001500000000usr/lib/libudebug.soELF4t4 (p888pPPP//hhh00QtdRtd//  | //   0\  ppp pp.p$poo< oo %.)" #!&-% ,  +' $*(|  U  u |  @U - /ya |N J R <    - Y-u Y Spi`P@b0 1k"{ Dp`WP"@B0."s _fini__cxa_finalize__deregister_frame_info__register_frame_infoubus_lookup_idubus_invoke_fdstrcmpuloop_timeout_setblobmsg_parseatoiudebug_ubus_ring_initudebug_buf_initudebug_buf_addudebug_ubus_apply_config__stack_chk_guardstrlensprintfudebug_buf_free__stack_chk_failudebug_netlink_msgudebug_timestampudebug_entry_init_tsudebug_entry_appendudebug_entry_addudebug_ubus_initubus_register_subscriberudebug_ubus_freeuloop_timeout_cancelubus_remove_objectmemsetmemcpypcap_initpcap_interface_initpcap_packet_initpcap_packet_appendpcap_packet_donepcap_interface_rbuf_initpcap_snapshot_packet_initudebug_remote_buf_getpcap_block_write_filefwritefflushpcap_block_getlibubox.so.20260213libubus.so.20251202libgcc_s.so.1libc.solibudebug.soGLIBC_2.0ii //0' 'Mzq%_c #5="!'( I] &8Q ADe C y JU o42 6-e DEGU a D3. YKM Y:, )F} 6\ &x tO BY 02 A#9 K M-& y#I E4 + QM9 G q 96u q$: R1^  ] u-1 s}:y "6 M4% J1$i ~a!0 h!= {H^ 2Q %5 A3E M85 %i E4 q4U #-Y e1u d9Hu ^%1) Z Q1 EY -]  J  E }@r 1% yA h !Q EO L0 M1 y0. t0u 0i PR T$0 %. =%A 08 d$$ %#: I"I P3& U E  5 *q 5 ]B4 C:e L N= MF} q* i E&m fq7 (  ;9 QEq JE)0 4^ >$. 92 }%. 5% a "d a3= `u) 0N: #A Je 0R# R R^RmQQeQQoQQDQQSpQ{`QPQu@Q)0Q  Q3QjQPPKP"PPP@q0)P"PapP`P."\PP_fini__cxa_finalize__deregister_frame_info__register_frame_infostderrfprintf__assert_failnla_oknla_nextnla_parsememsetfputsnla_validatenla_findnla_reservenla_putmemcpynl_cache_alloccallocnl_cache_addnl_object_clonenl_cache_removenl_object_freenl_cache_clearnl_cache_freenl_cache_request_full_dump__cache_pickupnl_cb_clonenl_cb_setnl_recvmsgsnl_cb_putnl_cache_pickupnl_cache_parsenl_cache_parse_and_addnl_cache_refillnl_cache_alloc_and_fillnl_cache_ops_lookupstrcmpnl_cache_ops_associatenl_cache_mngt_registernl_cache_mngt_unregisternl_geterrornl_perrornl_syserr2nlerrgenl_connectgenl_send_simplegenlmsg_datagenlmsg_lengenlmsg_valid_hdrgenlmsg_attrdatagenlmsg_attrlengenlmsg_validategenlmsg_parsegenlmsg_putgenl_family_allocstrncpygenl_family_putgenl_family_add_opgenl_family_add_grpgenl_ctrl_alloc_cachegenl_ctrl_searchgenl_ctrl_search_by_namegenl_ctrl_resolvegenl_ctrl_resolve_grpgenl_registergenl_unregistergenl_family_opsnl_object_alloc__stack_chk_guard__stack_chk_failnl_cb_errnl_cb_allocmallocnlmsg_oknlmsg_nextnlmsg_allocnlmsg_alloc_sizenlmsg_inheritnlmsg_alloc_simplenlmsg_set_default_sizenlmsg_reservenlmsg_appendnlmsg_freenlmsg_convertnl_msg_parsesocket__errno_locationbindgetsocknamenl_socket_set_buffer_sizenl_closenl_sendtonl_sendmsgnl_sendnl_send_auto_completenl_recvgetpagesizerecvmsgreallocnl_wait_for_ackgetpidnl_socket_free__time64nl_socket_allocnl_socket_alloc_cbnl_socket_disable_seq_checknl_socket_set_local_portnl_socket_add_membershipssetsockoptnl_socket_drop_membershipsnl_socket_set_nonblockingfcntlnl_socket_set_passcrednl_socket_recv_pktinfounl_freeunl_genl_initstrdupunl_rtnl_initunl_genl_msgunl_rtnl_msgunl_requestunl_request_singleunl_loopunl_genl_multicast_idstrlenunl_genl_subscribeunl_genl_unsubscribeunl_nl80211_phy_lookupsnprintfopenreadatoiunl_nl80211_wdev_to_phylibgcc_s.so.1libc.solibnl-tiny.so.1GLIBC_2.0ii holopotoxo|ooooooooooooooooooooooooooooooooopppppppppqq$q@qLqPqTqhqpqtqxs q' 'j @2iegd0PL@=eDdejz @2iegd0PL@=eDde<0֜'!'(s@܁@T܁ Dā@ā( Y$$s '<՜'!쁂@((쁙s$ Y$jz @2idekAklO"BMaD3ID2Yg@Z#aL0(0𨘀@jI ogM@:e00e O ngL@8ea+"0D3+H `ra]ajKkEbab#ara_*udjje]a@ZaCXgk n j j@kkJl`O` Ij @2ie d"m$T"ՙC M @:eReg ara\gP@:eKe\D"m@"mzp_ahMj҈jҏh Dhhhej @2iedgpP@:ee!""gj0pT& Onmg@:epXeg@:epe ґg@8e wdjK eeeeeeejV @2iedgҐL0(0𨘀@IogM@:e00eKOngL@8ej @2ide ]g!`L0(0𨘀@I/ogM@:e00ekO/ngL@8e$g8e@lg "j@أG@JCD!%g@=ePgudju @2ideAg*0(H@8eB$g"p@=ee%g@=eepg@8evdj5 @2ideAg*0(H@8eD$g@:eҞeW"AhBKS !`L0(0𨘀@IXogM@:e00eKOXngL@8eۅhBK#ACLM`IC``IC@ @:eeE"g@:eRe`p@8ejwd "D"L0(0𨘀@IfogM@:e0蘞e0KOfnj @2ieAD"\g40H5J3MjD쀛O@۠e jj @2iedgH@:e0Ll$gk@ %mgn 'M uaK sLajK h7gt3 `3Iude?j5 @2ide$$gnla_type == 0 netlink: %d bytes leftover after parsing attributes. %s: %s SuccessUnspecific failureInterrupted system callBad socketTry againOut of memoryObject existsInvalid input data or parameterInput data out of rangeMessage size not sufficientOperation not supportedAddress family not supportedObject not foundAttribute not availableMissing attributeAddress family mismatchMessage sequence number mismatchKernel reported message overflowKernel reported truncated messageInvalid address for specified address familySource based routing not supportedNetlink message is too shortNetlink message type is not supportedObject type does not match cacheUnknown or invalid cache typeObject busyProtocol mismatchNo AccessOperation not permittedUnable to open packet location fileUnable to parse objectNo such deviceImmutable attributeDump inconsistency detected, interruptedlibnl-tiny-2025.12.02~40493a65/genl_ctrl.cNEWFAMILYDELFAMILYGETFAMILYNEWOPSDELOPSgenl/familynlctrllibnl-tiny-2025.12.02~40493a65/genl_mngt.clibnl-tiny-2025.12.02~40493a65/handlers.clibnl-tiny-2025.12.02~40493a65/msg.clibnl-tiny-2025.12.02~40493a65/nl.cn > 0 && buflibnl-tiny-2025.12.02~40493a65/object.clibnl-tiny-2025.12.02~40493a65/socket.c/sys/class/ieee80211/%s/indexvalidate_nla   genl_ctrl_search_by_namegenl_ctrl_searchgenl_msg_parsernl_cb_putnlmsg_freenlmsg_putrecvmsgsobj_opsnl_object_clonenl_object_allocnl_socket_alloc_cbPS S S8SDSPS`SpSSSSSST(T '.zZI(h C{`oq1+!/>2 c 3PIx*z&74eP;ip=1_$ cB!8}' \[ru $  }|%Zgwef:XV,OnCRDm{Hu+~WS-GbmJL\*yM])o6BR%jOv`? |H& p"a-7FQU9warNk956xWLAXs^E3Ql[S^k~Nt.f<yq;nT)0J"#_  _ ٸ- ~ d)- y  ٙz < ն0 q< M uB- e   y%) EQIM 5-, I - Q 2O5 |F ) ͪ  )Q U Qy" 1)I( " B u!o͍" * A f- m )- cِ }m a 9- } ٘& 7 %- 5 1 AU %g F* ;AY с$ * ٻ* a< * Un 0  _m< =< f4 * = p* i" I) uU V= GU <žM 1 BqG"  UF- - /( :| nI  vE * .1, :M- < y 9!M E, N  $ z( " *i   +& -!4 Q( - ,=G5 ( mձ ѽ) |  *   1 ( ]!* $B" ٪  G6 E!\ " i!GY- f w%& 9(   )Y- a0   _ =( Q! iQ , w( WI> I< ͉" H   ]" 1  uj] MB( & M SI$ F* ! ]- " p   - +( * Q jO9 1 K (  N  "Y DMO5 F 5 L, g U1 ) } jmQ 7 ( m( , 1 M M) H< iq}* N< 6A t  _& y{y G AE& e] {y p- jE1 * ^EiY M, Y 8 ]I p(  L A = - cQ * p ͤ$ AN( & - !( < (qY ! ' 0  eY BA 0 1*  H -9 N* =I}& }O$ E HE " ] ]( s e,   0  H  Œ0  U Y GE( 5" % Q !!Py"  & u~& i R) %* Y @]& E( I* n  Y, ? ` ś5 Q=  kG iN( = UU EM t 5 ( Y D  WO5 "  " H ~~m $ YN 4I uRU -MM ui  TpLhu c ͘  19 k Q`E$ PP@ME  G0"UL " NY 4" x!2 i|& ٴ aH Y V~Jg=   w o$  ]Y " @} -, 7 i %= p `4  NɳM dPi Iq YJ5 ,  eI , @, U2  0-"   u V% - ( uI mIY  [=  M (V aA 1 ^p `0Q uM  3Q    9$ UE P ѥ$ b@0Y | Pa F Y    F*  = $ U 6q YH ŏE  1- #5  8ihi "}m eWm )M \  NI "1 b]$ C  CU$ #NM $4 pF= WG  ` Ou rP B @^  0 i ^% _init_fini__cxa_finalize__deregister_frame_info__register_frame_infostderrexitstrndupstrlenmnl_attr_put_strzmallocmnl_nlmsg_batch_startmnl_attr_get_typemnl_attr_validatemnl_attr_get_u32ntohlmnl_attr_parse_nestedmnl_nlmsg_put_headermnl_nlmsg_put_extra_headerhtonsmnl_attr_get_payload_lenmnl_attr_get_payloadmemcpymnl_attr_type_valid__errno_locationstrerrormnl_attr_get_strstrdupnftnl_batch_alloccallocnftnl_batch_freemnl_nlmsg_batch_headmnl_nlmsg_batch_stopnftnl_batch_buffermnl_nlmsg_batch_currentnftnl_batch_updatemnl_nlmsg_batch_nextnftnl_batch_buffer_lenmnl_nlmsg_batch_sizenftnl_batch_iovec_lenmnl_nlmsg_batch_is_emptynftnl_batch_iovecnftnl_flowtable_allocnftnl_flowtable_freenftnl_flowtable_is_setnftnl_flowtable_unsetnftnl_flowtable_set_datanftnl_flowtable_setnftnl_flowtable_set_u32nftnl_flowtable_set_s32nftnl_flowtable_set_strnftnl_flowtable_set_u64nftnl_flowtable_set_arraynftnl_flowtable_getnftnl_flowtable_get_strnftnl_flowtable_get_u32nftnl_flowtable_get_u64nftnl_flowtable_get_s32nftnl_flowtable_get_arraynftnl_flowtable_nlmsg_build_payloadmnl_attr_nest_starthtonlmnl_attr_put_u32mnl_attr_nest_endmnl_attr_put_u64nftnl_flowtable_nlmsg_parsememsetmnl_nlmsg_get_payloadmnl_attr_parsemnl_attr_get_u64nftnl_flowtable_parsenftnl_flowtable_parse_filenftnl_flowtable_snprintfnftnl_flowtable_fprintfnftnl_flowtable_list_allocnftnl_flowtable_list_freenftnl_flowtable_list_is_emptynftnl_flowtable_list_addnftnl_flowtable_list_add_tailnftnl_flowtable_list_delnftnl_flowtable_list_foreachnftnl_nlmsg_build_hdrnftnl_parse_err_allocnftnl_parse_err_freenftnl_parse_perrornftnl_batch_beginnftnl_batch_endnftnl_batch_is_supported__stack_chk_guardsysconf__time64mnl_socket_openmnl_socket_bindmnl_socket_sendto__stack_chk_failmnl_socket_recvfrommnl_socket_get_portidmnl_cb_runmnl_socket_closenftnl_gen_allocnftnl_gen_freenftnl_gen_is_setnftnl_gen_unsetnftnl_gen_set_datanftnl_gen_setnftnl_gen_set_u32nftnl_gen_get_datanftnl_gen_getnftnl_gen_get_u32nftnl_gen_nlmsg_parsenftnl_gen_snprintfnftnl_gen_fprintfnftnl_table_allocnftnl_table_freenftnl_table_is_setnftnl_table_unsetnftnl_table_set_datanftnl_table_setnftnl_table_set_u32nftnl_table_set_u64nftnl_table_set_u8nftnl_table_set_strnftnl_table_get_datanftnl_table_getnftnl_table_get_u32nftnl_table_get_u64nftnl_table_get_u8nftnl_table_get_strnftnl_table_nlmsg_build_payloadmnl_attr_putnftnl_table_nlmsg_parsenftnl_table_parsenftnl_table_parse_filenftnl_table_snprintfnftnl_table_fprintfnftnl_table_list_allocnftnl_table_list_freenftnl_table_list_is_emptynftnl_table_list_addnftnl_table_list_add_tailnftnl_table_list_delnftnl_table_list_foreachnftnl_table_list_iter_createnftnl_table_list_iter_nextnftnl_table_list_iter_destroynftnl_trace_allocnftnl_trace_freenftnl_trace_is_setnftnl_trace_get_datanftnl_trace_get_strnftnl_trace_get_u16nftnl_trace_get_u32nftnl_trace_get_u64nftnl_trace_nlmsg_parsemnl_attr_get_u16ntohsmnl_attr_get_u8nftnl_chain_allocnftnl_chain_is_setnftnl_chain_unsetnftnl_chain_set_datanftnl_chain_setnftnl_chain_set_u32nftnl_chain_set_s32nftnl_chain_set_u64nftnl_chain_set_u8nftnl_chain_set_strnftnl_chain_set_arraynftnl_chain_get_datanftnl_chain_getnftnl_chain_get_strnftnl_chain_get_u32nftnl_chain_get_s32nftnl_chain_get_u64nftnl_chain_get_u8nftnl_chain_get_arraynftnl_chain_nlmsg_build_payloadnftnl_chain_rule_addnftnl_chain_rule_delnftnl_chain_rule_add_tailnftnl_chain_rule_insert_atnftnl_chain_rule_append_atnftnl_chain_nlmsg_parsenftnl_chain_snprintfnftnl_chain_fprintfnftnl_rule_foreachnftnl_rule_lookup_byindexnftnl_rule_iter_createnftnl_rule_iter_nextnftnl_rule_iter_destroynftnl_chain_list_allocnftnl_chain_list_is_emptynftnl_chain_list_addnftnl_chain_list_add_tailnftnl_chain_list_delnftnl_chain_list_foreachnftnl_chain_list_lookup_bynamestrcmpnftnl_chain_list_iter_createnftnl_chain_list_iter_nextnftnl_chain_list_iter_destroynftnl_obj_allocnftnl_obj_is_setnftnl_obj_unsetnftnl_obj_set_datanftnl_obj_setnftnl_obj_set_u8nftnl_obj_set_u16nftnl_obj_set_u32nftnl_obj_set_u64nftnl_obj_set_strnftnl_obj_get_datanftnl_obj_getnftnl_obj_get_u8nftnl_obj_get_u16nftnl_obj_get_u32nftnl_obj_get_u64nftnl_obj_get_strnftnl_obj_nlmsg_build_payloadnftnl_obj_nlmsg_parsenftnl_obj_parsenftnl_obj_parse_filenftnl_obj_snprintfnftnl_obj_fprintfnftnl_obj_list_allocnftnl_obj_list_is_emptynftnl_obj_list_addnftnl_obj_list_add_tailnftnl_obj_list_delnftnl_obj_list_foreachnftnl_obj_list_iter_createnftnl_obj_list_iter_nextnftnl_obj_list_iter_destroynftnl_rule_allocnftnl_rule_is_setnftnl_rule_unsetnftnl_rule_set_datanftnl_rule_setnftnl_rule_set_u32nftnl_rule_set_u64nftnl_rule_set_strnftnl_rule_get_datanftnl_rule_getnftnl_rule_get_strnftnl_rule_get_u32nftnl_rule_get_u64nftnl_rule_get_u8nftnl_rule_add_exprnftnl_rule_del_exprnftnl_rule_nlmsg_parsemnl_attr_okmnl_attr_nextnftnl_rule_parsenftnl_rule_parse_filenftnl_rule_fprintfnftnl_expr_foreachnftnl_expr_iter_createnftnl_expr_iter_nextnftnl_expr_iter_destroynftnl_rule_list_allocnftnl_rule_list_is_emptynftnl_rule_list_addnftnl_rule_list_insert_atnftnl_rule_list_add_tailnftnl_rule_list_delnftnl_rule_list_foreachnftnl_rule_list_iter_createnftnl_rule_list_iter_curnftnl_rule_list_iter_nextnftnl_rule_list_iter_destroynftnl_set_allocnftnl_set_is_setnftnl_set_get_datanftnl_set_getnftnl_set_get_strnftnl_set_get_u32nftnl_set_get_u64nftnl_set_add_exprnftnl_set_expr_foreachnftnl_set_parsenftnl_set_parse_filenftnl_set_snprintfnftnl_set_fprintfnftnl_set_elem_addnftnl_set_list_allocnftnl_set_list_is_emptynftnl_set_list_addnftnl_set_list_add_tailnftnl_set_list_delnftnl_set_list_foreachnftnl_set_list_iter_createnftnl_set_list_iter_curnftnl_set_list_iter_nextnftnl_set_list_iter_destroynftnl_set_list_lookup_bynamenftnl_set_elem_allocnftnl_set_elem_is_setnftnl_set_elem_getnftnl_set_elem_get_strnftnl_set_elem_get_u32nftnl_set_elem_get_u64nftnl_set_elem_add_exprnftnl_set_elem_expr_foreachnftnl_set_elem_parsenftnl_set_elem_parse_filenftnl_set_elem_snprintfnftnl_obj_freenftnl_obj_list_freenftnl_rule_freenftnl_chain_freenftnl_chain_list_freenftnl_rule_list_freenftnl_set_unsetnftnl_set_set_datanftnl_set_setnftnl_set_set_u32nftnl_set_set_u64nftnl_set_set_strnftnl_set_nlmsg_parsenftnl_set_elem_freenftnl_set_freenftnl_set_list_freenftnl_set_elems_nlmsg_parsenftnl_set_elem_unsetnftnl_set_elem_setnftnl_set_elem_set_u32nftnl_set_elem_set_u64nftnl_set_elem_set_strnftnl_rule_nlmsg_build_payloadnftnl_set_nlmsg_build_payloadnftnl_set_elem_nlmsg_build_payloadnftnl_set_elem_nlmsg_buildnftnl_set_elems_nlmsg_build_payloadnftnl_rule_snprintf__umoddi3__udivdi3mnl_attr_put_u8mnl_attr_put_u16nftnl_set_elem_fprintfnftnl_set_elem_foreachnftnl_set_elems_iter_createnftnl_set_elems_iter_curnftnl_set_elems_iter_nextnftnl_set_elems_iter_destroynftnl_ruleset_allocnftnl_ruleset_is_setnftnl_ruleset_getnftnl_ruleset_ctx_is_setnftnl_ruleset_ctx_getnftnl_ruleset_ctx_get_u32nftnl_ruleset_parse_file_cbnftnl_ruleset_parse_buffer_cbnftnl_ruleset_parsenftnl_ruleset_parse_filenftnl_udata_buf_allocnftnl_udata_buf_freenftnl_udata_buf_lennftnl_udata_buf_datanftnl_udata_buf_putnftnl_udata_startnftnl_udata_endnftnl_udata_typenftnl_udata_lennftnl_udata_getnftnl_udata_get_u32nftnl_udata_nextnftnl_udata_putnftnl_udata_put_strznftnl_udata_put_u32nftnl_udata_parsenftnl_udata_nest_startnftnl_udata_nest_endnftnl_expr_allocnftnl_expr_freenftnl_expr_is_setnftnl_expr_setnftnl_expr_set_u8nftnl_expr_set_u16nftnl_expr_set_u32nftnl_expr_set_u64nftnl_expr_set_strnftnl_expr_getnftnl_expr_get_u8nftnl_expr_get_u16nftnl_expr_get_u32nftnl_expr_get_u64nftnl_expr_get_strnftnl_expr_build_payloadnftnl_expr_snprintfnftnl_expr_fprintfnftnl_expr_add_exprnftnl_expr_expr_foreachnftnl_set_elems_nlmsg_build_payload_iternftnl_ruleset_freenftnl_ruleset_unsetnftnl_ruleset_setnftnl_ruleset_ctx_freenftnl_ruleset_snprintfnftnl_ruleset_fprintfmnl_attr_put_strnftnl_tunnel_opt_get_datanftnl_tunnel_opt_getnftnl_tunnel_opt_get_u8nftnl_tunnel_opt_get_u16nftnl_tunnel_opt_get_u32nftnl_tunnel_opt_get_typenftnl_tunnel_opt_get_flagsnftnl_obj_tunnel_opts_foreachnftnl_tunnel_opts_allocnftnl_tunnel_opts_addnftnl_tunnel_opts_freenftnl_tunnel_opt_allocnftnl_tunnel_opt_setlibmnl.so.0libgcc_s.so.1libc.solibnftnl.so.11LIBNFTNL_11LIBNFTNL_12LIBNFTNL_13LIBNFTNL_14LIBNFTNL_15LIBNFTNL_16LIBNFTNL_17LIBNFTNL_18GLIBC_2.0LIBMNL_1.0                                             !!a !!b $-!!!c $9!-!d $E!9!e $Q!E!f $]!Q!g $i!]! h u!i!  ii ! `/5 !|  $(,048<@DHLPTX\`dhlpx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@D $(,0@DHLPTXhlptx|  048<@Dp|  ,8<@DHLX`dhlptx  $(4<@DHLPT`lptx| $(,0<HLPTX\htx| $(,048DPTX\`dpx|  ,048<@LX\`dhlx (48<@DHT`dhlpt $0<@DHL!' '<@?'!'!@@ D8@8 @$$! '<>'!H@H!$ @$j @2ietg-`T`T`Tau5`U`(%ua؞\ Nt`؞|N t` tu`ua؞|N Fgu`u`--؞|N؞\N؞\N؞\Nea@@"a@ A j @2iedgpLxg0\K:eg@gel@8ej @2iedgpLxg0\Kg:e@gel@8eejG @2idejD@$glg"\g@=ee\gpD@:e@"`m@jvdjKej @2idlejDl "ug&g*`]`ug`u`&-Pg@?eJ@Pgudu$` ]`uXg"u`h uaj@8Hj@Hj@Hj@H@j@Hj@(HjG @2ide\ggPT@:eMjjaddT5I堀HIej @2iedgPTg:e@%ge/"Q*s*ar`^\r$`\ؘgmNg@:ePTeg@:e(J}gikeomg@8ewdmj @2iedgҐD l@:ee&""g B D@:eҞe"gL@:eBٞe *@=eeg@8eiQgvdj @2iedgҰ\%g@:ereaP m@:ee*0D @:e0ge@8e`hqK@X`hjudjKj @2iedgҰ\$g@:ere a0P lMg@8eudjejG @2ide\g%g\@:e" gjemC\gDbmg@:e "g`žejA\g}gH@:eAPgudj @2ide,jvd"P m@:eRe;`H@:e0@e@:eghmJq/aP m@:eRe`H@:e0@e@:egum.q2`Y`Yaq`ud jYaqa (1% @P m@:eRe`H@:e0@e@:eg_m0 L@8eP m@:eRe`H@:e0@e@:egcmP m@:eRe`H@:e0@e@:eg~mX @:ee*H@:e0@e@:eg𘘄mj @2iedgҰ\$g@:ere`r&`ud jPmg@:eRe`H@:e0@e@:emg4M0 L@8e !Pmg@:eRe`H@:e0@e@:emg9M "ڼej% @2iedgҰ\@:e"g0D e m@:eReaY3`Yq`q `Y `q ` (1% @ud jq(aP m@:eRe`H@:e0@e@:egm0 L@8e Y!` Y<`q`qaP m@:eRe`H@:e0@e@:eg m qaP m@:eRe`H@:e0@e@:eg mP m@:eRe`H@:e0@e@:eg mP m@:eRe`H@:e0@e@:eg mej @2iedgҰ\$g@:e0Demg@:eRe)aJZ `Pmg@:eRe`H@:e0@e@:e0 g@mL@8e H2I vd jj @2iedgҰ\@:e"g0D em@:eReaY `%) (1% @ud jqaP m@:eRe`H@:e0@e@:eg`mP m@:eRe`H@:e0@e@:eg`m0 L@8eej% @2iedgҰ\@:e"g0D em@:eRe aq`Y(`Y `D) (1% @ud jqaP m@:eRe`H@:e0@e@:emgBM9q=`qaP m@:eRe`H@:e0@e@:emgJMP m@:eRe`H@:e0@e@:emg:M0 L@8eP m@:eRe`H@:e0@e@:emg>MP m@:eRe`H@:e0@e@:emgFMj @2iedgҰ\@:e"g0D e m@:eReaq `Y-`qm`Y `OA1ZGa (1% @ud jqaP m@:eRe`H@:e0@e@:emgZM<qw`HAJ1Z`P m@:eRe`H@:e0@e@:emggMP m@:eRe`H@:e0@e@:emgRM0 L@8eP m@:eRe`H@:e0@e@:emgVMP m@:eRe`H@:e0@e@:emg^MP m@:eRe_`H@:e0@e@:emgbMj @2iedgҰ\$g@:e0Demg@:eRe)aJZ `Pmg@:eRe`H@:e0@e@:e0 g mL@8e H2I vd jjE @2iedgҰ\$g@:e0Demg@:eRe aJZ`D3 m`i))C yykCC)Pmg@:eRe`H@:e0@e@:egm0 L@8ePmg@:eRe}`H@:e0@e@:eg mPmg@:eReb`H@:e0@e@:eg mP mg@:eReG`H@:e0@e@:eg mPmg@:eRe,`H@:e0@e@:eg mPmg@:eRe`H@:e0@e@:eg ms H2I vd jj @2iedgҰ\%g@:e0D em@:eRear`r6`vd jP m@:eRe`H@:e0@e@:eg` m0 L@8e0D @:e0eg@8eUj}m]PL0 gM@:ere`H@:e0@e@:eg`mj @2iedgҰ\@:e"g0D em@:eRe aY `YO`q-`) (1% @ud jq]`q`HAJ1Z`P m@:eRe`H@:e0@e@:egmP m@:eRe`H@:e0@e@:egm0 L@8eP m@:eRe`H@:e0@e@:eg mP m@:eRe`H@:e0@e@:egmj$ @2iedgҰ\@:e"g0D em@:eReaY `%) (1% @ud jqaP m@:eRe`H@:e0@e@:eg`mP m@:eRe`H@:e0@e@:eg`m0 L@8eejd @2i de#$jD@gl'g"򠘀@=eepH @:eeg@8e@"`m@jvdjKej @2ied @2iedgp\:e@%g" q `0n HMg@8evdej @2idvejl`r`r(`ALG`GA J9 r` r `rNaAL<`GA!J AAgnM L\g0@,J@:evdAAgnM LAL`GAJC`A5L `GA9JCanA1L`GA5J`D@C`G@JCn\gg@@:e&bjl"\g@=ee\gD@:egeL+"`ICa\g@g@:eM jDbmBjC`ICA!L`GA%JA%L`GA)JjKj @2iedgx2^KiP@8eddj{ @2i de\g P@o@:eDdj[ @2ide\g P@o@:eDdj @2iedgPTg:e@&gP e8eg@Budj @2idbejDlB" ]@`gg&g2 I@U!37?GOW_gj@ HPgudPg@?eJ@j@Hj@aCM`PgCgjl"\gؚ\Ng@:eReaCM ` Cg jl_"\gؚ\Ng@:eKjtjjjj3 @2idef\gؚ\'gN@:eRe N@:eReg;a C`Cg K bjl"\g ؚ\ ^N@:eRe$a AC`Cg K bjl"\g ؚ\ }N@:eRaAPgudjhhjej @2id'geDr\g'aؚ^N@8eeRg,ag`gꙷ'\gؚ\}N@:eRaAPgwdؚIGE~N@8eemhj @2ideBkLg'g#Dbg[`xH2KiؘE=N@8evd|Okl "ؘ柽N@8ejej @2idbejlraRgؘ课N@8eR`jedjd @2idbejl "gؘN@8eR`jddej$ @2idbejl%"\gZ'g#`xH2KiEfZ`ؘH2N@$ؘӾN@8eR`jwd|OX|Jj @2ideogNmLؘ< N@8efdejc @2ide RgXؘ8eN@3Oedej# @2idegPmؘLN@8efdej @2iedgؘN@8eddj @2ide Ro Qg PNmؘLN@8ehdej @2id ҚeGln* RgؘN@8eR`jedej# @2idekGgL'g$\gؚ\^N@:eRe }aCg`PgC^gl"\gؚ\ ^Ng@:eReja CM `PgCPglO" R \g x @KD2H2i @*j \gؚ \~Ng@:eRe=a CM `PgCGA-J \giX D2 mh3m䀛&a\gؚ \~Ng@:eRa I ik` ydklj ӂj Ҁjja(4`+ ^O H2I`B@n"\g ؚӰ\~Ng@:eRe a CM `PgC IJ ҝjjc @2iduҚe aggؘNm0L@8edd jj# @2iedg0OؘҞN@8eddj @2idePG'gL$\gؚ\ ^N@:eReg|a gC`Cg K Bgl"\g ؚ\ ^N@:eReda AC`Cg K 4gl"\g ؚ\ N@:eReIa AC`Cg K &gl"\g ؚ\ N@:eRe.a AC`Cg K gl"\g ؚ\ N@:eRaA k `Pgudljhhjjjej @2ideRg'g"r\g`|O|gXg=JgҰ\@:eReҠaCbg`PgCi \gPT@:ege\g\ g@:eReaCM`PgbCjl"\gؚ\Ng@:eRe aCM`PgCbjl"\gؚ\Ng@:eReoaCM`PgCb jl"\gؚ\> Ng@:eReTaCM`PgCb@jl"\gؚ\^Ng@:eRe9aCM`PgCbjl"\gؚ\}Ng@:eRaIwd\gO3O.lkj@j^jzjjjej @2idҚe'g ggPT@:ege\ؘ =N@:eReg;a C`Cg K bjl"\g ؚ\ N@:eRe"a AC`Cg K bjl"\g ؚ\ N@:eRaAPgudjhjj @2ideEgrggg`r`raL`C`C`LL@8edd jej @2ideEgrggg`Z `r!`r!`r`r`dd jr`r`ra$LL`C`C `LLL L(L,L@8ej @2ideEgrggg`Z`r `r`dd jraLL`C`C`LL@8ej @2ideEgrggg`r`raL`C`C`L L@8edd jejB @2ideEgrggg*`Z `r`r"`r `jKddr`r`ra$LL`C`C`L@8ejL L(LLj @2ideEgrggg`r`raL`C`C`LL@8edd jejb @2ideEgrggg`Z`r`r`jKddraLL`C`C`L@8ejLj @2ideEgrggg`ra8L`C`C`0L@8edd jej @2ideEgrggg`r`r aؘgNm3L@8edd j0L`C`C`2L@8eejB @2ideEgrggg`r`ra0L`C`C`8L@L@8edd jej @2ideEgJ Z<`gggD3 m`ie159=AEIMQUY0L`C`C`4L8LL@8e H2I vd jeja @2iedgҰ\@:e"g0D em@:eReaY `$) (1% @ud jqaP m@:eRe`H@:e0@e@:egWmP m@:eRe`H@:e0@e@:egSm0 >L@8eej @2iedgҰ\@:e"g0D em@:eReDaq#`q`q9aP m@:eRe/`H@:e0@e@:egKm0 ^L@8eP m@:eRe`H@:e0@e@:egOm (1% @ud jj @2iedgҰ\@:e"g0D em@:eRe aq `q'` (1% @ud jP m@:eRe`H@:e0@e@:egEm0 ^L@8eP m@:eRe`H@:e0@e@:egImj! @2iedgҰ\$g@:e0Demg@:eRe(aJZ`Pmg@:eRe`H@:e0@e@:e0 gEm~L@8e H2I vd jej @2iedgҰ\@:e"g0D em@:eRe^aq#`q;`qSaP m@:eReI`H@:e0@e@:egYm0 ~L@8eP m@:eRe*`H@:e0@e@:eg]mP m@:eRe`H@:e0@e@:egam (1% @ud jj @2iedgҰ\$g@:e0Demg@:eRe(aJZ`Pmg@:eRe`H@:e0@e@:e0 gDmL@8e H2I vd jej @2iedgҰ\$g@:e0Demg@:eRe(aJZ`Pmg@:eRe`H@:e0@e@:e0 gNmL@8e H2I vd jeja @2iedgҰ\$g@:e0Demg@:eRe(aJZ`Pmg@:eRe`H@:e0@e@:e0 gNmL@8e H2I vd jej @2iedgҰ\$g@:e0De mg@:eRe(aJZ`Pmg@:eRe`H@:e0@e@:e0 gnmL@8e H2I vd jejA @2iedgҰ\$g@:e0Demg@:eRe(aJZ`Pmg@:eRe`H@:e0@e@:e0 gMmL@8e H2I vd jej @2iedgҰ\@:e"g0D em@:eRe^aq#`q;`qSaP m@:eReI`H@:e0@e@:egEm0 L@8eP m@:eRe*`H@:e0@e@:egJmP m@:eRe`H@:e0@e@:egOm (1% @ud jj @2iedgҰ\@:e"g0D em@:eReEaq$`j,r9aP m@:eRe/`H@:e0@e@:egHm0 L@8eP m@:eRe`H@:e0@e@:egMm (1% @ud jej @2iedgҰ\@:e"g0D em@:eRe.aq/`Y#`OA1Z!`P m@:eRe`H@:e0@e@:egTm0 L@8eq` (1% @ud jP m@:eRe`H@:e0@e@:egXmj @2iedgҰ\$g@:e0Demg@:eRe(aJZ`Pmg@:eRe`H@:e0@e@:e0 gBmL@8e H2I vd jej @2iedgҰ\@:e"g0D em@:eReDaq#`q`q9aP m@:eRe/`H@:e0@e@:egFm0 L@8eP m@:eRe`H@:e0@e@:egJm (1% @ud jj @2iedgҰ\@:e"g0D e m@:eReaY`Ye`q*`Y`q&` (1% @ud j Y;a qaP m@:eRe`H@:e0@e@:eg𘘄mP m@:eRe`H@:e0@e@:eg~m0 L@8eP m@:eRe`H@:e0@e@:eg𘘉mP m@:eRe`H@:e0@e@:eg𘘎mj @2iedgҰ\$g@:e0De mg@:eRe(aJZ`Pmg@:eRe`H@:e0@e@:e0 gmL@8e H2I vd jej @2iedgҰ\@:e"g0D e m@:eReaY `$) (1% @ud jqaP m@:eRe`H@:e0@e@:egmP m@:eRe`H@:e0@e@:egm0 L@8eej  @2iedgҰ\$g@:e0Demg@:eRe(ar aPmg@:eRe`H@:e0@e@:e0 gmL@8e H2I vd jej @2iedgҰ\@:e"g0D em@:eReaY `') (1% @ud jMA1Z`P m@:eRe`H@:e0@e@:egmP m@:eRe`H@:e0@e@:eg m0 L@8eej @2iedgҰ\@:e"g0D em@:eReaaq$`q=`qVaP m@:eReL`H@:e0@e@:eg m0 L@8eP m@:eRe,`H@:e0@e@:eg mP m@:eRe`H@:e0@e@:eg m (1% @ud jej @2iedgҰ\@:e"g0D em@:eReaY `&) (1% @ud jMA1Z`P m@:eRe`H@:e0@e@:egXmP m@:eRe`H@:e0@e@:egRm0 >L@8eej @2iedgҰ\@:e"g0D em@:eRe^aq#`q;`qSaP m@:eReI`H@:e0@e@:eg@m0 > L@8eP m@:eRe*`H@:e0@e@:egDmP m@:eRe`H@:e0@e@:egHm (1% @ud jj @2idegA%gҰ\@:e0D e@:eRe,a*"@c&aP m@:eRe`H@:e0@e@:e0 gmm>L@8eH2I |vd jej_ @2iedgҰ\@:e"g0D em@:eRe^aq#`q;`qSaP m@:eReI`H@:e0@e@:egm0 >L@8eP m@:eRe*`H@:e0@e@:egmP m@:eRe`H@:e0@e@:egm (1% @ud jj_ @2iedgҰ\@:e"g0D em@:eRe aqe`Y `q(`qE` (1% @ud jqo`qaP m@:eRe`H@:e0@e@:egZmP m@:eRe`H@:e0@e@:egJm0 ^L@8eP m@:eRe`H@:e0@e@:egNmP m@:eRe`H@:e0@e@:egRmP m@:eRe`H@:e0@e@:egVmej @2ide @2idbejlg%g"P@:e emg@?eebjl"P@:e emg@?eebjl"P@:e emg@8eudej @2idbe jlg%g"P@:e emg@?eebjl"P@:e emg@?eebjl"P@:e emg@?eebjl"P@:e emg@?eebjl"P@:e emg@?eeb@jl"P@:e emg@?eebjl"P@:e emg@?eebjJl"P@:e emg@8eudj^ @2idbejlg%g"P@:e emg@?eebjl"P@:e emg@8eudej @2idbejlg%g"P@:e emg@?eebjl"P@:e emg@8eudej~ @2idbejlg%g"P@:e emg@?eebjl"P@:e emg@?eebjl"P@:e emg@?eebjl"P@:e emg@?eeb jl"P@:e emg@?eeb@jl"P@:e emg@?eebjl"P@:e emg@8eudej> @2idbejlg%g"P@:e emg@?eebjl"P@:e emg@?eebjl"P@:e emg@8eudej @2ideEgrg Ng@:eRegCaC`QgG\g 0\m@:ee" \ggؚ困\ ^N@:eRe(aCA`QgG\g 0\m@:ee" \ggؚ曰\ }N@:eRaAPgudjhhje%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x w$%x u$%x t$%x r$%x j$%x h$%x e$%x d$%x b$%x a$%x _$%x [$%x Z$%x V$%x U$%x S$%x R$%x P$%x L$%x E$%x B$%x A$%x @$%x 7$%x 6$%x 5$%x 4$%x 3$%x 1$%x 0$%x -$%x ,$%x &$%x  $%x $%x $%x $%x $%x $%x $%x $%x  $%x  $%x  $%x  $%x $%x $' 'preroutinginputforwardoutputpostroutingingressunknownlibnftnl: attribute %d > %d (maximum) assertion failed in %s:%d libnftnl: attribute %d assertion failed in %s:%d %c\x%02hhxelement - : %u [end] userdata = { }acceptdropstolenqueuerepeatstopreturnjumpgotocontinuebreaknf_tables kernel ABI is broken, contact your vendor. %s:%d reason: %s flowtable.ctrace.cchain.cobject.crule.cset_elem.cflow table %s %s use %u size %u flags %x hook %s prio %d dev { } %s: Bad input format in line %d column %d %s: Node "%s" not found %s: Invalid type in node "%s" %s: Operation not supported %s: Undefined error ruleset generation ID %utable %s %s flags %x use %d handle %llu%s %s %s use %u type %s hook %s prio %d policy %s packets %llu bytes %llu dev %s flags %x id %x(unknown)table %s name %s use %u [ %s ]%s %s %x timeout %llums gc_interval %ums policy %u size %u backend %s count %u %s%s%s%llu%s%u [ %s userdata = { synproxyct_expectsecmarkct_timeouttunnelct_helperquotacounterinetarpnetdevbridgereg %u = %s(reg %u, %u, %u) count %u flags %x pkts %llu bytes %llu sreg_addr %u sreg_dev %u tcpopt ipv6 ipv4 presentload%s %ub @ %u + %u%s => reg %u write%s reg %u => %ub @ %u + %u reset tcpopt %u op %u len %u type %u offset %u flowtable %s . unknown 0x%x%s%s => reg %d nfproto %u never packetsbytesrate %llu/%s burst %u type %s flags 0x%x prefix %s group %u snaplen %u qthreshold %u level %u tcpseq tcpopt ipopt uid macdecode reg %u set %s dreg %u 0x%x name %s rev %u set %s with reg %u load %s => reg %u reg %u = inc mod %u reg %u = random mod %u offset %u %.*sexpr.cexpr/bitwise.cexpr/byteorder.cexpr/cmp.cexpr/range.cexpr/connlimit.cexpr/counter.cexpr/ct.cexpr/data_reg.cexpr/dup.cexpr/exthdr.cexpr/flow_offload.cexpr/fib.cexpr/fwd.cexpr/last.cexpr/limit.cexpr/log.cexpr/lookup.cexpr/dynset.cexpr/immediate.cexpr/inner.cexpr/match.cexpr/meta.cexpr/numgen.cexpr/nat.c%s*originalreply, dir %s %s reg_key %u set %s sreg_data %u timeout %llums expr [ %s ] type %u hdrsize %u flags %x [0x%s%.8x reg %u = ( reg %u %s ) reg %u = ( reg %u & ) ^ <<>>&|^%s reg %u xfrmosfsocketflow_offloadobjreffibhashdynsettargetrtrejectredirrangepayloadnotracktproxynatnumgenmetamatchmasqlookuploglastinnerimmediatefwdexthdrdupconnlimitcmpbyteorderbitwiselenprotocolprioritymarkiifoifiiftypeoiftypeskuidskgidnftracertclassidnfprotol4protobri_iifnamebri_oifnamepkttypecpuiifgroupoifgroupcgroupprandomsecpathiifkindoifkindbri_iifpvidbri_iifvprototimedayhoursdifsdifnamebrouteibrhwaddraddupdatedeletesecondminuteweektypesaddrdaddrstatedirectionstatusexpirationhelperl3protocolsrcdstproto_srcproto_dstlabelavgpktzoneeventsrc_ipdst_ipsrc_ip6dst_ip6ideqneqltltegtgtentohhtonsreg %u set %s type %u name %s write reg %u => %ub @ %s header + %u csum_type %u csum_off %u csum_flags 0x%x load %ub @ %s header + %u => reg %u num %u-%usreg_qnum %u bypass fanout bytes %llu consumed %llu flags %u type %u code %u proto_min reg %u proto_max reg %u reg %u = symhash() %% mod %u reg %u = jhash(reg %u, %u, 0x%x) %% mod %u mss %u wscale %u load %s %u %s => reg %u name %s family %d protocol %d bytes %llu flags %u id %u rate %llu unit %llu burst %u type %u flags %u UNKNOWNfamily %d protocol %d policy = {%s = %u,}context %s dport %d timeout %d size %d snatdnataddr_min reg %u addr_max reg %u addr reg %u port reg %u expr/tproxy.cexpr/objref.cexpr/payload.cexpr/queue.cexpr/quota.cexpr/reject.cexpr/rt.cexpr/target.cexpr/tunnel.cexpr/masq.cexpr/redir.cexpr/hash.cexpr/socket.cexpr/synproxy.cexpr/osf.cexpr/xfrm.cobj/counter.cobj/quota.cobj/tunnel.cobj/limit.cobj/synproxy.cobj/ct_timeout.cobj/ct_expect.cobj/ct_helper.cobj/secmark.c-> %s UNREPLIEDREPLIEDSYN_SENTSYN_RECVESTABLISHEDFIN_WAITCLOSE_WAITLAST_ACKTIME_WAITCLOSESYN_SENT2RETRANSUNACKNOWLEDGEDdaddr4daddr6saddr4saddr6reqidspiinouttransparentwildcardcgroupv2pathclassidnexthop4nexthop6tcpmssipseclinknetworktransport_@_ X0ht (08@HT\dp|  $,4<<<DtLT\dlxLT $$tHl@d8 \0T(xL p  XP$,4<DHLP\ht| w  Lewɻuq %}%E0wA@0v !MwAAծ]@-vuMqqv-~@@@@@@@P 5v-Y~ he v})~x%{u͸} AIa} ] :MݭmY]5x$  m0y(( 1}u|00 -eKJSqPAW8,$Qu}m{4هuYzT Dut9y@Xɼ= {Ddݳ1uEIzL p5=Te)b&^\ ]tY}xdl 1tMͅte 55a-كx I4, U 3,9,i qQ2+  $i{4 ;)ML5 =<] h 9AM@uy ?E?1KK9VYRXH5fcu*^  1 )m)  U9Q7Q=0 (Hy86iLu>=>m/'L ee-b&]0.!%QHdA`y#!\x<x<x x,,! Zeh%~!CaCI~ {D ~aggESm_Ydm aH~YMuph͘1`EP@M0UL !i|ٴaH ]}-i%p`ɳPIYJe@U0- uVI=a1p`QuQ9EPѥ@0 PYFUqYHŏ15ih})1]UNpFG`PB@0 i%!07070101AE1D210000A1FF0000000000000000000000016A426C2800000014000000FE0000000000000000000000000000001900000000usr/lib/libmbedx509.so.7libmbedx509.so.3.6.607070101AE239F000081ED0000000000000000000000016A426C2800017153000000FE0000000000000000000000000000001A00000000usr/lib/libf2fs.so.10.0.0ELF4t4 (p888pPPPbbogt hhh  QtdRtdo  !  U`  9 0ppp p pwp"p0ooooaw+'#(@&NC8": H cvkBAF!QXLMp6%4 .T)$ZJ-01>5`<*,[7q 3=Y9dtoihaU glRP^KE;W2G/?D]rS_fIOVbm e\juns m-u <| 0 } L u 0 !&| D 2a a =" Y;U %@ 3=  505 cq -  D N %<6 <4 ) U = !  |)-D /R ]<6 U -4 2 a y  K= i0% f" AK %y sA4 #. su) x=9Y %U ^pUv`U5:M =2E iPU_@U0UkF 5 UU  NUHT# T& 3TXT;y :TX8. uT~ThT|qB ipTD`TXPTH ? @T0T` TsT QTCR$ !;6 S#Sl 9. S"2@ S`SS@S'3 :S9 GqC WpS_`SPS"@SW0SQ SnS."E=I 1S( : 3RReR\RR_fini__cxa_finalize__deregister_frame_info__register_frame_infosetmntentgetmntentstrcmphasmntoptendmntentutf8_to_utf16utf16_to_utf8log_base_2get_bits_in_bytetest_and_set_bit_letest_and_clear_bit_letest_bit_lef2fs_test_bitf2fs_set_bitf2fs_clear_bitfind_next_bit_lefind_next_zero_bit_lef2fs_dentry_hashf2fs_load_nls_tablemallocfreeaddrs_per_inodeaddrs_per_blockf2fs_max_file_offset__udivdi3f2fs_cal_crc32f2fs_crc_validf2fs_inode_chksumf2fs_checkpoint_chksumwrite_inodedev_write_blockget_rootdev__stack_chk_guard__stat_time64snprintflseek__stack_chk_failstrstrsscanfstrlenf2fs_init_configurationmemsetgetuidgetgidf2fs_dev_is_writablef2fs_dev_is_umountedputs__errno_locationf2fs_devs_are_umountedget_kernel_versionget_kernel_uname_versionunamef2fs_init_sparse_filef2fs_get_zoned_modelf2fs_get_zone_blocks__divdi3ioctlf2fs_check_zonesf2fs_get_device_infof2fs_get_f2fs_infocalc_extra_isizef2fs_str2encodingf2fs_encoding2strf2fs_get_encoding_flagsf2fs_str2encoding_flagsstrtokstrncmpdcache_releasedcache_initatexit__assert_fail__moddi3memcpydcache_update_cachedcache_readdev_read_versiondev_readdev_readaheadposix_fadvisedev_writedev_write_dumpdev_filldev_fill_blockdev_read_blockdev_reada_blockf2fs_fsync_devicefsyncf2fs_release_sparse_resourcef2fs_finalize_deviceget_sysfs_pathreadlinkstrrchrfopenfscanffclosef2fs_get_zone_chunk_sectorsatoi__umoddi3f2fs_report_zonecallocf2fs_report_zonesf2fs_reset_zonef2fs_reset_zonesf2fs_get_usable_segmentslibgcc_s.so.1libc.solibf2fs.so.10GLIBC_2.0 ii /P' '<'!'`@@ D܀@܀ b$$` '<'!$@ $d$ b$j] @2iegdp@Hr`r a@X`m*PD@:eDdjKj @2iedg0𤘐\kM@:eҞe*j,p@@:e"ge"pX @:ee*H0𤘑gM@:ee"Pk`ڐ@8eYXgknvdd}gFg bg8#a 4aC2`1@3-mi`e;eixg$yg,i+, #ll3,r3lnl.Lj3n+L3g majaC`Egg1d gg'EIxg ggajaC`@`3.1-m`leUdNag::e:63`3Tmakgio?aOWaKOWL`gegh&a1xge3..}1e3..y+ygT;e%aL@.raA.r`"m,eag5!guaOgKIۮj7de#Egy7wj @2i deg@2,ţ?i,£66,ã166,ģi6,Kap XRaDhm *000nML@8eXjKvd^aC66iN,&gn nNALp XRaDhm"Nj000nML@8ee?@j @2i degdg%g6aj@j Ip XR`XjKudDhm*000nML@8eR`^Ja@l[6?nnAKD`^8aC6 l6[4?nel>0H2iP2hAi Be=" mnPDM@:eRe.` m0DJ@:eRe ` XRaDhm *T0JL@:eejK 9#@8eDl@:e Ҟe*0\000nLjOM@:ePle@8eBp* P@:eRe` XRaDhm *0jLT@:ee0 @=ee Fbgjl rPD2a@hs.`@|@(+m@:eRe)`m 0DJ@:eRe` XRaDhm*0Lm@:eRe`m aB"0H@:ee*\J'*PD0mL@:eRe\` XRaDhm *T0L@:eejK\BM" L›o@:e eDeu+ kB[*U@ Fbgjl r a@>@:eRe_a K "@>@:ee " XR?aDhm?*0L# Fbgjlr a PHo›  raPDӵ@:eRe2` XRaDhm *T0L@:ee ŵBPD N@:eRe` XRaDhm*0 L bC` B Lo›@:e D>ee*S ҇BL8nmL@:eSjҪJ`j!j TjPDe m@:ebg XRe?aDm?* 0%0\+L@:ee XRaDhm*0KLc>>H2P2IPN# XR_aDhm_*0LG К&OF" XRaDhm *0\0L@:eePP>@:e xeS"?aDhm*0 LaDhm>"ڙAF*AG"" XRaDhm*\}00\L@:ee \}œBb,C`,ٝ xDI㹙cxg0𴘍 Xy@=eje Kr?a0*M0\0+L@:e XReaDhm* 0К񚬚MKL0\@:e XReaDhm* 00\L@:ee0*Ma#xXYLo:e @Zٞe{نdeh r@j @2ide$%x <$%x ;$%x 9$%x 8$%x 6$%x 5$%x 4$%x 1$%x 0$' 'ro[%s:%4d] illegal UTF-8 sequence [%s:%4d] name is too long [%s:%4d] illegal UTF-16 sequence [%s:%4d] CRC validation failed: cal_crc = %u, blk_crc = %u buff_size = 0x%x //sys/dev/block/%u:%u/ueventuevent[ASSERT] (%s:%4d) %s DEVNAMEDEVNAME=%s /dev/%s/proc/mountsInfo: Mounted device!/etc/mtab/dev/rootst_buf Error: In use by the system!%sawaremanaged Error: Failed to open a sparse file!stat_buf Error: Failed to get the device stat! Error: Failed to open the device!/proc/versionInfo: not exist /proc/version! Error: Using the default sector size Error: Cannot get the device sizeInfo: [%s] Disk Model: %.16s Error: Volume type is not supported!!! Error: Different sector sizes!!! Error: Failed to get number of blocks per zoneInfo: zoned: zone size %lluu (not a power of 2) Error: Failed to check zone configurationInfo: Host-%s zoned block device: %u zones, %lluu zone size(bytes), %u randomly writeable zones %zu blocks per zone Info: wanted sectors = %llu (in %llu bytes) Info: total device sectors = %llu (in %u bytes) Error: F2FS can support 16TB at most!!! Error: zones of different size are not supported Error: %s may not be a zoned block device Info: Segments per section = %d Info: Sections per zone = %d Info: sector size = %u Info: total sectors = %llu (%llu MB) utf8,nostrictSub %s Add %s : c, u, RA, CH, CM, Repl=%ld %ld %llu %llu %llu %llu libf2fs_io.cn > 0 lseek64 fail. read() fail. Error: Could not conduct fsync!!! Error: Sparse mode is only supported for android Error: Failed to close device file!!!Not-write-pointerEmptyImplicit-openExplicit-openClosedRead-onlyFullOfflineUnknown-cond/sys/dev/block/%d:%d/sys/dev/block/%s%s/partition%s/%squeue/zoned Info: can't find /sys, assuming normal block device Error: Failed to check the device zoned model Error: Failed to parse the device zoned modelnonehost-awarehost-managed Error: Unsupported device zoned modelqueue/chunk_sectors Error: Failed to get device sysfs attribute path[%s:%d] No memory for report zones [%s:%d] ioctl BLKREPORTZONE failed: errno=%d [%s:%d] Unexpected ioctl BLKREPORTZONE result Unknown-typeSequential-write-requiredSequential-write-preferred[%s:%d] No memory for zone capacity list. [%s:%d] ioctl BLKREPORTZONE failed [%s:%4d] Zone %05u: Conventional, cond 0x%x (%s), sector %llu, %llu sectors [%s:%4d] Zone %05u: type 0x%x (%s), cond 0x%x (%s), need_reset %d, non_seq %d, sector %llu, %llu sectors, capacity %llu, wp sector %llu [%s:%d] Invalid zones: last sector reported is %llu, expected %llu [%s:%d] Inconsistent number of zones: expected %u zones, got %u [%s:%d] No conventional zone for super block [%s:%d] ioctl BLKRESETZONE failed: errno=%d [%s:%d] ioctl BLKREPORTZONES failed [%s:%d] ioctl BLKRESETZONE failed Info: Discarded %llu MB get_device_infof2fs_dev_is_umountedget_rootdevf2fs_crc_validutf16_to_utf8utf8_to_utf16dcache_find(P`@ f2fs_reset_zonesf2fs_reset_zonef2fs_check_zonesf2fs_report_zonesf2fs_report_zonef cLN φe- Ը'≣5,"φm`he)edφddd <ຣφ φφφE;Eᇭ!φ偪㿩➩፩豈更φc㢫p鹿論 ׫縷電oφ1TNLKφIFhCφ黔cԻφ φφ φφt]Ҡ!φN-丽丸φp/咢哶4 𡚨𡛪 𡍪嬈嬾],寳𡬘8弳尢jφ派海 𣽞𣾎(災灷煅𤉣熜䎫φ*bH5直𥃳磌䃣䄯穀 𥥼𥪧 𥪧窮φQ  𣍟䏕荓菊C2 𦾱𧃒[蚈蜎蜨蝫螆䵗WYTtOMφeMԸ' ߍ9qφidybaqaφ6ada  =φ ࡥφφφ䞶 !φ䃦B!豈更φ%鹿論㌨kZ縷電uφ1mF'෿φ媻䣺㔹ƸφlcW^φ mφ\φ! φ\φҠ!φ丽丸φ咢哶4zi 𡚨𡛪 𡍪嬈嬾寳𡬘弳尢jφI'派海 𣽞𣾎災灷煅𤉣熜䎫φ直𥃳-磌䃣I䄯穀 𥥼𥪧 𥪧窮_φn] 𣍟䏕{WF荓菊 𦾱𧃒蚈蜎蜨蝫螆䵗fcLNφe-*5∜.+φf_a^(^]φ]d] φ1GF2*EφC=@㟶ѵવφwcbiφ xφgφ, φgφҠ!φ丽丸φ咢哶4t 𡚨𡛪ߑ 𡍪嬈嬾寳𡬘弳尢jφT2!派海 𣽞𣾎災灷煅𤉣熜䎫φ直𥃳8&磌䃣T䄯穀 𥥼𥪧 𥪧窮jφyh 𣍟䏕bQ荓菊 𦾱𧃒蚈蜎蜨蝫螆䵗WSN4I`GφeDG*˙ជjφWc^8\k[0[φZdZ @φ1uφ9φ庲cφ φφo φφE.Ҡ!φa丽丸φA咢哶4 𡚨𡛪ܑ 𡍪嬈嬾.寳𡬘 弳尢jφ^ud派海 𣽞𣾎災灷煅𤉣熜䎫φ3直𥃳{i磌䃣䄯穀 𥥼𥪧 𥪧窮φ" 𣍟䏕荓菊 𦾱𧃒,蚈蜎蜨蝫螆䵗װV^. abc defg hijk lmno0 pqrs tuvw xyzo 9"$φUcCR μφD? àáâãäåæç èéêëìíîï;ðñòóôõöøùúûüýþssφԀ@ āāăăąąćć ĉĉċċččďď; đēēĕĕėė ęęěěĝĝğğ{; ġġģģĥĥħ ĩĩīīĭĭįį7 i̇ijĵĵķķ ĺĺļļľľŀφr7 łńńņņňňʼnŋōōŏŏ;őőœŕŕŗŗ řřśśŝŝşş{; ššţţťťŧ ũũūūŭŭůů@ űűųųŵŵŷŷ ÿźźżżžžseφմZ/ ɓƃ ƅɔƈ ɖɗƌQǝə2ɛƒɠ ɣɩɨ ƙɯɲɵ]4ơơƣ ƥʀƨ ʃ ƭʈư3ưʊʋƴ ƶʒ ƹ ƽφDRQdžlj ljnj ǎǎǐF ǐǒǒǔǔǖ ǖǘ( ǘǚ ǚǜ ǜ ǟǟԇA& ǡǡ ǣǣ ǥǧǧ ǩǩǫǫ ǭǭ ǯǯ8ǰdzdzǵǵƕƿ$ǹǹ ǻǻ ǽǽ ǿǿ1DφԀ@ ȁȁȃȃȅȅȇȇ ȉȉȋȋȍȍȏȏ@ ȑȑȓȓȕȕȗȗ șșțț ȝȟȟy1 ƞȣ ȥȧȧ$ȩȩ ȫȫ ȭȭȯȯ'!C ȱȱȳȳQⱥȼ ƚⱦφ_[/ ɂ ƀ ʉ ʌ ɇ   ɉ  ɋ  ɍ  ɏ ы φCdBφ*CC^C̀́eC ̈́ι aC,  ͱ  ͳ ʹ ͷ aCQ ;ϳ1φ_!R ΅ ά· έή ί  ό ύώ<  ΐαβγδεζηθικλμνξοC5πρστυφχ+Cψω ϊϋφՔ<Qσa:C όύ ώ ϗ,FCβθ ϔφπ ϙϛ ϝϟX, ϡϣ ϥϧ ϩϫ ϭϯ+κρθεϸ ϲϻ ͻͼͽF='fφ~@" ѐёђѓєѕіїјљњћ ќѝ ўџ8абвгдежзийклмноп%B8рстуфхцчшщъыьэюяφdAX, ѡѣ ѥѧ ѩѫ ѭѯ3 ѱѳ ѵ ѷѷ ѹѻ ѽѿAφՎ6AAҁQҋ ҍҏ, ґғ ҕҗ ҙқ ҝҟX, ҡң ҥҧ ҩҫ ҭү, ұҳ ҵҷ ҹһ ҽҿφZ6 ӏӂ ӂӄ ӆӈ ӊӌi@ӎA$ ӑӑ ӓӓ ӕ ӗӗ ә ӛӛ ӝӝ ӟӟԂA ӡ ӣӣ ӥӥ ӧӧ ө ӫӫ ӭӭ ӯӯA$ ӱӱ ӳӳ ӵӵӷ ӹӹ ӻ  ӽ  ӿ &xφհX, ԁԃ ԅԇ ԉԋ ԍԏ,  ԑ  ԓ  ԕ  ԗ   ԙ  ԛ  ԝ  ԟ X,  ԡ  ԣ  ԥ  ԧ  ԩԫ ԭԯ5 աբգդեզէըթժիլխծկφ?p8հձղճմյնշոչպջռսվտ>րցւփքօֆ/?φ>>v>RQեւ>%{φKSFCCBφBdB φVvS RφeR φ ScR Ԁ@ ⴀⴁⴂⴃⴄⴅⴆⴇ ⴈⴉⴊⴋⴌⴍⴎⴏ@ ⴐⴑⴒⴓⴔⴕⴖⴗ ⴘⴙⴚⴛⴜⴝⴞⴟφBRP< ⴠⴡⴢⴣⴤⴥ ⴧR  ⴭRRφ bRSφ ScS φd"TφUTb/T ᏰᏱᏲᏳᏴᏵVVUUφ UcU+Z LYφe%Y YφE1вдосQтъѣ ꙋ@ აბგდევზთ იკლმნოპჟԀ@ რსტუფქღყ შჩცძწჭხჯ@ ჰჱჲჳჴჵჶჷჸჹჺ ჽჾჿHφԄ@ ḁḁḃḃḅḅḇḇ$ ḉḉḋḋḍḍḏḏH ḑḑḓḓ ḕḕ ḗḗ ḙḙḛḛ ḝḝḟḟԄ@ ḡḡḣḣḥḥḧḧ ḩḩḫḫḭḭ ḯḯ@ ḱḱḳḳḵḵḷḷ$ ḹḹḻḻḽḽḿḿφԈ@ ṁṁṃṃṅṅṇṇ ṉṉṋṋ ṍṍ ṏṏH( ṑṑ ṓṓṕṕṗṗ ṙṙṛṛ ṝṝṟṟԌH ṡṡṣṣ ṥṥ ṧṧ$ ṩṩṫṫṭṭṯṯ@ ṱṱṳṳṵṵṷṷ( ṹṹ ṻṻṽṽṿṿφԀ@ ẁẁẃẃẅẅẇẇ ẉẉẋẋẍẍẏẏ3 ẑẑẓẓYẕẕ ẘẙaʾṡQ  ss ԘH ạạảả ấấ ầầ( ẩẩ ẫẫ ậậ ắắP( ằằ ẳẳ ẵẵ ặặ ẹẹẻẻẽẽ ếếφ1ԐP( ềề ểể ễễ ệệ ỉỉịịọọỏỏP( ốố ồồ ổổ ỗỗ( ộộ ớớ ờờ ởởԘH( ỡỡ ợợụụủủ( ứứ ừừ ửử ữữD$ ựựỳỳỵỵỷỷỹỹ ỻ  ỽ  ỿ φlYX ἀἁ( ἀἁ ἂἃ ἄἅ ἆἇJY3Y ἐἑ( ἐἑ ἒἓ ἔἕltY]Y ἠἡ( ἠἡ ἢἣ ἤἥ ἦἧYY ἰἱ( ἰἱ ἲἳ ἴἵ ἶἷφլZYY ὀὁ( ὀὁ ὂὃ ὄὅZZ ὐὑ ὑὓὕὗZRZ;Z ὠὡ( ὠὡ ὢὣ ὤὥ ὦὧφd0 ἀιἁι ἂιἃι ἄιἅι ἆιἇι0 ἀιἁι ἂιἃι ἄιἅι ἆιἇιd0 ἠιἡι ἢιἣι ἤιἥι ἦιἧι0 ἠιἡι ἢιἣι ἤιἥι ἦιἧιd0 ὠιὡι ὢιὣι ὤιὥι ὦιὧι0 ὠιὡι ὢιὣι ὤιὥι ὦιὧιI& ᾰᾱ ὰιαι άι ᾶᾶι$ ᾰᾱ ὰάZ αιφս~D! ῁ ὴιηι ήι ῆῆι$ ὲέ ὴή[ ηι῍([[ ῐῑL[ ῐῑ ὶίQo[X[ ῠῡ$ ῠῡ ὺύ[ ῥ῭;Q ὼιωι ώι ῶῶι$ ὸό ὼώ[ ωι´ hφ#%^*_\[φ[[  FφU)RQωQkå%]Qⅎφ B]c-]@ ⅰⅱⅲⅳⅴⅵⅶⅷ ⅸⅹⅺⅻⅼⅽⅾⅿ4]φ]\\\Qↄ#a` `φe~`bφUTRQⓐⓑ ⓒⓓⓔⓕⓖⓗⓘⓙφW`@ ⓚⓛⓜⓝⓞⓟⓠⓡ ⓢⓣⓤⓥⓦⓧⓨⓩ 3b,b ec.φԀ@ ⰰⰱⰲⰳⰴⰵⰶⰷ ⰸⰹⰺⰻⰼⰽⰾⰿ@ ⱀⱁⱂⱃⱄⱅⱆⱇ ⱈⱉⱊⱋⱌⱍⱎⱏ|@ ⱐⱑⱒⱓⱔⱕⱖⱗ ⱘⱙⱚⱛⱜⱝⱞφdac2  ⱡ  ɫ ᵽ  ɽ  ⱨ  ⱪ ⱬ  ɑ ɱ ɐ'  ɒ  ⱳ  ⱶ R Q  ȿ ɀφ`0 ⲁⲃ ⲅⲇ ⲉⲋ ⲍⲏ0 ⲑⲓ ⲕⲗ ⲙⲛ ⲝⲟ`0 ⲡⲣ ⲥⲧ ⲩⲫ ⲭⲯ0 ⲱⲳ ⲵⲷ ⲹⲻ ⲽⲿφ`0 ⳁⳃ ⳅⳇ ⳉⳋ ⳍⳏ0 ⳑⳓ ⳕⳗ ⳙⳛ ⳝⳟ; ⳡⳣQ ⳬ;_ ⳮ@_Q  ⳳ  gφelφ gg& φeg φ`0  ꙁ  ꙃ  ꙅ  ꙇ   ꙉ  ꙋ  ꙍ  ꙏ 0  ꙑ  ꙓ  ꙕ  ꙗ   ꙙ  ꙛ  ꙝ  ꙟ ]g0  ꙡ  ꙣ  ꙥ  ꙧ   ꙩ  ꙫ g ꙭ 5gφ`0  ꚁ  ꚃ  ꚅ  ꚇ   ꚉ  ꚋ  ꚍ  ꚏ 0  ꚑ  ꚓ  ꚕ  ꚗ f ꚙꚛ йφdfX(Q  ꜣ  ꜥ  ꜧ   ꜩ  ꜫ  ꜭ  ꜯ (Q  ꜳ  ꜵ  ꜷ   ꜹ  ꜻ  ꜽ  ꜿ φ`0  ꝁ  ꝃ  ꝅ  ꝇ   ꝉ  ꝋ  ꝍ  ꝏ 0  ꝑ  ꝓ  ꝕ  ꝗ   ꝙ  ꝛ  ꝝ  ꝟ `0  ꝡ  ꝣ  ꝥ  ꝧ   ꝩ  ꝫ  ꝭ  ꝯ S   ꝺ ꝼ  ᵹ ꝿ qφզN0  ꞁ  ꞃ  ꞅ  ꞇ Q  ꞌd ɥ(  ꞑ  ꞓ Qꞗ ꞙꞛ ꞝꞟc0  ꞡ  ꞣ  ꞥ  ꞧ   ꞩ  ɦɜɡɬɪ5ʞʇʝꭓ ꞵꞷ ꞹꞻ ꞽꞿφc/+Qꟃꞔʂᶎf[d dcφc bcZe'eφe e ѫφfeee φU b'f@ ᎠᎡᎢᎣᎤᎥᎦᎧ ᎨᎩᎪᎫᎬᎭᎮᎯeφԀ@ ᎰᎱᎲᎳᎴᎵᎶᎷ ᎸᎹᎺᎻᎼᎽᎾᎿ@ ᏀᏁᏂᏃᏄᏅᏆᏇ ᏈᏉᏊᏋᏌᏍᏎᏏԀ@ ᏐᏑᏒᏓᏔᏕᏖᏗ ᏘᏙᏚᏛᏜᏝᏞᏟ@ ᏠᏡᏢᏣᏤᏥᏦᏧ ᏨᏩᏪᏫᏬᏭᏮᏯ cφφφԮ Td'p&nφ?mllxlgl切度ttsφ"s;7fffiflffifflststrQմն մեմի վնմխ @t0utφtdtucuφ |< ａｂｃｄｅｆｇ ｈｉｊｋｌｍｎｏ@ ｐｑｒｓｔｕｖｗｘｙｚ⇳`ݮφ偛b φvuuuφWucBu+xwwwφ!ԐH$ 𐐨𐐩 𐐪𐐫 𐐬𐐭 𐐮𐐯$ 𐐰𐐱 𐐲𐐳 𐐴𐐵 𐐶𐐷H$ 𐐸𐐹 𐐺𐐻 𐐼𐐽 𐐾𐐿$ 𐑀𐑁 𐑂𐑃 𐑄𐑅 𐑆𐑇LH$ 𐑈𐑉 𐑊𐑋 𐑌𐑍 𐑎𐑏Рφd0vc=vH$ 𐓘𐓙 𐓚𐓛 𐓜𐓝 𐓞𐓟$ 𐓠𐓡 𐓢𐓣 𐓤𐓥 𐓦𐓧φuԐH$ 𐓨𐓩 𐓪𐓫 𐓬𐓭 𐓮𐓯$ 𐓰𐓱 𐓲𐓳 𐓴𐓵 𐓶𐓷($ 𐓸𐓹 𐓺𐓻vjv vuφu ubuxx Lx xφ!ԐH$ 𐳀𐳁 𐳂𐳃 𐳄𐳅 𐳆𐳇$ 𐳈𐳉 𐳊𐳋 𐳌𐳍 𐳎𐳏H$ 𐳐𐳑 𐳒𐳓 𐳔𐳕 𐳖𐳗$ 𐳘𐳙 𐳚𐳛 𐳜𐳝 𐳞𐳟ԐH$ 𐳠𐳡 𐳢𐳣 𐳤𐳥 𐳦𐳧$ 𐳨𐳩 𐳪𐳫 𐳬𐳭 𐳮𐳯# 𐳰𐳱 𐳲φ{yxww ~D~} }φe}}φUԐH$ 𑣀𑣁 𑣂𑣃 𑣄𑣅 𑣆𑣇$ 𑣈𑣉 𑣊𑣋 𑣌𑣍 𑣎𑣏H$ 𑣐𑣑 𑣒𑣓 𑣔𑣕 𑣖𑣗$ 𑣘𑣙 𑣚𑣛 𑣜𑣝 𑣞𑣟φ Ҁۂφ  ;φ!ԐH$ 𖹠𖹡 𖹢𖹣 𖹤𖹥 𖹦𖹧$ 𖹨𖹩 𖹪𖹫 𖹬𖹭 𖹮𖹯H$ 𖹰𖹱 𖹲𖹳 𖹴𖹵 𖹶𖹷$ 𖹸𖹹 𖹺𖹻 𖹼𖹽 𖹾𖹿%φ݁䚁 Qφφ"Ј㓈81*φ⇓bч6/ Ḉφ!ԐH$ 𞤢𞤣 𞤤𞤥 𞤦𞤧 𞤨𞤩$ 𞤪𞤫 𞤬𞤭 𞤮𞤯 𞤰𞤱H$ 𞤲𞤳 𞤴𞤵 𞤶𞤷 𞤸𞤹$ 𞤺𞤻 𞤼𞤽 𞤾𞤿 𞥀𞥁 𞥂𞥃WA zφUSR φ|< ÀÁÂÃÄÅÇ ÈÉÊËÌÍÎÏ8 ÑÒÓÔÕÖ ÙÚÛÜÝ|< àáâãäåç èéêëìíîï8 ñòóôõö ùúûüýÿφԀ@ ĀāĂ㥹Ćć ĈĉĊċČčĎď4QĒēĔĕĖė ĘęĚěĜĝĞğt4 ĠġĢģĤĥ ĨĩĪīĬĭĮį0 İĴĵĶķ ĹĺĻļĽľφ`0QŃńŅņŇ ňŌōŎŏ4ŐőŔŕŖŗ ŘřŚśŜŝŞşt4 ŠšŢţŤť ŨũŪūŬŭŮů@ ŰűŲųŴŵŶŷ ŸŹźŻżŽžJφU,ƠơRQƯ ưφմ$SR ǍǎǏF ǐǑǒǓǔǕ ǖǗ( ǘǙ ǚǛ ǜ ǞǟԀ:& Ǡǡ ǢǣQǦǧ ǨǩǪǫ Ǭǭ Ǯǯ$ ǰǴǵ$Ǹǹ Ǻǻ Ǽǽ ǾǿφԀ@ ȀȁȂȃȄȅȆȇ ȈȉȊȋȌȍȎȏ@ ȐȑȒȓȔȕȖȗ ȘșȚțQȞȟh QȦȧ$Ȩȩ Ȫȫ ȬȭȮȯ0$ ȰȱȲȳQφ  "φUS φTSRQSQ5rφ$TRܒ Q,Qʒ  ܑφG.̀́̓  ̈́ QQ QR ʹ Q Q ;φz_!R ΅ Ά· ΈΉ Ί  Ό ΎΏ ΐJ QQ ΪΫ άέ ήί ΰφ{9SQ ϊϋ όύ ώ &Qϓ  ϔ Q RQGЋφlS0 ЀЁЃQЇR ЌЍ ЎS ЙTS йφWT0 ѐёѓQїR ќѝ ўTRQ Ѷѷ.φ($ QQ φվJ* Ӂ ӂ :$ Ӑӑ ӒӓQ ӖӗQ Ӛӛ Ӝӝ Ӟӟt:Q Ӣӣ Ӥӥ ӦӧQ Ӫӫ Ӭӭ Ӯӯ:$ Ӱӱ Ӳӳ Ӵӵ Ӹӹ t6φT  R   φ$TRQ  кφL$S  Q Q, Q Q      φ($ S QQR+ШφU(R  Q   R     =9  آأ ؤإ ئS Q φ\ S Q  !"  SR #"φUTSQφ[.  ۀ ۂRQQۓR8 QSQvφ(SRQ $SR  Qφ<8 QSR φUT φU S Q   Q  Q  WE?>,!φaєZφ T R  Q  $R    S R Q  φ T S  Q S QJφU    R   QRφT Q0 QQ        Q    Q  :wφ   Sऩ&ऱ ऴ φՌSR   , क़ख़ ग़ज़ ड़ढ़ फ़य़T      ІφD, RS φ{BRো ৌ RQR ড়ঢ়য় RS Q QHOФφL4 QQS .ਲ਼ ਸ਼φՀ4 QQ   %ਖ਼ ਗ਼ਜ਼ ਫ਼ RR Ђφ@, R QS  φ<(RQ Q      $ІφD, RS  φsER  ୈୋ ୌ RR ଡ଼ଢ଼   бφc( Q  ஔ, Q QRQφaE Q ொோ ௌ   QRQ Q Qvφ<( R S R φS/R ై RT[ Q  RQ vφ<( R S RφՂ^* ೀೇ( ೈ ೊೋ RRQ   nφ<( R S  S Q   φeER  ൊോ ൌ  RQRQ  R    Zφ4RQT QRφw(RQ Q QRQ ේ ොෝ ෞ R1X:φ TS Qg Qφ SkSОφT<  0 S Qv φ4 RRzS +>φTSTRܒ φs6Qགྷ ཌྷ&Q དྷQབྷR ཛྷ'Sཀྵ  5ཱཱིུ ྲྀ ླྀφe'ཱྀ  QྒྷQ ྜྷ=&Q ྡྷQྦྷR ྫྷ ྐྵφL$RQR     φy{eφU3 Q Q ဦ   Q Q   φTS .φ(S R  S   φ$ RQ R TRQ >φTS Q   φU Q φUTS !lφRQφH$RQ RQ bφ($RQ SRQ RQφ8$ RQRQSRQќ>φ8SRQ RQφ4RQS Q   SRφTSφUTRR0*$φ  l$φUTRQ φTSRφUT  рFφ(SRR TR φTSR φUT Rφ$T Q RSSXҏS5φ/S QQSφUTS "φUS φU T R  рBφTSR SSφ SRRφUS φ(SS Q р.φ(TRQ  φT S R Q    R  R   ^φ S  S  S R  R QЪφnSR Q  ᬆ  ᬈ  ᬊ  ᬌ  ᬎ Q  ᬒ T R   Q  ᬻ ᬽ φ=91% ᭀ ᭁ ᭃ  S Q    R  .φU S Q   S  φU R Q      L*φU T R Q   Q φS   :φS TS Qφ,  Q    ܒ (        Q     QφU Sφ@, Q Q    ܓ  R Q  RQ  HφԄ@ ḀḁḂḃḄḅḆḇ$ ḈḉḊḋḌḍḎḏH ḐḑḒḓ Ḕḕ Ḗḗ ḘḙḚḛ ḜḝḞḟԄ@ ḠḡḢḣḤḥḦḧ ḨḩḪḫḬḭ Ḯḯ@ ḰḱḲḳḴḵḶḷ$ ḸḹḺḻḼḽḾḿφԈ@ ṀṁṂṃṄṅṆṇ ṈṉṊṋ Ṍṍ ṎṏH( Ṑṑ ṒṓṔṕṖṗ ṘṙṚṛ ṜṝṞṟԌH ṠṡṢṣ Ṥṥ Ṧṧ$ ṨṩṪṫṬṭṮṯ@ ṰṱṲṳṴṵṶṷ( Ṹṹ ṺṻṼṽṾṿφԀ@ ẀẁẂẃẄẅẆẇ ẈẉẊẋẌẍẎẏ@ ẐẑẒẓẔẕẖẗẘẙẛ ԘH ẠạẢả Ấấ Ầầ( Ẩẩ Ẫẫ Ậậ ẮắP( Ằằ Ẳẳ Ẵẵ Ặặ ẸẹẺẻẼẽ Ếếφ1ԐP( Ềề Ểể Ễễ Ệệ ỈỉỊịỌọỎỏP( Ốố Ồồ Ổổ Ỗỗ( Ộộ Ớớ Ờờ ỞởԘH( Ỡỡ ỢợỤụỦủ( Ứứ Ừừ Ửử ỮữD$ ỰựỲỳỴỵỶỷỸỹ φ-ԨT( ἀἁ ἂἃ ἄἅ ἆἇ( ἈἉ ἊἋ ἌἍ ἎἏB( ἐἑ ἒἓ ἔἕ( ἘἙ ἚἛ ἜἝԨT( ἠἡ ἢἣ ἤἥ ἦἧ( ἨἩ ἪἫ ἬἭ ἮἯT( ἰἱ ἲἳ ἴἵ ἶἷ( ἸἹ ἺἻ ἼἽ ἾἿφԄB( ὀὁ ὂὃ ὄὅ( ὈὉ ὊὋ ὌὍT( ὐὑ ὒὓ ὔὕ ὖὗ ὙὛὝὟԨT( ὠὡ ὢὣ ὤὥ ὦὧ( ὨὩ ὪὫ ὬὭ ὮὯH$ ὰά ὲέ ὴή ὶί$ ὸό ὺύ ὼώφd0 ᾀᾁ ᾂᾃ ᾄᾅ ᾆᾇ0 ᾈᾉ ᾊᾋ ᾌᾍ ᾎᾏd0 ᾐᾑ ᾒᾓ ᾔᾕ ᾖᾗ0 ᾘᾙ ᾚᾛ ᾜᾝ ᾞᾟd0 ᾠᾡ ᾢᾣ ᾤᾥ ᾦᾧ0 ᾨᾩ ᾪᾫ ᾬᾭ ᾮᾯI& ᾰᾱ ᾲᾳ ᾴ ᾶᾷ$ ᾸᾹ ᾺΆ  ᾼιφԏD! ῁ ῂῃ ῄ ῆῇ$ ῈΈ ῊΉ ῌ῍ ῎῏@( ῐῑ ῒΐQ ῖῗ$ ῘῙ ῚΊ῝ ῞῟ԓN( ῠῡ ῢΰ ῤῥ ῦῧ$ ῨῩ ῪΎ Ῥ῭ ΅`;Q ῲῳ ῴ ῶῷ$ ῸΌ ῺΏ ῼ´~ φOφ.*   QS QφHRQR QRQ#R    ~φ4SRQR R  S Q  Qφ(T  Q0  ܓ  сOφU)RQΩQKÅSφ,SR   Q  hφH( Q  SQ ↚↛SRQ ↮φ.*SR⇍ ⇎⇏S Q8?hφ>:R ∄∉ ∌$ R ∤ ∦φHD.≁ ≄≇≉@ ≠ ≢R≭≮≯0 ≰≱ ≴≵ ≸≹ІφPL0 ⊀⊁ ⊄⊅ ⊈⊉0SR ⊬⊭ ⊮⊯φU\,( ⋠⋡ ⋢⋣Q ⋪⋫ ⋬⋭ d>φ  S 〈〉φUTS QφTS Qφ,SRQ  S    QQӦt@"φURφS QφUS QSRQφT RφUTH&φ T R φUT R^φ,S R   Q R  φ R Q   Q  ѨBφ($   S  φ@SR   Q Q  RQ    R>φTR T  RQ φ,(RQ Q    S 9 0φTSR ⫝̸р:φ(SR Q   φ0S R  R   T R2φT RTSφ(S  Q SSRQҬhφUSRQφTSRQS R    R  φUS Q Q   l*φU RQ R φU R RQ  RQ ZφTRQ RQRQRQRQφ@ RQRQRQRQ Ҝh2φTSR  T    φ0, QQφTS QφUTφT RTSφ>φUS QS QQφժ2 R が ぎ< ぐ げ ご ざ じ ず ぜ ぞS< だ ぢづでどJ% ばぱび ぴ ぶぷべ ぺ ぼぽφBTR ゔQ ゞ2 R ガ ギ< グ ゲ ゴ ザ ジ ズ ゼ ゾφS< ダ ヂヅデドJ% バパビ ピ ブプベ ペ ボポT"R ヴヷ% ヸヹ ヺQ ヾeFφRSR  φUR 2φSRQTS Q  φ  Ҥ\"φTSRφ   TSRQφUT φ STSRQ0φUTRQ QφTSRTSRQH@φ,φUT Rφφqьφφ"φU RS φ( R   RS Qφtn>φSR Rφ$    ҄LφU S  φU   R Q   R  φT S RQ φU T  @:φ$TRQ Q     ^φ(S R     S Q  Q φQTRQ Q  eҘH6φRQ  SS  φU T   φ,R  R S  T  R `"φU S Q   φ$T  Q  RQ T S R  φU T  Q   φ4   R Q  S   TSRQPφU T R Q  φ S R  S  T S  :φU T       φ,  S Q T R Q  ьrφL0  Q   Q    Q  R Q  R Q  φU RφU S R  S  φv φφφU  φ$ R Q  Q T S  φφφԀ@ 豈更車賈滑串句龜 龜契金喇奈懶癩羅@ 蘿螺裸邏樂洛烙珞 落酪駱亂卵欄爛蘭Ԁ@ 鸞嵐濫藍襤拉臘蠟 廊朗浪狼郎來冷勞@ 擄櫓爐盧老蘆虜路 露魯鷺碌祿綠菉錄φԀ@ 鹿論壟弄籠聾牢磊 賂雷壘屢樓淚漏累@ 縷陋勒肋凜凌稜綾 菱陵讀拏樂諾丹寧Ԁ@ 怒率異北磻便復不 泌數索參塞省葉說@ 殺辰沈拾若掠略亮 兩凉梁糧良諒量勵φԀ@ 呂女廬旅濾礪閭驪 麗黎力曆歷轢年憐@ 戀撚漣煉璉秊練聯 輦蓮連鍊列劣咽烈Ԁ@ 裂說廉念捻殮簾獵 令囹寧嶺怜玲瑩羚@ 聆鈴零靈領例禮醴 隸惡了僚寮尿料樂φԀ@ 燎療蓼遼龍暈阮劉 杻柳流溜琉留硫紐@ 類六戮陸倫崙淪輪 律慄栗率隆利吏履Ԁ@ 易李梨泥理痢罹裏 裡里離匿溺吝燐璘@ 藺隣鱗麟林淋臨立 笠粒狀炙識什茶刺φt@ 切度拓糖宅洞暴輻 行降見廓兀嗀4 塚晴 凞猪益 礼神祥福靖精羽d0 蘒諸 逸都Q飯飼館鶴 郞 隷@ 侮僧免勉勤卑喝嘆 器塀墨層屮悔慨憎φԀ@ 懲敏既暑梅海渚漢 煮爫琢碑社祉祈祐@ 祖祝禍禎穀突節練 縉繁署者臭艹艹著u@ 褐視謁謹賓贈辶逸 難響頻 恵 𤋮 舘@ 並况全侀充冀勇勺 喝啕喙嗢塚墳奄奔φԀ@ 婢嬨廒廙彩徭惘慎 愈憎慠懲戴揄搜摒@ 敖晴朗望杖歹殺流 滛滋漢瀞煮瞧爵犯Ԁ@ 猪瑱甆画瘝瘟益盛 直睊着磌窱節类絛@ 練缾者荒華蝹襁覆 視調諸請謁諾諭謹φԁ@ 變贈輸遲醙鉶陼難 靖韛響頋頻鬒龜𢡊E" 𢡄𣏕㮝䀘䀹𥉉 𥳐𧻓齃龎φBRQ QR יִײַBSQ שׁשׂ שּׁשּׂ אַאָC$ אּבּ גּדּ הּוּ זּ$ טּיּ ךּכּ  לּ מּφ> נּסּףּ  פּ צּקּ$ רּשּ תּוֹ בֿכֿ פֿφUT  φ$   QZφφT φ TSRѥ7φTSRQ  Rφ8$R  QRQ QφUTSRPφ φTSRQ /φU SRQφ8   RQRQS F>;9φ@&`φSL=ҔpJφSRRQS QQφ SRSRφUTS Q@:φ  QQTRQFφ, S QS   φ T S R  ^φT S R  φT    Sp6φTSRQRφS QT R QφTSRQφ  RӺҀ4φU RφSR*φTSRSφTTS4φUφURQ@φUTRQφT REpRφ  R TRQ φT R Q  2φTSRQRQφUT Q Q@:φT S  Q T S  Q φU T S R φT ѤvφH(RRR T RQ φ(S S  φφU$R QRQT&φU T R   φT R  T  Q  Bφ(T  S Ӗh$ φS  φUT QφUT Q("φU S*$φUT S R Q  XφUφ@$ R Qܑ φUTRQφL φ,R Q  R   T SRQ iφ2T S Q  𑂚  𑂜 S Q  𑂫 S    φ   R S  S  і\φ Q  &S R Q  𑄮 𑄯 Q   φR QT QQ φ@,   S Q  RHBφT QTR RQRφ<(RQ QSRQSφUS S'ЊφD, RS   QφjBR𑍋 𑍌  QR RRR0ҷHφ< Q QS QEφUTSQ𑒻 𑒼 𑒾φ$ Q S@φUT RQ 𑖺𑖻Q φ, SRҠ\φUTSRQ φ$RSSR*φU T R Q   φS  @:φ TS QS Q YӲ\("φUTS  φφUT QRQφUSφTS  Ҡ<φUTR φRQ Fφ, RS   QφUTS Ұl>φS TRQRQ φ RSR>φT S RQѠRφ$ RQ QTRQ QQφ( Q S RQ Rφ<SRQ QQ S*φUTS φUT RQφT  $ φU S R Q  φTS hF@ φU  Q  RQR φ φL @:4.φU S R Q  S LDφ<*$φRQφφ  ҄PφU T S  φTSRQSφSRRlφUTRQφ$ RS Q QSRφ0 φTS QL φ,(R   QQ T S R Q  φSRQ φU φюІφHφUSR 6*φUT QφφφբԜt& φ  HφTSRQφT Q "φUTSy4φUS QSR?φ,S SQ φφ3&φUT R*φU RQ  φ*TSRQ 𝅗𝅥𝅘𝅥uaD"𝅘𝅥𝅮𝅘𝅥𝅯𝅘𝅥𝅰𝅘𝅥𝅱𝅘𝅥𝅲 QQЗφ($ QSSQ𝆹𝅥 𝆺𝅥𝆹𝅥𝅮𝆺𝅥𝅮𝆹𝅥𝅯φ1!𝆺𝅥𝅯SRS D(φφUT@φTRQT   _Ҵ$φTRjφTSR4 Q S Qφ  ѤjφH(RQ QRRTS QQφ4 R &φU RφS RF:φ SS Q φf`Zφ,RQS( Q QT6φUSRRQRφS6φU SSQԂ|>φ,RRQ8φ, QSӂH$φUT φUTR4.φ TSRAnφR  0       Q    φt4 Q Q            0     Q   Q     Vφ S Q  S  (   Q  S  φUT  φ(ҠφU S   FφT  S R Q    R Q  φ(    T RZφ S Q   S R Q    R   φL, Q  Q   Q  R Q  R Q  S  S     Nφ4S     Q  SRφU R ~x>φ  T  Q  φ$S    RX:φU   RR Q  φU T S R  φT   φ4(R   Q  QT   l<φU T S R Q  φ    φU T S   TφU T S R  φ  Q  S QφURφUTS Q Ѩ~φL        Q   R  R  R  φ$    φ0 R  SRRQ φU T  φ$TR  S@\4φ SφS"φ SR^φ0SRS QRQφ(SRSRQ SQ Qbφ$R , Q QSφ0, QRQp@φTSR Q*φ$ Q RφUTSRφφDφ<*φTRQ  φ<   $φU T R    2,& φT S R  H@φ&φU φDφ6φU φhQφԂA!丽丸乁𠄢你侮侻倂 偺備僧像㒞𠘺免兔B!兤具 𠔜㒹內再 𠕋冗 冤仌冬况 𩇟凵刃㓟Ԁ@ 刻剆割剷㔕勇勉勤 勺包匆北卉卑博即9卽卿卿 𠨬灰及叟! 𠭣叫叱吆咞吸呈周φԀ@ 咢哶唐啓啣善善喙 喫喳嗂圖嘆圗噑噴@ 切壮城埴堍型堲報!墬𡓤売壷夆多夢奢{B" 𡚨𡛪姬娛娧姘婦㛮㛼嬈嬾 𡧈寃寘寧A!寳𡬘寿将当尢㞁屠!屮峀岍𡷤嵃𡷦嵮嵫φԂ@ 嵼巡巢㠯巽帨帽幩!㡢𢆃㡼庰庳庶廊𪎒;"廾𢌱 𢌱舁Q弢㣇𣊸! 𦇚形彫㣣徚忍志忹ԁA 悁㤺㤜悔 𢛔惇慈慌 慎慌慺憎憲憤憯懞@ 懲懶成戛扝抱拔捐! 𢬌挽拼捨掃揤 𢯱搢φԁ@ 揅掩㨮摩摾撝摷㩬!敏敬 𣀊旣書晉㬙暑@ 㬈㫤冒冕最暜肭䏙 朗望朡杞杓𣏃㭉柺ԂA!枅桒梅𣑭梎栟椔㮝 楂榣槪檨 𣚣櫛㰘次B! 𣢧歔㱎歲殟殺殻𣪍# 𡴋𣫺汎𣲼沿泍汧洖 φԂA 派海流浩浸涅 𣴞洴 港湮㴳滋滇𣻑淹潮B" 𣽞𣾎濆瀹瀞瀛㶖灊!災灷炭𠔥煅𤉣熜𤎫{C!爨爵牐𤘈犀犕 𤜵𤠔 獺王㺬玥Q㺸瑇瑜B 瑱璅瓊㼛甤𤰶甾𤲒"異𢆟瘐𤾡 𤾸𥁄㿼䀈φ}<#直𥃳 𥃲𥄙 𥄳眞真 睊䀹瞋䁆䂖𥐝硎碌C!磌䃣 𥘦祖 𥚚𥛅福秫 䄯穀穊穏 𥥼𥪧 𥪧竮ԃB!䈂𥮫篆築䈧𥲀糒䊠!糨糣紀𥾆絣䌁緇縂D"繅䌴 𦈨𦉇䍙𦋙罺𦌾!羕翺者𦓚 𦔣聠 𦖨聰φԅB! 𣍟䏕育脃䐋脾媵𦞧# 𦞵𣎓 𣎜舁舄辞䑫芑A 芋芝劳花芳芽苦𦬼 若茝荣莭茣莽菧著ԅC 荓菊菌菜 𦰶𦵫 𦳕䔫!蓱蓳蔖𧏊蕤𦼬䕝䕡B" 𦾱𧃒䕫虐虜虧虩蚩 蚈蜎蛢蝹蜨蝫螆䗗φԃA 蟡蠁䗹衠衣𧙧裗裞!䘵裺㒻𧢮 𧥦䚾䛇誠A!諭變豕𧲨貫賁贛起" 𧼯𠠄跋趼跰𠣞軔輸ԄC" 𨗒𨗭邔郱鄑𨜮鄛鈸 鋗鋘鉼鏹鐕𨯺開䦕C!閷𨵷䧦雃嶲霣 𩅅𩈚!䩮䩶韠𩐊䪲𩒖頋 φԂA!頩𩖶飢䬳餩馧駂駾!䯎𩬰鬒鱀鳽䳎䳭鵧D# 𪃎䳸 𪄅𪈎 𪊑麻䵖黹 黾鼅鼏鼖鼻𪘀φUTSRφφφφφφUTSRφ`φφφφφφUTSRφφφφφφUTSR`φφφφφφUTSRφφφφφφUTSRφ`φφφφφφUTSRφφφφφφUTSR`φφφφφφUTSRφφφφφφUTSRφ`φφφφφφUTSRφφφφφφUTSRӁyqiφ`YR3,%φ φUφφφφφφφφUTSRφφφ              t -PPpU`U5:=2PU@U0UF UU UT#T&TT;T8TTTqBpT`TPT ?@T0T TTTR!;SS 9S@SSSS3S9qCpS`SPS@S0S SSE=S:RRRRRP07070101AE228E0000A1FF0000000000000000000000016A426C2800000010000000FE0000000000000000000000000000001700000000usr/lib/libext2fs.so.2libext2fs.so.2.407070101AE22F4000081A40000000000000000000000016A426C2800012297000000FE0000000000000000000000000000001D00000000usr/lib/libjansson.so.4.14.0ELF4t4 (p888pPPP//( hhh00QtdRtd//((  l z  //p 004 xppp p_pp#poooooo2Wx |E?R\bJGg{*1veTf wjt.<No~nVyqH&FusO,hKQm^}ScB3'5A"k2rpX_  #$/4-0C>P=;M[ZDl9(]Uid7z@%YI `a+!6:8)L  Y1 1y$ ,ىd R  8y= W5z  wA{ >Q( w] }5  ) x4 y\ + q } 5 1- !Q gAz ( ) )  AJ %= e :0 M0 U.y u U   Y - y0 Ywa 1\F U/0 q5 E A e  5 q )   I 0  /I hy5 = yA i q( 'i  U d0 5% a ]|, X mB eɚU K  #Uy-  źY .A We 3 Xm /a  9xe s a 9  - E ? u +0&  <% #?I a d5 X ] m( M0 . SUu YY Y  | -0a , k͕ D A vU | . ͐) 1A !  qR (  %I a 6- Ky9 I{ ɧy 5 R q( |M 9n !%] h 0 Km Gy1 0 e6a ]Y= 0 ] =  m6 p`PC@0 ?T|C-%gQp`KP@0B [jbV`'tUp"2`P@20 "D9 ."0~HMp_fini__cxa_finalize__deregister_frame_info__register_frame_infomemcpy__muldf3fwritememcmpread__sync_add_and_fetch_4memmovejsonp_error_set_sourcestrlenstrncpyjsonp_error_initjsonp_error_vsetvsnprintfjsonp_error_sethashtable_gethashtable_seedhashtable_iter_athashtable_iter_nexthashtable_iterhashtable_iter_keyhashtable_iter_key_lenhashtable_iter_valuejson_object_seed__sync_val_compare_and_swap_1__gettimeofday_time64getpid__sync_synchronizesched_yieldjsonp_mallochashtable_initjsonp_freegethex__errno_locationstrtod__unused__flt_rounds__floatundidf__divdf3__ashldi3__lshrdi3__udivdi3__eqdf2__adddf3__subdf3__ledf2__ltdf2__fixdfsi__floatsidf__gtdf2__fixunsdfsi__floatunsidffreedtoadtoa_rdtoa_divmaxjsonp_strndupjsonp_strdupjson_set_alloc_funcsjson_get_alloc_funcsstrbuffer_initstrbuffer_closestrbuffer_clearstrbuffer_valuestrbuffer_steal_valuestrbuffer_append_bytesstrbuffer_append_bytestrbuffer_popjsonp_strtodstrchrjsonp_dtostrmemsetutf8_encodeutf8_check_firstutf8_check_fullstrtollstrcmputf8_iterateutf8_check_stringjson_objectjson_object_sizejson_object_getnjson_object_getjson_object_iterjson_object_iter_atjson_object_iter_nextjson_object_iter_keyjson_object_iter_key_lenjson_object_iter_valuejson_object_key_to_iterjson_arrayjson_array_sizejson_array_getjson_array_extendjson_string_nocheckjson_stringn_nocheckjsonp_stringn_nocheck_ownjson_stringnjson_stringjson_string_valuejson_string_lengthjson_string_setn_nocheckjson_string_set_nocheckjson_string_setnjson_string_setjson_vsprintfjson_sprintfjson_integerjson_integer_valuejson_integer_setjson_realjson_real_valuejson_real_setjson_number_value__floatdidfjson_truejson_falsejson_nulljson_deletehashtable_close__sync_sub_and_fetch_4json_array_set_newjson_array_append_newjson_array_insert_newjson_array_removejson_array_clearhashtable_clearjson_object_clearhashtable_setjson_vunpack_exjson_unpack_exjson_unpackjsonp_loop_checkjson_object_setn_new_nocheckmemchrjson_loadsjson_loadbjson_loadfstdinfgetcjson_load_filefopenstrerrorfclosejson_loadfdjson_load_callbackjson_object_updatejson_object_update_existingjson_object_update_missingjson_object_set_new_nocheckjson_vpack_exjson_pack_exjson_packjson_object_setn_newjson_object_set_newhashtable_delqsortjson_dump_callbackjson_dumpsjson_dumpbjson_dumpfjson_dump_filejson_dumpfdjson_object_delnjson_object_deldo_object_update_recursivejson_object_update_recursivehashtable_iter_setjson_object_iter_set_newjson_equaljson_copydo_deep_copyjson_deep_copyjansson_version_strjansson_version_cmplibgcc_s.so.1libc.solibjansson.so.4JANSSON_4GCC_4.2.0GLIBC_2.0GCC_3.0GCC_4.4.0d  D l ``'  ii  P&y  `^'  //////////(02$0 0' 'e KLe eg gg ܜg ge go>egc``0#\gg0@DJ@:eR aj :eo@`gocXgxgKk:eLM`2I`# J yd`+HJCa`+HJCajej @2idejg)"X\gmL?e@e*\gX)jjKvd!Ya jL@8e*G& jL,\gmL@?eekIdgn#k#gg ] `M ]`3 m`ueqkc[WQIA=7/'Mた O\IP6B0OnI64n34AmN32@2b3Mb2`0V2 {B6P0 Si ]`M ]``0 '#gbg桟@5B45N5@45@`5~4nB4@554N45nb4`3x3kNB3@2mK!d蘵 1Mm䁯 O44qxIz`3`3M\^@2@2P6B0S46In34AmN32@2b3Mb2`0V2 {B6P0 Si ]`M ] `4 倌eokc7_[S+OKCgbgů66悯QC@2@2 qa`3`3F44愯44₯44〯0.`M O6yv`3`3ק6yxy`344q{`3Q]@244Q_@2P0B4[ 60In63Q Nb6`2@26Ms4 40 N20y n_k`3ij`3`3ii`3ihig`3qf`3`3qe`3qdqc`3yb`3`3ya`3y`gDgFgeﾭgD@Kj aaCa@ `A`DLj`P2gEO _`KNIaEO_`KM]`Kj Kea@i@"Ka j KbAC`@iK@b j Kd`Dgc `diK@dddjDH̜m@:e@JZajKjp @2iedaP`h0DgAn KH2eI5& om8egKCHagAKca+JJ2H2gQ- gd\g0M@=ewdLD2JKjKCHaejN @2id"gA XxyA@:enoӡnolexy>*"e0@IJAgxlgeg\ggPLg@:e88e9xԜg9:;ӡ yա :;@8ee "\g0vdH@8ew8e@#ggegwdgdovt3S`3a-|g?<=>?@8ege|g"g@DA01@A@:eRe ` *xy+l*\gBTC  BC@:eRe a\gDXEDE@:eҞe@Ny ,&Lx*``(+ Mi&yl|gKemJLXgJKLM@:eyegxgg@8eNN x&OOleyz`,N+*K#yjKx\g0H@8e@8e@8e@8esFsNaM* B?a"e0@H JAgj҂\gFXGFG@:e"g eg*N\g0L@:ee*\gHѰTIЀHI@:ege"gT`jiMj`` iDiy ja*y((&lN+\gdѰXede@:ege|g@=ege|ggfgPLfg@:e"g(`LDgxeg |ge"hiXghi@:eRea|gjPkРjk@:eReu" cpa\gdeQPӀ xgPQ@;eRe`\g@RSRS@:ege*l\g0D@:e"g eg*n(mkg TVUWTUVW@8e*e@?L@8e|dj@j>@?L\g23H ## @:ee*<j>@|g0@@?J L@:e 3@2l3m4"04l0P Mj"Ҽg(xG@,JKD2i@@X=JP2Icb a +`ca.+A C`J J : Z`RaJ::rk`r`r `rjҠ`jJ lj;_D132m ) h"g j 0C ` 1B2B2 1M H@2@2 0# a 1B2M H@2 0# a 01B2M HP2 0У# a (1B2M HH2 0Q a $1B2M HD2 0j "j^j;RUa ҂g?U*\g0@J@:e?Ҟe:RaN" #lmG*# L[XgrXg R=`:(jFkl7"j i;O ? j "e0@ JAgjj ;iJR ҂g`lkjK: lLj lH@Ca>"jj j  R`R`a @ 2b3n3M"2N2g xOZKH2i@ R|aJ\lm@:eBCKXgi,, "3n3me+ *gk@ g@:e ҞegxL2]Ki`! x x i g7"@ g@:e ўe #g i *\g\lm@:eean?,?`j i"e0@M JAgjҬj &* iR!a gB2@ 0N2Mx J]KL2i"1@?e.1#ean)\g PT@baCgiRjҀa @ 2b3n3M"2N2  "ii|g J]HL2 @?eL2 e? j RXg\gL@:eg J G@)J_2xyeQqgCxgkMF#m"{go57gyg֤5=a*xg;e+ 6a*#b5h7h7*a.- %aC-anbg*C'a*+jL+i"e0@.JAg#ayg+ cakl(B36m#D2a.E. cB` J9s`K j4a\g0L@:ee"r`B3D2md4CaN+a-+k +#ca.+ ca#a.* C`Bb` nXY8i Y eJ  a\g\^^@:eҞe? j RXgg@@:e gJ 0J_\e@:eCҏXgOCg e? " #\g\lm@:egKm;egiUe2d6Mg2ag./ Cat#2h6C6a.* `YgB25M#YgD2a.- caJJh3Ҁ2m3cxgI (3B2m %h4mg %"+l,l5B3H5Igi\g@@:e Igee %=?i jj +j(#a/ cakl"k Jja\g\lm@:egpgLe#k+oBCLXg M+_"C_a*a _a2d3m#0?a._* C?J_a K 1k` j@ <J@>" `?"e0@JAgj R`` jWJkP2Q Ay Y9xg   XgmgCXg9# g9"gCXg!C J Ji!Ra4J#5B2! #d3D2m#!0jk$\g$@ !@:e0 e@4 Ҏ4 %T``$?? jjҁL. -RXg)g/ J 20J_.L) "kKC/XgKR\g\ aC@:ee:e{aauagSXgSa,ac? a+ygc?a nXYi- j`YaB4H2MH2mCXgR`Ln3@@4N2wanggLl@$Oo "Ac"e0@JAgg_CXg&&Qa,`cagn,ygc`C8Nlm@:eKlC&kXgK*&l*e m*jk'\g'\g@:eeaja`$B4d3D2a+c`'i c8g E\g \g@:eean8,c5`aJaC`sXgcCmCXg_aN(_ aocg#aN) C`#j$"\g$@m@:e"ge\g\ !`"wB`+BaKC7k7 llkmjMؙPX mzNg@:e m mZHmZHmZHmzHmzHmZHmZ HjK{d a m@:ej @2ideh Caj \gPX@:e"ge*jvdr` #a\gp@ng@:ee"HHej @2iedg0@$gJ@:e Dg 0@eJ @:ej@ ehBK [`jJFkl@*@dB`@**ҚO n M0gH@8ejSj\@:e gpXe@:e *ҚOn `zd " O n Mp\ @:e"0@𸘅J:eOnM@gjSX @dB`@ * 0@𸘅J:eO n M@gjSg@:e D#re:a@dB`S*PT @:eJ*0@𸘅J:eOnM@gjSg@:e D+r` g@:e Se"P@8eV%r` g@:eSe *\ @:eegnpX @:ee*0@𸘅Jg:eO M@nPe@8e`j@ې@@:ej$ @2iedg0P$l@:ee ""g\@*l@=eej@jAِHAL@:ebgeQg#0g@8ejud$@* B j jej @2ide % $@ *\gLL@:egDd Egmjd @2ideg%j< @2ide$gw$@gr`Z `rz`ra@8e"gdr `JZ^ai\ PPg  o@:ee*0L@:e Ҟe="\g@:ee5"@@:e He@:e Xe@:egpXe@:eg0Pe @:ee" sM@=eej P  @8e Qgzd\g@:ee  PP g o@:ee*0T@:eҞe."j @g@:e Ce$`D g@:egpXe@:eg0Xe@:ee"sM@=eejP @8e JD@:e0egg@8e.H@:eegg@8e!ej< @2ideg $ggH@:ee*pXg@:ee8e@"gQgzdiej @2ie\gXJj*j*je%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $' ' .../dev/urandomnfinityanInfinityNaN0%s near '%s'%s near end of file%#.0f%dunable to decode byte 0x%xpremature end of inputunexpected newlinecontrol character 0x%xinvalid escapeinvalid Unicode escape '%.6s'invalid Unicode '\u%04X\u%04X'invalid Unicode '\u%04X'too big negative integertoo big integerreal number overflowtruefalsenull\\\"\b\f\n\r\t\/"\u%04X\u%04X\u%04XNULL %sInvalid UTF-8 %sCannot use '%c' on optional stringsOut of memoryNULL objectExpected object, got %sExpected '}' after '%c', got '%c'Unexpected end of format stringExpected format 's', got '%c'NULL object keyObject item not found: %s, %li object item(s) left unpacked: %sExpected array, got %sExpected ']' after '%c', got '%c'Unexpected format character '%c'Array index %lu out of range%li array item(s) left unpackedExpected string, got %sNULL string argumentNULL string length argumentExpected integer, got %sExpected true or false, got %sExpected real, got %sExpected real or integer, got %sExpected null, got %sNULL root valueNULL or empty format stringGarbage after format string%pmaximum parsing depth reached\u0000 is not allowed without JSON_ALLOW_NULstring or '}' expectedNUL byte in object key not supportedduplicate object key':' expected'}' expected']' expectedinvalid tokenunexpected token'[' or '{' expectedend of file expectedwrong argumentsrbunable to open %s: %sobject keyNULL object valueUnable to add key "%s"Unable to append to arraystringInvalid floating point value:: %lld[],{}w2.14.1objectreal{[siIbfFOon  !#&(*-/1468; !!!"""####$$$%%%&&&&'''((())))***+++,,,,---...////000111222333344455566667778889999:::;;;<<<<===>>>????@@@AAABBBBCCCDDDEEEEFFFGGGHHHHIIIJJJKKKKLLLMMMNNNNOOOPPPQQQRRRRSSSTTTUUUUVVVWWWXXXXYYYZZZ[[[[\\\]]]^^^^___```aaaabbbcccddddeeefffgggghhhiiijjjjkkklllmmmnnnnooopppqqqqrrrsssttttuuuvvvwwwwxxxyyyzzzz{{{|||}}}}~~~                    !!!""""###$$$%%%%&&&'''(((()))***++++,,,---....///000111122233344445556667777888999:::;;;;<<<===>>>>???@@@AAAABBBCCCDDDDEEEFFFGGGGHHHIIIJJJJKKKLLLMMMMNNNOOOPPPPQQQRRRSSSSTTTUUUVVVVWWWXXXYYYZZZZ[[[\\\]]]]^^^___````aaabbbccccdddeeeffffggghhhiiiijjjkkkllllmmmnnnoooopppqqqrrrrssstttuuuvvvvwwwxxxyyyyzzz{{{||||}}}~~~                    !!!"""###$$$$%%%&&&''''((()))****+++,,,----...///0000111222333344455566667778889999:::;;;<<<<===>>>????@@@AAABBBCCCCDDDEEEFFFFGGGHHHIIIIJJJKKKLLLLMMMNNNOOOOPPPQQQRRRRSSSTTTUUUUVVVWWWXXXXYYYZZZ[[[[\\\]]]^^^____```aaabbbbcccdddeeeefffggghhhhiiijjjkkkklllmmmnnnnooopppqqqqrrrsssttttuuuvvvwwwwxxxyyyzzzz{{{|||}}}~~~~ؗҜ<3#I9=D2[%Cod(h7yACnF?O8M20HwZy]ߙZSoΊ,,+ؑy6NFqHDz㷘M#jmrx0O\3-f+#Gx, vU0P;Lܭk<$JߵbSx݅Km׸=qԇk3odrɩ˯h;Hvmt0K;Υ>~AJB5]LRΕzCsBIfʦ`&8G ^s c_nU6b/!C{+ջuk-;eU3GԜ DHv,n%p*͖dW8'u>7qkDJ[D~X1jzhrL`YE=$obЏk0ԶӥijH).<)3 q%I To(qJ2,1'n1pƚ cm=M}x̻, FN`%##Xl!&8*&,nGѪo(f)ۤ̂EyP-}R5(Hvf;^eC2yVc@J6>Ծ|uO>hN"DwZS Zq(\QӃU1D[Z  yXfMnbs]-@!= h4f|9r#jGCND'"Kqɦ?wo"|Uˤ+TS*~ODt.%C19zcU=XU5yu|&c5UK<%w"ˋ#^F_uv I6]yY'᷂ 1X7 ?νjggA֋B`,I̮mSx@X[Hhu9y-^zmx{_`2ϚJ;\&\JoH/`ЋWڔ;yZ[l,01r'xP*{~Tg85*a1d<<~8@ޗ ^p8GP$ڍv$֭;ԨץL Lϟ^̇t+ep GvȄ;?) wqhyUqՓLƵ'/8;٦F.DJ0JJ.>vNY'Dź@0T(Y+>ݔxt:206Rj?D`巧:)ޥHtfV֑[IΟk% ‡F;iOQ]=)X k Gsg!YจPih0sOsUrBAP#Nd$lۃb}FEKr]Όk|O/na֢Ur{S uE,tAR8H, Q;ѠZH=sMXf_ `>?̳ѷ1ϻFwa՟ӛnȂS|.d" i{chz=%a->!Q )øiOInH,&ޣۉZ/\mv:kF)33Re 6+Yg}jt98H۔@N¨=FPbM@נf wC$^`2t G J#`M?Qks0T|Fݠd|W ,zk[J.l^dDw`zqa_bJ|lGe:-] hxy4yJk6`K*roCNr=z>'b"=suf)}5yc&4*|`R048?,g|Ax 6)KKՆc1^y 5C}eFM.?KPd9ϛ^z}pÂ'sv]NU&j:&(۲tE+kȒoOFɋ ;z˻n Y彪ܝj B̪TW‚F-deT"G$w߽~)p+~xYv6NWkw"Yą6_Su᪁½RDբR|3mK-@poߦPLв& ~$^/xsfԎ-;Vrk4y@+O&2$6} ?C1]=P_}tcLui|HRD"[gAr`ŗ k鸶`T#g$8>G#)v6 rpDΛ’s w;H+Ʊ (J8l (2R c%#Y_S~HWH7yZ-'D"E1k˞6-~Fr"w[%R̆꺔G)'9ט#?,d />hS3ꌤ+ZBè_6U%Ͷ11e79U>_ػ=*nj[@uȋ dZEC.F{s=ĶMFUJZ(LuLᗪMq3eM=P?{FTxۏ_RWVs|f>Zvc'^S|Y~`Uahqޝd!q& bhi U{`=k\;+*}nz[`wrg@8Uu_ߣ7.Flkx;1a⼺K##|}9wl^U"S5疂uu\TAP~$$Ғsi ݉-ԇwN^<섴Jb;ZK'aЊϺ9Eg,΁CKꀚ_B1^y%>;5Xn nʋtH~d^w%ڝXvJ6Qӽ݃:R;uDjım'<u,$SP{tӻd}Ja1+].2:2wI6 [Mh.L|٬:75$\ SB.Ke( ̼ˈPo? $˥i۾DsA_p6 h1w̫a+ ՔּBzv2=7ilI?Gŧ#G܀X+ean;OZd= ף ףpףp= @P$ (k"@C%(*焑, /1_26.9:k @v<#NJ@xbC&zF2xnJ?hW MPaQY@ToȥW': Zx9? @^ 6PaNgd@|o"EMgŝp+ k7L6(lnV߄2q \l:@Q4FKnԖlq2#ku0SEkFۄx|Fd{On_~OmIw3^ U\Oc*/ss~Mg(5FQၲ‹e B|Z"YW_Fixu3/-7ñR{x k}]gME2cP@ fP?]zB壦Gߌl3oƪ٨#G *lY C7ȇTwyE)j^Tm)R4'E]^!]dBCupv~IrJIjEiۇP֒ҩE[ś[# 6h2wlDd#2ja5vDŹӨl _7h͡6"!"dZkTIIk*S5=]ȔoB:9#wrixv* %eь[fX~y/8?w/XJU.g]S*\*tZtau߈=9q ѹGV7z "Ub+k{WvI㔝_~ZA}XdұzزnYF__o!#;{%%,J V(٤(Q++"yD/A(+EW:52/u-B5]| .|5ai94›%9ۃC<².g?a}DKC2*bdF(ʓu{}I5˲xRs\La:P®kzSr[TV b XMh,x{R5 .Ea7VpǼ|Bv`]jVR5ZS!{3zr֨YOt dpbԅ>V݊J.7+>m虺ŶԱ ےJ^MY%ܵ:0dD.q$~s\ ]V>%tPukN/R/t?x,4$MB@Fr У$IV<Č-Leq|/~P~S1Vx"t*UV\(35k:ZsVF*],Wiu+-`jgb);dB_Igv/?wqBp$jS ӌ#m]ɞc86qY{H|Ctoځ܆w(1|{r}ca/~J<9;cAnՅJID-KE+Q݋E;R吻ʏbڸ uj= g }ajE+'A`S8Qdһsx^4~cU{H ۣI_^jΑS\uk@Av᳹)c驭 ();bEcT)23ʺy|Y־ԫI0pIVh\&Ҍ/j\.s]X]S1t.%2Ш|>0:o?(^KDϧzcрy6^UfQõj@4+Gٍ4cPO^عԚn5O / BbbLa'瘽}8@!,ݬc GP]xXRzR 7ϖ%` P|$.Gtґ~3LQ.GG?嘡cX/gD^ W;s?5e, OK~.aB 'zխ9Қy Jt8ǁR7o·H"Jy©ƣu83A_(ׁsǥM""!9kk"h$)/u(:SoZI`+^h#`[8.,B,8rF1¢l5?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD}D! 08@22U. /01691\y\9xyAzU/I{1|]|5z|ىyA{0e6/y0-0000%%5!m͐-eqau.UyA%qYiźɧq}x})p`P@0 p`P@0 p2`P@0 0p207070101AE22F30000A1FF0000000000000000000000016A426C2800000014000000FE0000000000000000000000000000001800000000usr/lib/libjansson.so.4libjansson.so.4.14.007070101AE23A4000081ED0000000000000000000000016A426C280000C232000000FE0000000000000000000000000000001E00000000usr/lib/libiwinfo.so.20230701ELF4t4 (p888pPPPtt|||hhh@@QtdRtd|||  P !  |$ S 0(ppp ppp"poooox=!N"^>]UkDOrm|:q$?&)0z.P8K17(;F359* c\< ,#2tgeT/6-4` u oA'GQdX{hEM[%@J wY+LvZIBSHa RCsj}VyfWb_lp~nxi -4dx/) $j$  @H,(\($, #- " A%A P q#9 ~$) 05  #= 902 8=$  %5 ,| p|`P@y0 ]' +=Њt6S`JD) p`Ps@0N  0lЉK& =p`#P*@s+ 00 ;]/- 4`ЈvpL`P@t0 "TdR%'6 kЇh!u @&gp'`P @0 uB  І"OD 7`p`& EP."l@! 0l % .. a5dЅ+o. - _fini__cxa_finalize__deregister_frame_info__register_frame_infomemcpystrcmpblobmsg_parsestrncpyiwinfo_ioctlsocketfcntliwinfo_dbm2mw__fixdfsi__muldf3iwinfo_mw2dbm__floatsidf__gtdf2__divdf3iwinfo_band_nameIWINFO_BAND_NAMESiwinfo_htmode_nameIWINFO_HTMODE_NAMESiwinfo_band2ghziwinfo_ghz2bandiwinfo_format_hwmodesIWINFO_80211_NAMESsnprintfiwinfo_htmode_is_htiwinfo_htmode_is_vhtiwinfo_htmode_is_heiwinfo_htmode_is_ehtiwinfo_ifup__stack_chk_guard__stack_chk_failiwinfo_ifdowniwinfo_ifmaciwinfo_closeiwinfo_hardwarememsetfopensscanffgetsfcloseiwinfo_hardware_id_from_mtdfscanfmmapmunmapiwinfo_parse_rsnmemcmpiwinfo_uci_get_radiouci_ctxuci_alloc_contextuci_lookup_ptruci_lookup_nextiwinfo_uci_freeuci_free_contextiwinfo_ubus_queryblob_buf_initubus_connectubus_lookup_idubus_invoke_fdubus_freeblob_buf_freeiwinfo_backendnl80211_opsiwinfo_typeiwinfo_backend_by_nameiwinfo_finishIWINFO_ISO3166_NAMESeht_chan_widthvht_chan_widthht_secondary_offsetIWINFO_FREQ_FLAG_NAMESIWINFO_OPMODE_NAMESIWINFO_AUTH_NAMESIWINFO_KMGMT_NAMESIWINFO_CIPHER_NAMESgenl_family_putnl_socket_freenl_cache_freereadatoirealpathstrncmpstrstropendirreaddirclosedirstrlenstrchrglobglobfreefnmatchnla_parsenlmsg_allocnl_cb_allocnlmsg_freegenlmsg_putmallocnl_socket_allocgenl_connectgenl_ctrl_alloc_cachegenl_ctrl_search_by_namenl_cb_putnl_cb_setnl_send_auto_completenl_cb_errnl_recvmsgsnla_putstrcpy__lstat_time64if_nametoindexfchmodgetpidsprintfbindlchownstrcspnstrspn__select_time64recvfwritesendstrtok_runlinkstrtokstrtoulnl_socket_add_membershipsstrtolisxdigitkillgenlmsg_attrdatagenlmsg_attrlennla_oknla_next__floatunsidfstrrchrlibuci.so.20250120libubox.so.20260213libubus.so.20251202libnl-tiny.so.1libgcc_s.so.1libc.solibiwinfo.so.20230701GCC_4.2.0GLIBC_2.0GCC_3.0 ``' 7ii AP&y K|  $(,048<@DHLPTX\`dhlptx|  $(,08@HPX`hp|0' '<3'!'@@@ D4@4 p$$@ '<2'!@Dҥ$ p$A`@2mb`3`3M`3@2mB2k leA`@2mb`3`3M4g`24m`3ml3ml Jej @2ide\g0@J@:ekkJDd le$a`3뢤DD55mc`3m#e`3m4b31lK ijejf @2ide$gg0@0cJ@:eH"gg8eO@+udjt`\ `t`\``,jm @t ` t` t`t `j@k@k@ kk@K@k@km @ej @2idegNҰDnM@:eAj""g0@J@:e 0@"cJ@:e"j Za0 "CI@9e CaZa0@"J@:er `"@9e O "I""g0@J@:e 0@"cJ@:ej Za@9e CaZa@:ere `@9e O I𸘆BXM@:e *p"g0@J@:e 0@cJ@:e Za @9e CaZa0@ cJ:e@ e0@ J:e@PDegm@:e9$6" @:egXe@:e)* @:ee@:ePDegm@:e$ @:ee›gg@8epdj @9e O Ij @2iedg8XJ*Dnml@:egX0\em@:eenM0\m@:ee @8evdj% @2ide jZ*gi  Bai Ba @8eydP@:egegIP  @:egegIe?$@$?je @2ide\gX@:e"gjeg\g 0P !" @:eRe`\g0P@:eRe`zd J\g X @:ege"gJ\g X @:ege"ge$@ zo ?$?j @2iej"jk+Jr4aH4\gpHI @ jje @2ie "jk+Jr4aH4\g\I @ jj% @2iL\e`\gX2JQ @ jt`\`t`jN\Xg D2ahB H2O[aI%A@2H2Bb`IJ`BAg\g Ln@:ee"\gnLMA@:ee *ErQ` Z/`r=`rB`IGAJg\g Ln@:ee"\gALnML@:ee *\g0@O@?eeIZ` ZaAk raAkmAkF AmAkFAmAFkmFAkmAkF?)jDejD @2ideg X$g(nm@:eeF!@@knZXgH2p4 XJ ,0X@:ege@)"p\no@:ee* "𸘰XM@:ee* XNO @:ee"j|dj "e+$@8e* ejd @2iegdpҀ$P@=ej@ddej$ @2idegj ҂gLm@:eDel@:e Ҟe8"gpP M@:eie+*j0@ؘcJpL N@:eZ8geI @=ee @8eQg}di+jd @2iedgA@:e"PgddjjD @2ide\gT@:e"@Ddej @2iegdҰXg@:e*Pgddjej @2iedgD@c4g@ؘ1gHr Nm@:ePe@:ee#P@8ecZd Xgejb @2i deH$g$g0@GJ@:ee=*HnMg@:ee4*A0@@:e("jKXX0@J@:e"ge"7" nmD@:eR`0gH@8eiQgwd0@g' J@:ege*0@ J@:eR `0@gJ@:eRajҶJ"  nmja @2iedg0@'gJ@:e "0Hgg@8eud jKej! @2iedg00j ҨH&gOn2m@8e* d2iP2@wd jjej @2iedg8 nQgzJg Xm@:e00 HҎOnm@8ezP" wdjj @2ide\g0@(J@:eZXgkDd nejA @2iedgn00ҨH8en O@mZXged Jej @2iedgn00ҨH8eO@mZXged Jej @2idegj@ABCDL:e@%g Ҟe=*xdJ PX@:e ҞegH @:ee&* iS"gLHnM@:ee*0@0J n Om@:ee@ @:eҞe*P @8ej @2iegd0gHO@?e "]g @@jfdjKej @2ide\gg0@J@:e*Sa`edS`nkknKSa(kjKeja @2iegd0gHO@?e "]gldjX@jfdjKej! @2idegj0@nJ_m@:e"g"g0@00JNMH@:eg@8evdej @2i degj0@J:e@$gnL&n0@gJm@:e"ge"Donm@:eR`0gH@8ejkK`vd00HMg@8e*p3ej! @2iedg0@nJm@:ee""gPX @:e eBDm@:eR `0gH@8eud0nHmg@8ej @2ideg X$g4nm@:e0@gJ@:enL&n0@gJm@:e"ge*jK}d耚Donm@:eRa0@0J Mg@:e *0&H@8e `0gH@8eej @2ideg X$g4nm@:e0@gJ@:enL&n0@gJm@:e"ge*jK}d耚Donm@:eRa0@0J Mg@:e *0&H@8e `0gH@8eej! @2ie@dgT@ ,j #P@8e0@$g J@:eRe `0@gJ@:eRe aXjL@ۺKABCD@:e Ҟer*@"JgؘH0 Nm@:e I@9e ne>*HؘNm@:e@9eRe *aHؘNm@:e@9e"g Je " ba raq `@n@:e e ѐ@ @:ee*PD @:ee j J @{dj @2iedg0 (I@9ee"g @8ej 0@ J@:eg*jKud@9ee" ej@ @2iedg0@i J @:ekk "00H8eOn@mZ@Xgwd Kj @2iedg0@%g J@:ek`" 00 H8eю On@mZXgvd Jj @2iedgT @'Xnnm @:eDemnl@:eRe"g@ajNؘHNlm @:eaBe#lZajKJHmg@:e0\emg@:emenM0\g@:eRe`0Tg@:eie+ '`nF"P@8eL g@:ee*kJ~ҰT@:eg𸘰PeM@:eeB0Hg@:eReap\men@:ep\eemen@:eeQgvdej @2ideT$0@jJ@:eR؞es1"AT2"AU9 $0@jJ@:eV؞ewB $0@jJ@:eH؞eiA"AY*"B`H+"B`J,4"d@sLeL `[`s `saM("APت)"ARذs`s`s`rMM@:e:%0@OuL@?e;%0@O@?e<%0 @I@9e7"e`3놢m44mg`3#i`3늢44mk`3#``l``e`3놢 m44mg`3#i`3늢44mk`3#``l``e`3놢44mg`3l#i`3몢55mk`3#````e`3놢44mg`3l#i`3몢55mk`3#````e`3놢44mg`3l#i`3몢55mk`3#````e`3놢44mg`3@l#h5mjK`3`3@2m"`@ km`@jHWWAJA {d jM MM2M2Mej\ @2ied"\g%pD@:ergen`rn`raMg\g30H@8eB:8e@Am8em1@Hm1@8embgG1eb"kB2@B\gnHMg@:ee*H\gnH2 Mg@:ee*H\g"pD@:ege\gg0A HA@8ee\glPijj\g 0@&J@:ee*&r`rajjKg0rdejZ @2iedgT @j0@ J@:e * 0 0I n Om@9e Pe*0 n O m@9e Pep*0@𸘮J go2M@:eeP"j PP@nmg@:e QP@emn@@:e RP@emn@@:e SP@emn@@:e TP@emn@:e UP@emn@@:ee V P *J &#P@8e V2M U T S Ѣ P@:ejedej @2idei2\g0@ J:e@g ؞e"*JzdGA J PX@:e ҞegHA L@:ee%* IS" HLnM@:ee*0@0J nmOm@:ee@ @:e"ge*PD 0@:e H @8e"jX@j 𤅂`KJ1Kj @2iedg0@%gO J@:e *0H8e@g@ud Egmjy @2i dejK \ggX pJ:e@$ge"j |g 0@0JnlOmg@:e ҞeQ* \g L#a @:e#eW`D@C$a`CXg*\gnDgg@:eJH2@ yd @:e#eW`D@C``CXg*\gnDgg@:eJeHjK jy @2ied|gTh @50@ J@:e  e* |g0@0J n O m@:ee@k*|g0 𸛮I!oM@9e@eX*|g Xg҃oM@9ee5" X"rOa\g!@0\"mg@:ee#"a!+'!Ya iA@C`-caA@c`)C`\gDg@@:ee%j@@*\g D !o M@:ee 5@ZXgK#\gP@ %8!"( ,$ / & 6%*7# +'31.)-0254    P0 Zp0`0P0@0K00 0007/1/8/////u/p/t`/P/@/Y0/ ///`....R..._."p.`.P.@.k0. ..z."Q-D--."-&---_fini__cxa_finalize__deregister_frame_info__register_frame_infouloop_fd_addblob_buf_freeuloop_timeout_canceljson_object_putjson_tokener_freeubus_abort_requestcloseblobmsg_parsestrcmpblob_memdupblobmsg_add_fielduloop_timeout_setubus_connectstderrfputsexituloop_doneubus_remove_objectstrlenjson_object_object_get_exblobmsg_add_json_elementubus_lookup_idblob_buf_initubus_invoke_fdblobmsg_format_json_with_cbstrncasecmpustream_printfstrdupstrchrstrncmpubus_lookupubus_strerrorubus_register_subscriberubus_subscribejson_tokener_newblobmsg_open_nestedblob_nest_endmemsetubus_invoke_async_fdubus_complete_request_asyncjson_object_get_typeblobmsg_add_objectblobmsg_parse_arrayjson_object_array_lengthjson_object_array_get_idxjson_tokener_parse_exuhttpd_pluginlibubus.so.20251202libubox.so.20260213libblobmsg_json.so.20260213libjson-c.so.5libgcc_s.so.1libc.soGLIBC_2.0JSONC_0.14w ii hhOlOpOxOOOOOOOOOOOOOOOOO PP P$PQ' '<@Ü'!' Q@؀@؀ D@ 4$$ Q '<œ'!耂@耙$Q$ 4$A`@2mb`3`3M`3@2mB2k leA`@2mb`3`3M4g`24m`3ml3ml Jej @2ide\gXJ@:ekkJDd lej @2iegdM=e@gDd Ie$a`3뢤DD55mc`3m#e`3m4b31lK ijejx @2ide$ggXaJ@:eH"gg8eO@+udjj8 @2iedgX؞gdHA@:eDdj @2iedgX m@,L@:eDdej @2iedg`@D$gB=e@uL`@ABPe9L@:e򄙞e$pT@:ee$@=eeL "XP`A@?ee0@8ejLudj8 @2iegdҪ@T a0@=e@kklddej @2ide%&g.XgJ:e@g@eLO m@:e $aH@8e@KB2@wdj @2iedgX$gJg:e@g@eLO m@:e *$XaJ:e@ ҂g@𸘞e M@:e* $ @ @:e eB $@8eZFkXgnydjjj @2ideg32m3gm5kl𘘰 j 8eҊL@medej @2ideBJB *Lra\gpHmHL@:eDdjw @2iedgX8ڐPو@:exe@*pX𘘠PHL@:epel@8eH𘘠 L@=ee@8eud jej @2ide@J`aa@ۡݠ\gML@:eDdj @2iedl_p_   `Pppp ppYp$poo0oo~CY9BR"7E!I3M-1O' )* J8;+5:C(# %U/H TA?@ <&$.=26,G04KP>NDXWQFLSV` 5 7] b=:T  `B 9 7]7> ) m 5a ` R B :0 } 7  78L lU8 ]r 0I p> 1 u5*  :p p U 5Z |P>@>10>v >e>D>===p=g=,===Tp=`=P=0@=0=\ =$=q=<<<*<L<c<]<<p<`<KP<=@<"~0<  <`<<W;;;;;;;;;p;"`;P;."_, @;0;z ;;V;_fini__cxa_finalize__deregister_frame_info__register_frame_infostrlen__calloc_astrcpystrncpystrchruclient_urldecodestrrchruclient_get_addrinet_ntopntohsuclient_backend_httpstrncmpstrstrstrcspnmemcpyuclient_newuclient_set_proxy_urluclient_set_urluclient_set_timeoutuclient_connectuclient_freeuloop_timeout_canceluclient_writeuclient_requestuloop_timeout_setuclient_new_ssl_contextdlopen__dlsym_time64dlcloseuclient_readuclient_pending_bytesuclient_disconnectuclient_strerrorustream_free__stack_chk_guardbase64_encodeustream_printf__stack_chk_failreallocsprintfmemsetusock_inet_timeoutfcntlgetsocknameblob_buf_initustream_fd_initblob_buf_freeustream_get_read_buf__errno_locationstrtollustream_consumestrsepstrtoultolowerblobmsg_add_fieldsnprintffopenfreadfclosebin_to_hexhttp_digest_calculate_auth_hashhttp_digest_calculate_responseblobmsg_parsestrdupstrncasecmpustream_writeuclient_http_set_request_typestrcmpuclient_http_reset_headersuclient_http_set_headeruclient_http_redirectuclient_http_set_ssl_ctxuclient_http_set_address_familyisxdigitstrtolmd5_beginmd5_hashmd5_enduclient_get_url_filenamestrnduplibubox.so.20260213libgcc_s.so.1libc.solibuclient.soGLIBC_2.0ii l_p_t_|_____________________________8a' 'aB@j \gXHM@:eҞebg"j@\gp\@:e  ej@\gLn @:e e`+Ra ` #\gmgO@?e Mo @ *kj@qa`gRa`g @0   ` C`kg DRa`g D*jJ@QC` C\g0Dg@:eeR ag\g@?ee\ggM@=e@Pe *`H*\g@AYL@:ePgej @2ideTZ"akklr`@g  Ңg\g|LX@:e"ge " "TZaJ"zdCB` s\aoBcZaj@t+s@xa,"\g8LgIgg @:ege$%x =$%x <$%x ;$%x :$%x 9$%x 8$%x 7$%x 6$%x 5$%x 4$%x 3$%x 2$%x 1$%x 0$%x /$%x .$%x -$%x ,$%x +$%x *$%x )$%x ($%x '$%x &$%x %$%x $$%x #$%x "$%x !$%x  $%x $%x $' 'Unknown/?#libustream-ssl.soustream_ssl_opsunknown errorconnect failedtimeoutssl invalid certssl cn mismatchmissing ssl contextinvalid error codeAuthorization: Basic %s , %s="\"%s"44380 realmqopnonceopaquestalealgorithmauth-paramdomainqop-options%08x/dev/urandomauthusernameuricnonceresponseAuthorization: Digest nc=%s, qop=%s%s []:%s %s HTTP/1.1 Host: %s%s%s%s%s %s: %s Transfer-Encoding: chunked 0 chunkedclosebasicdigest%X locationtransfer-encodingconnectioncontent-lengthwww-authenticatehttp://https://GETHEADOPTIONSPOSTPUTDELETECOPYLOCKMKCOLMOVEPROPFINDPROPPATCHUNLOCKABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/;&@@@@_Q#")) 1#&4A AAA$A,A4A8A@AHAPAXA`AlAxA8aU8%578 :=:P>@>0> >>>========p=`=P=@=0= ===<<<<<<<<p<`<P<@<0< <<<;;;;;;;;p;`;P;_@;0; ;;;8a07070101AE239E0000A1FF0000000000000000000000016A426C2800000011000000FE0000000000000000000000000000001600000000usr/lib/libf2fs.so.10libf2fs.so.10.0.007070101AE1D1C000081A40000000000000000000000016A426C2800065A7F000000FE0000000000000000000000000000001F00000000usr/lib/libmbedcrypto.so.3.6.6ELF4p4 (pl0l0:JJF000  QtdRtd:JJ44 KKK ( JJP0L 4K `ppp pCpIp pooood I y-v^'B.@,HJtX,h7=Z9> {*0'/YLl9 I}_X#c8r jQ 9mbO&2Nw [hI\kQ{; KmusCNhx#M$f3/ E`~iqzH<2';[1+"$71BeAN3 8G:1Udos:-Or`SW]RJc)0'$n#D3,   J aTbkktVg>pFu(- <8.?KX7a)PHn^W >qFv+9Rld# Gi(zA,\jS?!6 m4=+;3/>EYc.2{M]5_Ebg`i4qPy\Yd1%!.6SOp;4s[V"*gD?U=f}^r%aT@<pU+DB5( &/z0? xW:Gw"M)<oI V|}@!CC x%v]:e~-2&Fw7PlyZA=$@!jLQ(DfGKH~%|*t5o&8 L5_uBe4 )Tn*6Z R0A6CFE|"( t5 4 @@ )L . h)V  8F = K 0;w$ @ Q( =8 8,D  $ 5X + hM Hh @l 2]  tP\ =@ ( 6h 8h BT =@ R@  'D 6 !U| xDa '\   ra 'kD QT p ] 0 O, T "4 Ԫ 0$x wlo ]<8 Px 3`th IH +.-H ȡ( 4 #zD >)gX ?@ ]8d @d %" 'D #P & iG a  hGT '4p ;h$  W=Д #04 E PH E` [@  ) "np 5d 50 < ԑP ~I2P %X * P < S&8 0 &:  J? 5l b $\X DDX^@ W0!T ) p >h :X < 1 7(p | 7 AwP @ 2^   .h  ( 9 4 CDi L2( Cj #<  }2 V$   i,`  2c\  'YL 1t  :P h;LgX 8d  20%t ] F 9` ?H:D `h 1`  lF0  ;w  I? 0l4 o  Ȧ " "D^< bH G8 .,X \  L ht ;d 8 ]$ I1| } R%( r Y/ &3v$ ( ?Ad  <| %$ P@ { E@ C04 *FH ] )D ^( B l x t34 .$` c9 t F | N \ p < ;  9$(  7 #4 B&|  9X B x /C|  > lCm 5,8 Hq )T F ;h (t (HZ TG [ \N @ -'k$ z@ a0 -) 4 27 % A8H 9  B/l { ,! i&4` B0d < &&, v$ G$4 Z@  cgD CQ Y; 9 LH LD %h $t  6d %C< (#@~\ p;D$   th J |)` f?X 3T \ b4X #  bD^ LxD +@ < ; oH;  9 u1% + d r+  T) /tCH  D at g'B$ l8К `  R*h F$ FD< 90 @ i<{D "$h< S+D ` [CtC &@ (h ^( 5 xp ?0  &@ 29D` EP$ 84 !<]@ @ QA  cPo ..< V 06@ 4d $Ah SCk .., 9\! x 1@ )5 @/؀ (@ } _1? 6@TL Z \ 7P Ah ' A ,  IH[  :}T  = 7>P ;+d T At  %(h B :h "Pz *$x l"d 9Pp | F` X Fh : H# Tl x tCxF  (!U p P4 7<( &`$ p 0 p ZX : H "\ O /xD a x 64 H\ l  cE  D &< + T . =@ ", ? E$L UT ^ | \ ,( Jt ;  1* . )X @C@ "*  m(BL T7h 8C "  d  @QP < F| |\$ + < @   p 9| 9( "T  l;H x : ,  ( 9$A :4 RpP S'Y$ ) C|IX |  @ -'l ~-(t #@ .A, >.H-H _| $ ,A8 , 7"x  DO C0{ ;G, b \ f:5t *\R l ? % `` ) H A` L 2(! =$ x WJ\`"] < 8< 2^ E j?D  9 C!V O>8 H$ cAt ==4 C|M GT ,'  X EX 3 3X ( /B zA 4\ s ,/  B0Q 0Բt wJ@ <D g|0 &D ! |\ _F  4} _( C@<  8T 0C G4 Eh" 1 D I O0 | L ;gT mT \$ &  }.8.H kAt` -L+\ 8; W3$ CK 7 Im "x ؛ 3 X CT} X )< 6 J, t>8 %( \8 H(pB '08 ^:x .8    f> H B\x IHC 9 ( E xBd *\ ![D =8 * tD A& l > )Tj @ ж L| >* H & # %< /+  uB.l m >P\ A \ 1 #h mG\,  $c 26L  h dn| 9` L0 BT3X $ >8 ,|  >  J:` 7 &?x  B @X H  H P. G|, iD .1< l#x g 48  . ?d ;3|8 $o4 L, +  58 H  0%8 OX d   hD D k* B 8 tx K9   p 8h v 8T 7l / lX u= :H :8 !8  32*\ CO D$ P$D ?\ (Y  Tt 6D 1,\ ;$ $h 8 Y6t 6h G4  u6 $8 @f #  }: t8D A' $ y4 20Zh 7BD(P n"x (H8D G T# 4(4 (k F  RD B:@8 y'$ rPD C;0 BF0 0  c2Op | 8 X Dt  (' l3́ ' Q< |, ^"4P : l 5D H\ * VHH zT 8]x !H[ (GxH (  Q;j ` h7 r  8p A8 -+D I"w  ~ `5D $D A4 ;hh j@$ I"D HX -((t H  |`J/Jt4`^4dJTD4"."$Vi#`Ќx "X-l_0J4@`ԛs ěBJ # *, A4D tdJTp4D- _0N`4m-_0 $2-_0#FJ 4$`e`DJԚxx`E-<_0#Ě&,  F4G_fini__cxa_finalize__deregister_frame_info__register_frame_info__stack_chk_guard__stack_chk_failmbedtls_aes_initmemsetmbedtls_aes_freembedtls_platform_zeroizembedtls_aes_setkey_encmbedtls_aes_setkey_decmbedtls_internal_aes_encryptmbedtls_internal_aes_decryptmbedtls_aes_crypt_ecbmbedtls_aes_crypt_cbcmbedtls_aes_crypt_cfb128mbedtls_aes_crypt_cfb8mbedtls_aes_crypt_ctrcallocmbedtls_asn1_get_lenmbedtls_asn1_get_tagmbedtls_asn1_get_boolmbedtls_asn1_get_intmbedtls_asn1_get_enummbedtls_asn1_get_mpimbedtls_mpi_read_binarymbedtls_asn1_get_bitstringmbedtls_asn1_traverse_sequence_ofmbedtls_asn1_get_bitstring_nullmbedtls_asn1_sequence_freembedtls_asn1_get_sequence_ofmbedtls_asn1_get_algmbedtls_asn1_get_alg_nullmbedtls_asn1_free_named_datambedtls_asn1_free_named_data_listmbedtls_asn1_free_named_data_list_shallowmbedtls_asn1_find_named_datambedtls_asn1_write_lenmbedtls_asn1_write_tagmbedtls_asn1_write_raw_buffermemcpymbedtls_asn1_write_mpimbedtls_mpi_sizembedtls_mpi_write_binarymbedtls_asn1_write_nullmbedtls_asn1_write_oidmbedtls_asn1_write_algorithm_identifier_extmbedtls_asn1_write_algorithm_identifiermbedtls_asn1_write_boolmbedtls_asn1_write_intmbedtls_asn1_write_enummbedtls_asn1_write_tagged_stringmbedtls_asn1_write_utf8_stringmbedtls_asn1_write_printable_stringmbedtls_asn1_write_ia5_stringmbedtls_asn1_write_bitstringmbedtls_asn1_write_named_bitstringmbedtls_asn1_write_octet_stringmbedtls_asn1_store_named_datambedtls_base64_encodembedtls_base64_decodembedtls_mpi_lt_mpi_ctmbedtls_mpi_core_lt_ctmbedtls_mpi_initmbedtls_mpi_freembedtls_zeroize_and_freembedtls_mpi_growmbedtls_mpi_safe_cond_assignmbedtls_mpi_core_cond_assignmbedtls_mpi_safe_cond_swapmbedtls_mpi_core_cond_swapmbedtls_mpi_shrinkmbedtls_mpi_copymbedtls_mpi_swapmbedtls_mpi_lsetmbedtls_mpi_get_bitmbedtls_mpi_set_bitmbedtls_mpi_lsbmbedtls_mpi_bitlenmbedtls_mpi_core_bitlenmbedtls_mpi_read_binary_lembedtls_mpi_core_read_lembedtls_mpi_core_read_bembedtls_mpi_write_binary_lembedtls_mpi_core_write_lembedtls_mpi_core_write_bembedtls_mpi_shift_lmbedtls_mpi_core_shift_lmbedtls_mpi_shift_rmbedtls_mpi_core_shift_rmbedtls_mpi_cmp_absmbedtls_mpi_cmp_mpimbedtls_mpi_cmp_intmbedtls_mpi_add_absmbedtls_mpi_core_addmbedtls_mpi_sub_absmbedtls_mpi_core_submbedtls_mpi_core_sub_intmbedtls_mpi_add_mpimbedtls_mpi_sub_mpimbedtls_mpi_add_intmbedtls_mpi_sub_intmbedtls_mpi_mul_mpimbedtls_mpi_core_mulmbedtls_mpi_mul_intmbedtls_mpi_core_mlambedtls_mpi_read_stringstrlenmbedtls_mpi_read_filefgetsmbedtls_mpi_div_mpi__udivdi3mbedtls_mpi_div_intmbedtls_mpi_mod_mpimbedtls_mpi_core_exp_mod_working_limbsmbedtls_mpi_core_montmul_initmbedtls_mpi_core_to_mont_repmbedtls_mpi_core_exp_modmbedtls_mpi_core_from_mont_repmbedtls_mpi_core_get_mont_r2_unsafembedtls_mpi_core_exp_mod_unsafembedtls_mpi_core_check_zero_ctmbedtls_mpi_mod_intmbedtls_mpi_write_stringmemmovembedtls_mpi_write_filefwritembedtls_mpi_exp_modmbedtls_mpi_exp_mod_unsafembedtls_mpi_gcd_modinv_oddmbedtls_mpi_core_gcd_modinv_oddmbedtls_mpi_gcdmbedtls_mpi_fill_randommbedtls_mpi_core_fill_randommbedtls_mpi_randommbedtls_mpi_core_randommbedtls_mpi_inv_mod_oddmbedtls_mpi_inv_mod_even_in_rangembedtls_mpi_inv_modmbedtls_mpi_is_prime_extmbedtls_mpi_gen_primembedtls_mpi_core_clzmbedtls_mpi_core_bigendian_to_hostmbedtls_mpi_core_uint_le_mpimbedtls_mpi_core_add_ifmbedtls_mpi_core_montmulmbedtls_ct_memcpy_ifmbedtls_chacha20_initmbedtls_chacha20_freembedtls_chacha20_setkeymbedtls_chacha20_startsmbedtls_chacha20_updatembedtls_chacha20_cryptmbedtls_chachapoly_initmbedtls_poly1305_initmbedtls_chachapoly_freembedtls_poly1305_freembedtls_chachapoly_setkeymbedtls_chachapoly_startsmbedtls_poly1305_startsmbedtls_chachapoly_update_aadmbedtls_poly1305_updatembedtls_chachapoly_updatembedtls_chachapoly_finishmbedtls_poly1305_finishmbedtls_chachapoly_encrypt_and_tagmbedtls_chachapoly_auth_decryptmbedtls_ct_memcmpmbedtls_cipher_listmbedtls_cipher_definitionsmbedtls_cipher_supportedmbedtls_cipher_info_from_typembedtls_cipher_info_from_stringstrcmpmbedtls_cipher_info_from_valuesmbedtls_cipher_base_lookup_tablembedtls_cipher_initmbedtls_cipher_freembedtls_cipher_setupmbedtls_cipher_setkeymbedtls_cipher_set_ivmbedtls_gcm_startsmbedtls_cipher_resetmbedtls_cipher_update_admbedtls_gcm_update_admbedtls_cipher_updatembedtls_gcm_updatembedtls_cipher_finish_paddedmbedtls_cipher_finishmbedtls_cipher_set_padding_modembedtls_cipher_write_tagmbedtls_gcm_finishmbedtls_cipher_check_tagmbedtls_cipher_cryptmbedtls_cipher_auth_encrypt_extmbedtls_nist_kw_wrapmbedtls_gcm_crypt_and_tagmbedtls_cipher_auth_decrypt_extmbedtls_nist_kw_unwrapmbedtls_gcm_auth_decryptmbedtls_nist_kw_freembedtls_nist_kw_initmbedtls_nist_kw_setkeymbedtls_gcm_freembedtls_gcm_initmbedtls_gcm_setkeymbedtls_des_freembedtls_des_initmbedtls_des_setkey_decmbedtls_des_setkey_encmbedtls_des_crypt_cbcmbedtls_des_crypt_ecbmbedtls_des3_freembedtls_des3_initmbedtls_des3_set2key_decmbedtls_des3_set2key_encmbedtls_des3_crypt_cbcmbedtls_des3_crypt_ecbmbedtls_des3_set3key_decmbedtls_des3_set3key_encmbedtls_ct_memcmp_partialmbedtls_ct_memmove_leftmbedtls_ct_memcpy_offsetmbedtls_ct_zeroize_ifmbedtls_cipher_cmac_startsmbedtls_cipher_cmac_updatembedtls_cipher_cmac_finishmbedtls_cipher_cmac_resetmbedtls_cipher_cmacmbedtls_aes_cmac_prf_128mbedtls_ctr_drbg_initmbedtls_ctr_drbg_freembedtls_mutex_freembedtls_ctr_drbg_set_prediction_resistancembedtls_ctr_drbg_set_entropy_lenmbedtls_ctr_drbg_set_nonce_lenmbedtls_ctr_drbg_set_reseed_intervalmbedtls_ctr_drbg_updatembedtls_ctr_drbg_reseedmbedtls_ctr_drbg_seedmbedtls_mutex_initmbedtls_ctr_drbg_random_with_addmbedtls_ctr_drbg_randommbedtls_mutex_lockmbedtls_mutex_unlockmbedtls_ctr_drbg_write_seed_filefopensetbuffclosembedtls_ctr_drbg_update_seed_filefreadferrormbedtls_des_key_set_paritymbedtls_des_key_check_key_paritymbedtls_des_key_check_weakmbedtls_des_setkeymbedtls_dhm_initmbedtls_dhm_get_bitlenmbedtls_dhm_get_lenmbedtls_dhm_get_valuembedtls_dhm_read_paramsmbedtls_dhm_make_paramsmbedtls_dhm_set_groupmbedtls_dhm_read_publicmbedtls_dhm_make_publicmbedtls_dhm_calc_secretmbedtls_dhm_freembedtls_dhm_parse_dhmmbedtls_pem_initmbedtls_pem_freembedtls_pem_read_buffermbedtls_dhm_parse_dhmfilefseekftellstrstrmbedtls_ecdh_can_dombedtls_ecdh_gen_publicmbedtls_ecp_gen_privkeymbedtls_ecp_mul_restartablembedtls_ecdh_compute_sharedmbedtls_ecp_point_initmbedtls_ecp_point_freembedtls_ecp_is_zerombedtls_ecdh_get_grp_idmbedtls_ecdh_initmbedtls_ecdh_setupmbedtls_ecp_group_initmbedtls_ecp_group_loadmbedtls_ecdh_freembedtls_ecp_group_freembedtls_ecdh_make_paramsmbedtls_ecp_tls_write_groupmbedtls_ecp_tls_write_pointmbedtls_ecdh_read_paramsmbedtls_ecp_tls_read_group_idmbedtls_ecp_tls_read_pointmbedtls_ecdh_get_paramsmbedtls_ecp_copymbedtls_ecdh_make_publicmbedtls_ecdh_read_publicmbedtls_ecdh_calc_secretmbedtls_ecp_get_typembedtls_ecdsa_can_dombedtls_ecdsa_sign_restartablembedtls_ecdsa_signmbedtls_ecdsa_sign_det_restartablembedtls_md_info_from_typembedtls_hmac_drbg_initmbedtls_hmac_drbg_freembedtls_hmac_drbg_seed_bufmbedtls_hmac_drbg_randommbedtls_ecdsa_sign_det_extmbedtls_ecdsa_verify_restartablembedtls_ecp_muladd_restartablembedtls_ecdsa_verifymbedtls_ecdsa_write_signature_restartablembedtls_ecdsa_write_signaturembedtls_ecdsa_read_signature_restartablembedtls_ecdsa_read_signaturembedtls_ecdsa_genkeymbedtls_ecp_gen_keypairmbedtls_ecdsa_initmbedtls_ecp_keypair_initmbedtls_ecdsa_freembedtls_ecp_keypair_freembedtls_ecdsa_from_keypairmbedtls_ecp_group_copymbedtls_ecp_point_write_binarymbedtls_mdmbedtls_md_get_sizembedtls_ecp_gen_keypair_basembedtls_ecp_muladdmbedtls_ecp_mulmbedtls_ecp_point_cmpmbedtls_ecjpake_initmbedtls_ecjpake_freembedtls_ecjpake_setupmbedtls_ecjpake_set_point_formatmbedtls_ecjpake_checkmbedtls_ecjpake_read_round_onembedtls_ecjpake_write_round_onembedtls_ecjpake_read_round_twombedtls_ecp_tls_read_groupmbedtls_ecjpake_write_round_twombedtls_ecjpake_derive_secretmbedtls_ecjpake_write_shared_keymbedtls_ecp_curve_listmbedtls_ecp_grp_id_listmbedtls_ecp_curve_info_from_grp_idmbedtls_ecp_curve_info_from_tls_idmbedtls_ecp_curve_info_from_namembedtls_ecp_set_zerombedtls_ecp_point_read_stringmbedtls_ecp_point_read_binarymbedtls_ecp_check_pubkeymbedtls_ecp_check_privkeymbedtls_ecp_gen_keymbedtls_ecp_set_public_keymbedtls_ecp_read_keymbedtls_ecp_write_keymbedtls_ecp_write_key_extmbedtls_ecp_write_public_keymbedtls_ecp_check_pub_privmbedtls_ecp_keypair_calc_publicmbedtls_ecp_keypair_get_group_idmbedtls_ecp_exportmbedtls_md_setupmbedtls_md_startsmbedtls_md_updatembedtls_entropy_freembedtls_md_freembedtls_entropy_add_sourcembedtls_entropy_initmbedtls_md_initmbedtls_platform_entropy_pollmbedtls_entropy_update_manualmbedtls_entropy_gathermbedtls_entropy_funcmbedtls_md_finishmbedtls_entropy_write_seed_filembedtls_entropy_update_seed_filembedtls_platform_dev_randommbedtls_high_level_strerrmbedtls_low_level_strerrmbedtls_strerrorsnprintfmbedtls_hkdf_extractmbedtls_md_hmacmbedtls_hkdf_expandmbedtls_md_hmac_startsmbedtls_md_hmac_updatembedtls_md_hmac_finishmbedtls_hkdfmbedtls_hmac_drbg_updatembedtls_md_hmac_resetmbedtls_hmac_drbg_reseedmbedtls_hmac_drbg_seedmbedtls_hmac_drbg_set_prediction_resistancembedtls_hmac_drbg_set_entropy_lenmbedtls_hmac_drbg_set_reseed_intervalmbedtls_hmac_drbg_random_with_addmbedtls_hmac_drbg_write_seed_filembedtls_hmac_drbg_update_seed_filembedtls_lms_error_from_psambedtls_lmots_public_initmbedtls_lmots_public_freembedtls_lmots_import_public_keymbedtls_lmots_export_public_keymbedtls_lmots_calculate_public_key_candidatepsa_status_to_mbedtlspsa_generic_status_to_mbedtlspsa_to_lms_errorsmbedtls_lmots_verifymbedtls_lms_public_initmbedtls_lms_public_freembedtls_lms_import_public_keymbedtls_lms_export_public_keymbedtls_lms_verifymbedtls_sha512_freembedtls_sha3_freembedtls_sha256_freembedtls_sha1_freembedtls_md5_freembedtls_md_clonembedtls_sha256_clonembedtls_sha512_clonembedtls_sha3_clonembedtls_sha1_clonembedtls_md5_clonembedtls_sha512_initmbedtls_sha256_initmbedtls_sha3_initmbedtls_md5_initmbedtls_sha1_initmbedtls_md5_startsmbedtls_sha1_startsmbedtls_sha256_startsmbedtls_sha512_startsmbedtls_sha3_startsmbedtls_sha512_updatembedtls_sha256_updatembedtls_sha3_updatembedtls_sha1_updatembedtls_md5_updatembedtls_sha512_finishmbedtls_sha256_finishmbedtls_sha3_finishmbedtls_sha1_finishmbedtls_md5_finishmbedtls_sha3mbedtls_md5mbedtls_sha1mbedtls_sha256mbedtls_sha512mbedtls_md_get_typembedtls_md_error_from_psapsa_to_md_errorsmbedtls_md_listmbedtls_md_info_from_stringmbedtls_md_get_namembedtls_md_info_from_ctxmbedtls_md_filembedtls_internal_md5_processmbedtls_oid_get_attr_short_namembedtls_oid_get_x509_ext_typembedtls_oid_get_extended_key_usagembedtls_oid_get_certificate_policiesmbedtls_oid_get_sig_alg_descmbedtls_oid_get_sig_algmbedtls_oid_get_oid_by_sig_algmbedtls_oid_get_pk_algmbedtls_oid_get_oid_by_pk_algmbedtls_oid_get_ec_grpmbedtls_oid_get_oid_by_ec_grpmbedtls_oid_get_ec_grp_algidmbedtls_oid_get_oid_by_ec_grp_algidmbedtls_oid_get_cipher_algmbedtls_oid_get_md_algmbedtls_oid_get_oid_by_mdmbedtls_oid_get_md_hmacmbedtls_oid_get_pkcs12_pbe_algmbedtls_oid_get_numeric_stringmbedtls_oid_from_numeric_stringmbedtls_pem_write_buffermbedtls_pk_initmbedtls_pk_freembedtls_pk_info_from_typembedtls_eckey_infombedtls_ecdsa_infombedtls_eckeydh_infombedtls_rsa_infombedtls_pk_setupmbedtls_pk_setup_rsa_altmbedtls_rsa_alt_infombedtls_pk_can_dombedtls_pk_verify_restartablembedtls_pk_verifymbedtls_pk_sign_restartablembedtls_pk_signmbedtls_pk_decryptmbedtls_pk_encryptmbedtls_pk_check_pairmbedtls_pk_get_bitlenmbedtls_pk_debugmbedtls_pk_get_namembedtls_pk_get_typepsa_get_key_attributespsa_export_keymbedtls_ecc_group_from_psambedtls_pk_ecc_set_groupmbedtls_pk_ecc_set_pubkeypsa_export_public_keypsa_reset_key_attributesmbedtls_rsa_parse_pubkeymbedtls_rsa_set_paddingpsa_pk_status_to_mbedtlsmbedtls_rsa_parse_keymbedtls_pk_ecc_set_keymbedtls_pk_ecc_set_pubkey_from_prvmbedtls_psa_get_randommbedtls_pk_copy_from_psambedtls_pk_copy_public_from_psambedtls_pk_sign_extmbedtls_rsa_rsassa_pss_sign_no_mode_checkmbedtls_pk_get_psa_attributesmbedtls_rsa_check_privkeymbedtls_rsa_get_padding_modembedtls_ecc_group_to_psambedtls_rsa_get_md_algmbedtls_rsa_write_pubkeypsa_import_keymbedtls_pk_import_into_psambedtls_rsa_write_keymbedtls_pk_verify_extmbedtls_rsa_rsassa_pss_verify_extmbedtls_rsa_freembedtls_rsa_initmbedtls_rsa_check_pub_privmbedtls_rsa_get_lenmbedtls_rsa_pkcs1_encryptmbedtls_rsa_pkcs1_decryptmbedtls_rsa_pkcs1_signmbedtls_rsa_pkcs1_verifymbedtls_rsa_get_bitlenmbedtls_pkcs12_derivationmbedtls_pkcs12_pbe_extmbedtls_pkcs12_pbembedtls_pkcs5_pbkdf2_hmacmbedtls_pkcs5_pbkdf2_hmac_extmbedtls_pkcs5_pbes2_extmbedtls_pkcs5_pbes2mbedtls_pk_parse_subpubkeymbedtls_pk_parse_keymbedtls_pk_parse_public_keymbedtls_pk_load_filembedtls_pk_parse_keyfilembedtls_pk_parse_public_keyfilembedtls_pk_write_pubkeymbedtls_pk_write_pubkey_dermbedtls_pk_write_key_dermbedtls_pk_write_pubkey_pemmbedtls_pk_write_key_pemmbedtls_platform_gmtime_r__gmtime64_rmbedtls_ms_time__clock_gettime64__time64mbedtls_poly1305_macmbedtls_threading_psa_rngdata_mutexmbedtls_threading_psa_globaldata_mutexmbedtls_psa_pake_setupmbedtls_threading_key_slot_mutexpsa_save_persistent_keypsa_validate_key_locationpsa_validate_key_persistencepsa_is_valid_key_idpsa_reserve_free_key_slotmbedtls_psa_mac_sign_setuppsa_unregister_read_under_mutexpsa_get_and_lock_key_slotmbedtls_psa_mac_computepsa_can_do_hashpsa_can_do_ciphermbedtls_to_psa_errorpsa_validate_unstructured_key_bit_sizepsa_allocate_buffer_to_slotpsa_copy_key_material_into_slotpsa_import_key_into_slotmbedtls_psa_rsa_import_keymbedtls_psa_ffdh_import_keymbedtls_psa_ecp_import_keypsa_remove_key_data_from_memorypsa_wipe_key_slotpsa_free_key_slotpsa_destroy_keypsa_unregister_readpsa_destroy_persistent_keypsa_export_key_internalpsa_export_public_key_internalmbedtls_psa_ffdh_export_public_keymbedtls_psa_ecp_export_public_keymbedtls_psa_rsa_export_public_keypsa_copy_keypsa_driver_wrapper_get_key_buffer_sizembedtls_psa_hash_abortmbedtls_psa_hash_setupmbedtls_psa_hash_clonembedtls_psa_mac_abortmbedtls_psa_mac_verify_setuppsa_sign_hash_builtinmbedtls_psa_ecdsa_sign_hashmbedtls_psa_rsa_sign_hashpsa_sign_message_builtinmbedtls_psa_hash_computepsa_verify_hash_builtinmbedtls_psa_ecdsa_verify_hashmbedtls_psa_rsa_verify_hashpsa_verify_message_builtinpsa_interruptible_get_max_opsmbedtls_psa_interruptible_set_max_opsmbedtls_psa_sign_hash_get_num_opsmbedtls_psa_verify_hash_get_num_opsmbedtls_psa_sign_hash_startmbedtls_psa_sign_hash_completembedtls_psa_sign_hash_abortmbedtls_psa_verify_hash_startmbedtls_psa_verify_hash_completembedtls_psa_verify_hash_abortmbedtls_psa_cipher_abortmbedtls_psa_cipher_decrypt_setupmbedtls_psa_cipher_encrypt_setupmbedtls_psa_aead_abortmbedtls_psa_aead_encrypt_setupmbedtls_psa_aead_decrypt_setupmbedtls_psa_aead_set_noncembedtls_psa_aead_set_lengthspsa_key_derivation_abortpsa_key_derivation_get_capacitypsa_key_derivation_set_capacitypsa_custom_key_parameters_are_defaultpsa_key_derivation_setuppsa_key_derivation_input_integerpsa_key_agreement_raw_builtinmbedtls_psa_key_agreement_ecdhmbedtls_psa_ffdh_key_agreementpsa_random_reseedpsa_random_depletepsa_random_set_prediction_resistancepsa_generate_key_internalmbedtls_psa_ffdh_generate_keypsa_random_internal_generatembedtls_psa_ecp_generate_keymbedtls_psa_rsa_generate_keypsa_generate_key_custompsa_generate_key_extpsa_generate_keymbedtls_psa_crypto_configure_entropy_sourcesmbedtls_psa_crypto_freepsa_wipe_all_key_slotspsa_random_internal_freepsa_crypto_initpsa_initialize_key_slotspsa_random_internal_initpsa_random_internal_seedpsa_crypto_driver_pake_get_password_lenpsa_crypto_driver_pake_get_passwordpsa_crypto_driver_pake_get_user_lenpsa_crypto_driver_pake_get_userpsa_crypto_driver_pake_get_peer_lenpsa_crypto_driver_pake_get_peerpsa_crypto_driver_pake_get_cipher_suitembedtls_psa_pake_abortpsa_pake_set_password_keypsa_pake_set_rolepsa_crypto_local_input_allocpsa_crypto_local_input_freembedtls_psa_hash_updatepsa_hash_verifymbedtls_psa_hash_finishpsa_hash_comparembedtls_psa_mac_updatembedtls_psa_mac_verify_finishpsa_mac_verifypsa_verify_messagepsa_verify_hashmbedtls_psa_cipher_set_ivmbedtls_psa_aead_update_adpsa_pake_set_userpsa_pake_set_peermbedtls_psa_pake_inputpsa_crypto_local_output_allocpsa_crypto_local_output_freepsa_driver_wrapper_export_public_keymbedtls_psa_mac_sign_finishpsa_key_derivation_input_bytesmbedtls_psa_pake_get_implicit_keypsa_key_derivation_input_keypsa_key_derivation_key_agreementpsa_sign_messagepsa_sign_hashmbedtls_psa_asymmetric_encryptmbedtls_psa_asymmetric_decryptpsa_cipher_generate_ivmbedtls_psa_cipher_updatembedtls_psa_cipher_finishmbedtls_psa_cipher_encryptmbedtls_psa_cipher_decryptmbedtls_psa_aead_encryptmbedtls_psa_aead_decryptpsa_aead_generate_noncembedtls_psa_aead_updatembedtls_psa_aead_finishpsa_aead_verifypsa_key_derivation_output_bytespsa_key_derivation_output_key_custompsa_key_derivation_output_key_extpsa_key_derivation_output_keypsa_raw_key_agreementpsa_generate_randommbedtls_psa_pake_outputmbedtls_cipher_values_from_psambedtls_cipher_info_from_psapsa_driver_wrapper_get_builtin_keymbedtls_psa_ecp_load_representationmbedtls_psa_ecp_export_keymbedtls_psa_ecp_load_public_partmbedtls_psa_rsa_load_representationmbedtls_rsa_exportmbedtls_psa_rsa_export_keymbedtls_rsa_gen_keymbedtls_rsa_rsassa_pss_signmbedtls_rsa_rsaes_oaep_encryptmbedtls_rsa_rsaes_oaep_decryptgetpidpsa_load_persistent_keypsa_free_persistent_key_datapsa_open_keypsa_close_keypsa_purge_keymbedtls_psa_get_statspsa_is_key_present_in_storagepsa_its_get_infopsa_its_removepsa_format_key_data_for_storagepsa_parse_key_data_from_storagepsa_its_setpsa_its_getrenamembedtls_ecdsa_raw_to_dermbedtls_ecdsa_der_to_rawpsa_to_pk_rsa_errorspsa_to_ssl_errorsmbedtls_rsa_importmbedtls_rsa_import_rawmbedtls_rsa_completembedtls_rsa_deduce_primesmbedtls_rsa_deduce_private_exponentmbedtls_rsa_export_rawmbedtls_rsa_export_crtmbedtls_rsa_deduce_crtmbedtls_rsa_check_pubkeymbedtls_rsa_validate_paramsmbedtls_rsa_publicmbedtls_rsa_privatembedtls_rsa_rsaes_pkcs1_v15_encryptmbedtls_rsa_rsaes_pkcs1_v15_decryptmbedtls_rsa_rsassa_pss_sign_extmbedtls_rsa_rsassa_pkcs1_v15_signmbedtls_rsa_rsassa_pss_verifymbedtls_rsa_rsassa_pkcs1_v15_verifymbedtls_rsa_copymbedtls_rsa_validate_crtmbedtls_internal_sha1_processmbedtls_internal_sha256_processmbedtls_internal_sha512_processpthread_mutex_destroypthread_mutex_lockpthread_mutex_unlockpthread_mutex_initmbedtls_threading_readdir_mutexmbedtls_timing_get_timer__gettimeofday_time64__divdi3mbedtls_timing_set_delaymbedtls_timing_get_delaymbedtls_timing_get_final_delaylibgcc_s.so.1libc.solibmbedcrypto.so.16GLIBC_2.0Kii *KJJJJJJJJJJJKKKK K(K0K8K@KHKPKXK`KhKpKxKKKKKKKKKKKKKKKKKL L,L0L4L8L"4"*"$ǭ%%%%k%J%)%%c$ |@0A 4|80!E&(&F.&Ee"<"2"bX'%(%0%8%$B bLHD@<840,(P'L <)'!܉$ %(<)'!$ $<)'!'$$ ,(%%8%$'$5, $jb&@(B1&0%( % @!0&$$ $d$Md $ b ,($ %0'$jb@B1(9'$jb $($ $0'j$ ($&̋c$^:|0!Xk<|!b!Pjk!HiBJ)\ &KV &JJ &I&K&0&8&@& $ &,    $j%&̋c$:|0!x<|! d!xo!hm& ~؍& j & & &8&@&H(&0&! d0:| G$H(I,F!x!xo<|!hm&& z& l & &PD&Xj&`&(0J4K8L<E B$P%r,    j%&̋c$n:|0!hm<|! d!`l!Xkkl & f ͍& Z & & &0&8&@&H(&PI&(FG H$I(J,EB$P%B,<%'!',8'D@<4%% %%%(@0%0`% %@U@!C '!8% OX&E DCB9$ %p̋$v%jk%rJ%n)%%@$% %0$r0!!:b|!&H#c<} <|!ȹ@! 8&PC!@c!8&(9&&&&6&U&(Y& 1& k%&t&P&(V & s&@!S r&i0S0H !H!!!0:|:x|0<|<|7u4!!!ȹ!:|@X8SQ!X!8:I|!xP!p$A'0'+%%!f+G$(b&&C v+ s&@$I@+0@(D@"$ #"$"# " .u + .@+@+^*@    @%8%0$IHC] B@,Dclhd`\XTPLHp'%L 4<'!'Ìb,(4H0,$ ]@%L%%V`%$#C%#@P+ H @DLP!P! c!(!8CB$&f$$!+0@@%8`%0 $% -@" "|"B$|##@ #"&E$CC|#c$ |$$D`D"%%E$CC|#c$ |$$D`D%$!CB0%40,($ 8'%$< '!'$(b ,%%%@%$ $%@@ brtq%,($ 0'%`$#8$C D| i0C$B¬#(+(%#%c,`*8'J$#%!8C%@%h%Hc$¬g!I$$HC!D$&%(@P% %@@"!C$R"CDB$cf&"%(@% @4"cb!CR"40,($% 8'%@0,($% 8'$ $ % `4$$<'!''T,ଜ @$d` `,0'$$$#e%g'$f%CB0/$?$0$#d%f'$e%CB0%$0G0%$0C0z$i$#CZ$$#g%I%h''$e$F%CB0%$0f09$$#f%g'$e%CB0%$0f0+$$#f%g'$e%CB0%$0e0/$$#e%f'$d%CB$ |%%%f%@ @,( %@$0'eW% %@@B8#8#d%8?$%"'B$$d$G%CB$b%"'B$$ $C%Dfd%B$",( %@$0',%( %@$0'<'!'$ %%܉0 %($$" %('$%(%  ('$ %('<,'!',T@'%8 +,($<@%B&1@ !dB$*@fc$B$+ $% @ %@%@-@4+T@0!f3 %( % `( % 03%,($ 0'$+@!3b ,($ 0'$$<'!Y'$ ,(%@%B$*@ !dB$$@fc$&CP$+!@#%(u% @" %܉$"0 %(%,($ 0'&C$+@#$܉#00%( ! $E+ @!+@ !3 %0`%3 %'+`%'3+`$3C+8C$3+8$3C+E`'3B'+`$3%@$ ('%$$%8%0@ K('<'!'(0+9' $%!(C%%@$ ('%$$%8%0@ T('<'!%%8%0@<'!%%8%0@<'!'% $%!Q@+b `E0B+(!(% @4%0 %$ ('<'!@%'%0%(@% '5@0$!fB$@fc$$`(!(c$`$+(b+C`B$$`H!! cB$+(+d$+$`%$`0$!Fc$`FB$!$GB$ `#%`+@+0f@c$ $i! !(c$+0+ @$#$<ݜ'!',#%/4$$&' ' ,0'<,ݜ'!'($, % %%@%P$bBc$!C&,C`B$%(% `@,($ 0',($ %0'qĀF%8%( u% %@ @!#,bc$!B+R@b$b%+@&%(% `@c!q<ۜ'!'Д$ ,(%%%Œc$!C& C`B$E+@6$E% %@/@C+@Q$E! !(#p+6@0+@!3 C&+f @܉$#00%( ! ȀfE$5%8%0@ @$",$ %(0'%'̀!(#8% @$$!3 <ٜ'!'„Qp ,($Gp@%Ѐ!@,Q,($ 0'Ԁ%% `%(k%%@ @؀%0%(`e% @@,$%0`%([% @@,#Q($ 0'<؜'!(9'$<؜'!(9'$<؜'!',#%74$$܀&' ' ,0'<`؜'!',#%74$$&' ' ,0'<؜'!'䀙D 'TH@<8PL40%% %%('䀙% VS^TpIbc$!C&$C`B$%8 c$!C1&2 %(C`B$!(% @%@@耙%(% @%@ @쀙eD%0$B}% y% TLHD@<840%PX'%($$bCpB0B%(@% %@@T%%(@% %@@%<՜'!' (40,$%c$%%!C&4C`B$`&H% @%@@4,($ %08'40,$ % @耙(%()8'%( % @%@@&EDs& %84<Ԝ'!'$B,<840,($ @䀙%'%% %"@-$XC$ % $%@@<+B@B2+E~!(% `%@F@% <840,($% @'耙%(% `%@@f@!2&$+􀙏%0%(`!@% e%0%(% `@%@1&%@@NQ$&0C$D$ c,`,B$B,@$$$1&$耙%(% `%@@/@% R&$b((!E0E%C!@$R&!2E0$$ B,@f,$$B,@$$e% `<%840,($% @'$%% `@vy%z$<ќ'!'$ B,c Y@܉'%% $%(% % %0 $ % M@ %  $EC*@C$%+ @%0`bE0$ ,$B$+Q@c$%(  % @ c0  ',$,B$B$ d$!( $H  $!!}!@`H! ]E$%`%$$$L <М'!X'%%% %(%%A@䀙L'% T'% 䀙t'\'% @䀙d'% @䀙<B$Ԁ%( % @pl@A`耙%(% `%@ @(%(@% %@"@% %  $$ % %'%%'%(@% %@@%( % %@@E$$% XaP%@@耙%(R% %@@ER$%@@% B0$C#b0%(.% %@@%('% %@@RZ#C @$(%(@% %@@ \!^Cc$C%@y@%(% %0%(A% (#% %@h@ $B$c$8+b@(?< c4b$!$l'!#D(48 , ,TL!E!F$% @e! < \@!g+DH@$ȉ %8B`$b8$kC<ClCDcC<cC$F$ F4!Ced,􀙏!C\E !bFO% %(@\ !d$@f$耙$F%( @(`T%($$]0%@􀙏'%(@ $q%(@@%(^% @%(,% @8(B$8+b c$@ x@%%(@$K@܀%(1% @\ !CCc$C `% `@B#Cpb0Q% @B%(% P@%(% @$¦<ɜ'!',#%?4$$ &' '( ,0'<Ȝ'!' $%%% %(%9@ %0@%8 %( % %@@ $"@%(% %0 %(܀@% @%( D% %0 %(A% $%@ ('$%@%@ ('$ p'V*!p!h!`!x&0&(&l&OB6&B.%B#B"!!!Y! &P &H&@(&8T*L)D(<'!`L!x/!p!h&(&&&0-%#"5&!!!"! &PP&H?&@&8V*N)F(>'!`!x!p!h&(&o&N&0k%B.%B#B"`B6&% ! !0 $!($ (!($,!,(0!p0,4840<!h 4! !8!!!` !!i!H!XgTtx'P<@DHLX\`dhlp% edEEDeD E dED Dc$dB$$%  @$|x'<\'!'$@$ %@&$ @$@$ '<'!$ $paJ%(%@@ȁ%0 %(% `%@@L '!'\dB`XTL %LBbd`\X%Th't'%(9'|% `%@@t%(`\9'% %@$0${% `L <='!t9'%8<='!'Ly@b%PHD<T@$ $(,048%% %8`< $$@%@0$' & @th%8 %(9'% <cTPLHD@X'A0b,@%c$B$L <<'!p'C,p%|xtlhd@,@%$'*C$%%(  $(@,q@x% %@Z@I@tT' &&$ |"B$|#@ %CC|#c$ |$$D`D C$%`CC|#c$ |$$D`D@%8%0$'% %@$@C.%+4@ C!3+J@+@ !+"C@% %0`%( #S!3@t%(\9'% %@@B$$@$z% dB#b|xplh%`t't(9'n% %@@t%(\9's% %@@$$$L 4<9'!'Y0@$,($ 4%% % %%@ @40,($% 8'%8%0`%(@% !% y %@@4$<8'!'%0,C(40$%T$%  /@x% @%( %@'% $%(`%@@$$jz% `p % Bb40,$% (8'X%8$$ % `$C$$L <7'!',(%B0<84$%X$%  #@x% @%( %@'%8$$ % %8$$' %@6@̉$$z% p % $B1b<840,(%$@' % @p % %0%(% `$% $y%@%( U% `%@$$y% % p $L <6'!܉$ %(<5'!$y$<5'!܉$ %(<5'!$y$<5'!$c$$B!bB&H0&%(C% @% ?%(%@@% L&HD@<840,%(P'87&$t% h@d%8`%0 $@% %@@T$%(% %@@L@3&%8 %0%(`% %@@\0"&%8 %0%(`% `%@@`%0%(% %@@%0 %(u% %@@\0"&(5&%8 %0%(c% %@@`%0`%(% %@@%0 %(Y% %@@`% %0@%(@d% B% B%@cL&`%0%(g% %@z@%0 %(6% %@r@`@3&%0`%(`V% `%@i@%0 %(`%% `%@a@`耙87&$'% %@W@耙@3&$% `%@O@`*$<'!5'%H$@&8&0&(& &&&&% % $P$Rp '<'!'P<' TL\XH%h% @R%h@ %(`H0'0$,'% 0!@ P$T% @F G%!(b@Hh'%8`\$x$R% @%@=@ @<h!(b0,Ă!b%0 %(`% @ Ă&&%(`% @ 0+S䀙4'r%  % %0Ă%(` % k%@  0S% @~T$ ȂY% \XTPL%H`'$lT% @ gT% @%&aT%\h!(b< '!'%X$$,( % % `N@8$%(% @ %@H % %@$B"8%0%( % 4&%( $%@9@% @%8%0  $% !"p !Q% @l$ @ "%0̂%(@+% `%(% @o%@,($ %0' %(xo% @$p % $p % $$< '!'Ђ,%P 840<%%0%f% @ PԂg&%0@%( % `<840,@'&'&%0@%(q% %@@ t%8%0%(% %@ <'!h'|tb +"xp`%%%%%0`#8"% @%@@ |xt%p'@ ؂@' %  X'% @؂ , 0'䀙Ӿ%  8'(䀙;% @g+'e@ #8'%0`%(N% @%@@ b+Q `E$+%`eB#%+" $@%@$܂ %  ܂ , %  (|xt%p'L%0@`% %@@ bt!Qb(%8%0%(@9'2% %@@ %0 ,p%( % @%@@ x%((% %@@ $p$n$ &䀙<&䀙8&&䀙1 '<'!-'삙% $܂p l&܂l &܂h &܂d &܂` && && '<'!',$ *@ d%% %5%$@肙%(@&%@ @|% $ % ('L<8&%@@$ % ('$$,@h%$ @@@%$$<'!d%#C' Nc$!C8tLDWh<%$PH@4$! $,'dR&0 T%%8%0%(,%@m% ` @&TPLHD@<840X'%8%0%(%@U% `@,#T$@l&&%8%0%( % `@0#@%0%(% `@tLD(!B<8$ %8%0%(`%%H@Ht#qplhd`\XTPx'$<ߜ'!0'䂙H' ,%% %% 0'% `؂& &t&l&%(`9'% %@+@ d`,'%0@%(z% %@ @ Hb$d%#C Nc$!CtCh&!%8`d9']%(%@@ ,R삙%  ܂% `% '$< ޜ'!X'؂P'@0%% `%%<%0h'% ؂6H'0% 䀙3&0l&t&&%(`9'(% %@@0܂t% `0܂p% 0% % 't8&&&$9'@% %@@0t%8`%0%(% %@@0d! V$3b<%@<+v=@h#vD'%(% %@@0d Nc$!CD!<htB( @'$%8`%(9'@%@@0@#R+ @􂙏%8%0@D'% %@@0D!V@$`%0%(% %@@%( % %@@"`^$%0%(% %@@%( % %@@ ٸ$%@@$ Ѹ$%@@$耙$$%@y@1&vs&&,`~&%0`%(ż% %@k@%( % %@d@&`$%(% `%@[@%( % `%@T@"`^$%0%(% %@J@%(% %@@@K$'D$$ b%X$\@%%܂! \1&+"X@R& $ % $`$[('k $g&܂&_4&[&<'!'삙%G`&h&܂ '<'!' $%%@$ ('%&&@$%&& ('<,'!肙<'!'耙$%@ '耙$&@&耙%(  '<'!'(<P840,$ @$%%% `%(%%@@&%(% *@$% @`%0`%(`% @t%(@p&%Ƞ%  @`&%0`%(% +@%(@<840,($ @'<840,($ %(% `@'<80,($ %(% 4Q@'%Ƞv% @`%0%(% @<%(@%Ƞi% @`&%(% @<%(@%Ƞ\% @%0%(c% @ W&1%0%(܀ @% N@%(@% &%0%(H% @ W&%0%(܀ @% 3@ %(@% %(% @%(% @t%8%0%( % @09'<840,($  @'c$`7&%0%(`B% \@<%(@%Ƞ% U@`&%0%(4% `N@<%(@%Ƞ% `G@t&&%8%0`%(%Ƞ?% @=@<%8%0`%(`%Ƞ7% @4@%(`f% .@t%( 9'7% @(@<%8%0%( %Ƞ"% @@t%8| &%0 %( %% @@<%8%0 %( %% @@<%8 %0`%(`%% @@<%8%0`%(`%Ƞ% @@<%8%0%(%Ƞ% @@%8%0`%&% @%<840,($ % @'<'!@'4,B<䀙T'@(%% `%%ql'% @䀙k$4&%(@% $C$@%(% %(% `ڳ%@%@@$TP% `4BIb%'%( $%01% %@ @$.D%0@%( % `%@@% ܉F&',%(% L -@8%00%@%( K% `%C&!20&B$B0!H% 8%8H&'B0#($(%&0e$ $eBB%F8I% $% % `؂% `䀙% ۱&!],B(t%(D Q$% r% %@@<A䀙L'ű% @%8&$c% %@X@% $%܂% `$% 1&7\4tD%(h 9' % %@R@4Bbt%(% 9''t!0T$t#^$B,(%(`% % @$%8`%0%(%|% R& @$%0%(%Ȁ% @%@&`%(@%00% @%@ @Y% $S%t0pY$%(98%@@&`%(@%00r% @%@@08 %(%@@`%0%(c% %@@8%( % %@@`%0%(T% %@@8%( % %@@0`%0E%(%@@08 %(%  %@$|tO%M$L <'! '(%%%%$C(% @$(CC$% '؂|'% @4(l'8䀙İ% @'(%䀙% 1&'"(@$86%(`%@@(܂4(8(% &'( % @$C($E&d&\@(@^/@$'@$8P$TP $%@/@(8%@L!CX!؂% s&('|%䀙g% 1&'"(%(`&% %@.@(r%e@<t0B$4<^$D@0D|E0B0@!b!((!!(`% `%@ @(4%8%0`%(` % @%@(@&0% &'( T@Pt 8@%8%0%(h)9'% @XC(w%@@LL8%!C!W܂% U&P( % (! ܂J% 4%(`%@A@(耙$% %@:@(耙&@%(% @%@1@(&B&(<%@%@(4<%(O% (%0%( ؀A% 䀙t'į% (<$b% %@>@(4`%0%(%@6@(t4pY$%(@P%@-@('`% @H%0Ҵ%(@%@#@(HP %(@(% %@$"( '@BD'D$C@D% (V04%0%% %@@(H@%0%@@(܀@%(d% %@@(܂%@@(<%( % (%0 %(؀A% @%(Q% %@@(܂(<%(܀ @% ;%@@(%(@% ܀H4.% %@@(܂v%@@(<%( % (%0 %(؀A% 'H4L% @%@@(i܂(L<܀ @%(%@[@(L@%(L`%02%(%@N@(LP %(@%@G@(`%0%(#% %@?@(P%(@ % %@8@(`%0%(% %@0@(P%(@ % %@)@(`%0%(% %@!@(P%(@ % %@@(`%0%(% %@@(P%(@ % %@ @(%0%(% %@@(܂(<%(܀ @% %@@(%(@% t@Y$%8 F&% @T%@@(t@T Y$%8`%0%(`% @X%@@(L4X%8 % @%@@(4T%8@%0@%(@ % @%@@(tLH%8| 9'_% @%@@(HT%8%( % @%@@(H8T%( % @%@@(@T%8`%0%(` % @%@@(4%0% %@@(H@%0%@D(B$ D܂E&% `(@@^/@XW$\B@$<'B4$@ $8XW\B/\B@//@$'@$8XBL܂$'B@8P$yTt@<'B4$@$8|'4\%0$@(!08!+(E$$t4Y$% @nd%@@(t$#c$H@`!bDs&!<V$ !H %@(&@s&D<#0b$%(`% @`8+C`@P@!b&!\$B$b\P4dF$ % @%@t@(X&!% &(j@$@$'8P$$T$'B@b8$'@8P$B$T|% $"($@L<%0%(% %@@(`%0%(% %@@(P%(@ % %@@(耙$k% %@(V$< '!'%($B, '<ԡ'!' $%%@%&& @%&&@$ ('$ $('!`# +#(!`4&%dc$' dCB$c$`CECB$c$`C0,#S$C(0$%  0'<|y'!'hb.|xtpld`\@u&Xc$$<c$2,'( B,$ %>@%2t0 R&+,"  $(@0!3B+P$@!F %(@ % &$b"܉0%( % @`'$'%0%(@% @@|xtplhd`\'3 $Ѐ%0@%( % @5&2 B,M@%3v0 s&+,"  $(@0!3b+p@ !f3 %(` % * .!"܉0%( % ``%0%(@ħ% @@Ѐ%0@%( s% |xtplhd`\'|xtplhd`\%'$$>$lB$x(y@v$v((@w$u$u(&@t$t$pB$($e((@&$^&(@'$%$%(@$$$$B$s!(@"$$(@$$0B$&V(@X$U$U(@T$U$B$q$q(@p$Up(h@n$Ro$B$f$f( @e$Fe(=@d$e$pB$|$|(@{$'{(@z${$B$;$;(@:$:(@9$:$ B$L$L(@D$D( @C$D$[tB$/$/(@.$.(@)$)$DB$"(@!$"$B$5(@4$4$~B$m(@l$l$m$B$S(#@Q$R$DTB$X(@W$W$'B$B(@A$A$B$s'(@&$l'$B$j(@$c$`B$Uw(@v$Nw$ܱB$b({@a$b$lB$XB$hB$B$LB$dB$B$r$Vr$Qq$B$$$~$B$0$J0$E/$vB$g$h$g$lXB$<$=$<$d8B$M$M$L$Z(B$|$\xB$.$R4B$;$RB$f$H̹B$K$fB$c$xB$($B$p$(B$8$rB$ $XpB$X$:B$3$rB$#$2|B$k$LܷB$x$LB$P$`B$m$JB$V$$HB$B$B$?$,B$S$.B$%$XB$$*B$$B$`$B$u$$B$B$B$ԸB$B$pB$B$ԲB$ȢB$B$B$B$dB$LB$pB$̵B$B$B$ԦB$B$B$B$B$B$PB$lB$HB$B$xB$B$XB$̶B$4B$B$B$B$B$B$B$B$B$`B$4B$B$B$B$ B$'!'P,%!T+t!F+8F<840($ r%%l% @Bl@1.$#+ x$%`!"!pDec$& DcB$!8$GP(T&#!+ P!H+b! ! D.P#@T$&%胖|&!u%`x%&0&H&&&%% @CB$&gC$"@%R&U%|s&!2 %x1&!4"c1&&C"s&%<840,($ @'% R&"@胙x%&H&&9' % P(T&+(h$<<'!'\x+FDd%`|XTPLH@<,048G@$D Ѭ+%%O@%HL!6+!+K`T+.F`$.%C@2E$胔#V+> ",'L&%8%0%(%ȀS% @!$HL!#>! Q+^!e+!C#.!^!~H)`L\ $$;% %<yd`\XTPLHD@h'#+Q@$PB0/@".H6@L胔,'L&胂x&B$H&$1&".R&@s&wt$|"B$|"wt%0%(%Ȁ% @@$%0%( % @".胙x&H&9'R% 胔,'L&wt%8 |"B$|"wt%0%(%Ȁ% @}@胙x&H&9'0% vW`.$W`$L < 9'!'H@8%L4PTH<lDB7B/%CPLH0Th,%%X`~&0H /6$X&+b@+!3 %0` % %%%C&@||||x&1"76$ (%','%Fdc$&0FgB$A@胙 `% !0#$&C1&%,C8TPLHD@<840X'@胙x&H&% 9' /$ /B0@X&@+胙x&% 9'H&X&+@+@!3 H&9'% L <6'!'́%H,(40%%0`I%@40,(8'ЁPL% @ԁXT$'%0Z% @\܁`%8@% %0/%(40,(8'<5'!'􁙏Xd"`\<'0hTl%8%%0($ %(L @0L#lhd`\XTp'ȁ%0`%(@% @0$%(9% 0$L <4'!'ٰ%% $$k9 '@%0@%(? % %@6@􃙏%0@%(` % %@.@%(` % %@'@ B$B0+U!`  % %@@􃙏%0@%(` % %@@􃙏$%( % %@ @􃙏%( % %@@$@$7% dBb|xtpl%h'$L <,'!@'P%%%%%@!TB#.M`!QB,J@܉'$%( % \`%0 %(@@ `P\`B0 !(7@PB!@ ! %0%(;% %@@L$%(C7%  b% '+ @!+D@!Q3 %0  %(@!3B $$L <+'!'$ ,(%$%%=%@d&Y  &h % %0@%(Y %  @,($ 0'h % % %0@܉ $,(%0@%(` $% 0'< *'!胙9'G%8<)'!',($ 40%$HL%%%5@d&Y  &hI % %0@%(%  %@#@܉%0 $ % P\ @`". @$1.  $$P胙40$ %0%(,(% $9'8'40,($ 8'PPTPXW@ %0`%( % @ #8%+% %j  #@􃙏%0%(  % @%(  % @+Q@!S+2@!3+B0@!S%0%(% @<840,($ @'%0%(% @<Lc$840,$ L(@'$4<8&'!'Y0d$,($ 4%% % %%@ @40,($% 8'%8%0`%(@% M% y %@@4$@'($%(`L% %@~@($L% %@v@"($%(% LD%@l@($%(% L@%@c@f(8,@1%(L% %@X@,%8 $%($T% %@O@% ?R&V?% %@@A($%(`oL% %@!@($e&gL% %@@($$^L% %@@f(8,@1&SL% %@@(%0%(KL% %@@f,8',L'@1%(S% %@@c$yb'%% $CB$#F! $B$('!C |DM(d$"b$ B,@܉$$$($%(`L% %@@($e& L% %@@($$L% %@@c$b@$%0(L'K% %@@f,88,H'@1S% %@@rL'F:@,0@1p +@+!+@+@! %(0$c$B04"$$(b4+@ 4%% L <@'!'T P"p\X%L)8@$$$b,#@<D0 $,'% @ $& % @@ L# \XTP`'$$L <<'!܉<$ %(< '!$1<$,L@<HC$8$E<@C$$+2`+0D$3IH GFG FH $+8C 8$3e i$hg fehg efHHGG FFc$E EiB$$8%$3C$+0b8$3E i$$<'!'$ $%KC%$+0L8K`|"$|#+ P.+`&3C$  HGG FFC C&8,+@@1!3  $b$"%$ ('$3+@!3 8$8$"$$<<'!`' |xC<8tf@$cb%$_b$Hb<DC%k@ ($%(I% %@6@ |("D$%(I% %@+@ ($$I% %@"@ (8,,@1I% %@@ (80,@1yI% %@ @ ,8(,@'@1 Q%  %@<%  $ $쉅 % @ $3b`$ s&bB2( $ &)@ $&8$!C%`@$!C B$!0(~,%`u@$ $$8L <8 '!$,@ B$!DB!\@%pB$hB$`B$XB$PB$HB$@B$8B$xB$B$  @<9`7CBB$C,0`tc$!b'B!\@H % 'L P $ 'T X$$< '!t'$ %%B$C, `c$!bB!\@%$$ ('$ $% @@\ @$ %('% $@$% $$ l$% @@` $ $% @@d $ X$% @@h $ \$% @@l $<'! @BB$C,`c$!bB!\@$pt x $x %(| $| %( $ $ $ $<'!@BB$C,`@c$!bB!\@   $ '!<&(^b%$$(!0&(!0!#!~@<&(@4$(!0&(!0!@E(!@^&<&0hQZ$$0!(e!(&0!04&!0<&(B4$(!!^&(!(+%!(/<&]B$$!!C&!>!D<&SB$$f!!H&e!b#!~<&5!@$E!@&^!H"!C<&@b4$@!0!0&@!@C(!@!<&0Hͥ4$0!(%!(&0!06&!07<&('$(!~!&(!(-%!(<& c$$!#!b&!>!ZE<&B$$f!!H&e!b#!~<&5$E!@!@&^!H"!C<&0b5$0!@H&0!@!(-%!(og<&0E%$0!@(!@&0!04&!0&@$H%*B9c$!!&@!b!Hq<"5!^&!@&b!@!(hm`K$!&0b!(%!(&0!0<4&p5!0&(^!@!@&(!((!&C!^<"$!C&!0!0&!9Х4!&0b!(%!(&0!0<7&5!0&(^!@!@&(!(@0<% 8$@P $'(r( h08s% &Fc$i$,@+50@+5@4+@$#+$#@t'+v@+@+q@P'聙(%8$%(î®%$%@P@+4@+8Y@+@<U@""#+@#+J@+@+E@Ϗ +P&B.#bR&%S@% LD%C$$j&% $$e&$HtBb|x%'$3P$@܉D %(T'$$L 4<'!܉D$ %(<'!'䃙0%,($ 4%%%($% Hc%,@%@B$B0 C$$!y% %(|%  @40,($ 8'40+8%0@,$%(`% ( p8'$$&P&" % @!P@B$Ld'%0@!"l'0+(+7T'8+5\',+44+6%$%<H(@,8@,@+@$#+$#@t'+@+@+@P'聙$%8$%(۝ @4@++@+@<@##""% 8$@P $'(r( h08s% &Fc$i$+@++@+@+@ŽÎB&0+R&+!S `%@L+R@(HD%OF0g$+Tj@$hB$+"`#&+Cn+Q@B$3"|" c>&##"+U`"!3 %  %0@.!4%@@@@&B$d,@@c$B$`@!P€$;b&.^`%0@$%@d'T' ܉%( % $$$%  $$$@tBKb|x%@'#p!+C@$%@H%@+@!3 R.@d'+@+5t'3"+5@"&3)( #")(# "P'聙$$%8 %(dhlp%@@0T'\ @!p@c$LL 4<<'!'%`TP$+8Xtplhd\L %`%(C,`C0`胙4'%8`<9'0%@g@ȁ$%(`E$0@c%$zf$C,`W0$vC胙4'%8`<9'0%@H@<'$ȁ$%(`$$0@c$8$|6#0%(&EB # #%% `#E' $D$(%EB##%ï%$Ą0$$$<@#8$! D0c@'$c2%o/%e`!VC,]`X@6%&܉%( % @ $$#0'$$#% `LWbtplh`\XTP%dx'%04'<'聙%8@$,'-$%@8@$4'+S@D'3b<+B4@`8$+rn+R`DL'3CDBCC$B$B#$$k"&$@6@@B$R&@@@@'R&&#&4'$L %%%8`@c$#(+(e,!G0G 1$ $#8b!(B$%@+8b1%!$<ۜ'!,'($ %,%(D$h]&&QE %0 @,$ c(0',($ $0'$<ڜ'!,'($ %,%,D$\&&QE %0 @,$ c(0',($ $0'$<$ڜ'!,'($ %,%0D$4\&&QE %0 @ ,$ c(0',($ $0'$<\ٜ'! $b$U$D$$D $DB@"$<840,($ $@'" $ $$|% $7 $ $n%$$$<$#<$<840,($ $@'AB4B0e% <B$ Be@$B$ B$$L$8r% <B0c$%C B".(@:".6@+$".@$<%2$$$^$\%f4<'!'X`b\TPLdD$(%%%%@$&.C,',0% B$B,N@0,4j%(AB43!$@$0D',,'$"P0<$'p4' @$%0@(@%8@h.% j% @Dcd`\XTPLh'$% D$4'%8('%(% @($%(L ,4<ԣ'!p'|xptl%%o%$C@$pB0eCe% @%@$)"1&1. CB ' $% UB$B,@$4pj'qB4XB$lxb|xp% t'p$bB&2!;&%( $%@`@CB! $ 'NQ$H'p%(%@ @@%8`#0E-% j% @%@%(% l4b胙t%0`%(|p% @x:9''f@L('%(  B$%0@% %@@@ %8`%(@-% i% @ % @$%@$% $L $4<Р'!'Dl %PLH@<84hptT%%%@%[X@%( d% U@ $"N`%8lhTPL@8%0DH%(@% <4PX'% %@$=" 5` W% C$+2` ('(v,#Q ,cbT%8%0#y%(@%@ @ 8% B$+VTPLHD@<4% 8X'% $$$$$<؞'!','($40%% @2%B$B,)@&% @B$B,&@B@4% @B$B,@B Q4,$%( % `(0肙 8'%0,($$8'4<'!''($,%%B$B,@X%8 %0@,($0'($B$0'4< '!'8t$$`$h$$('<Ĝ'!' h&%8$%0% ~%( @$ ('$%( %  ('$8,$<,'!xc$$F$c$B$ $B,<B<̛'!$hB$c$$B,8B,8B,' YD  ''84 0,($X <PT\`%% %C,`+!@%8 XTP<8,($ %04%(0 @'$<840,($ @'$'0, ($ 4HL%% %Q%8@H4, %0$0%(`( 8'40,($ $8'<'!'\x%%   '<`'!'$ $%@@`so% @% '<'!dtp<옜'!'h,840(P$ <T% X\%%o%+TP<0($%8 %0 8%(% 4,ltt@'<840,($ $@'<'!'h(840,$ <% `PTX\%%Xo%PXTP<8$ %8%040%(% `,(pu@'<840,($ $@'<'!'h(840,$X <T% P\`%%o%+XTP<8,$ %8 %04%(% 0(tv@'<840,($ $@'<'!'h480,(T$<% %%n%%@+B@Px%8`%0%( w% @+ <840,($@'$$@ +>=@ $%8%0 %(%@@ %(  % @ L,btplhd\XTP%`x'thm% %@+@ x% %8 $w%(%@@ +~$$$$$L <'!'( ,$%% %!+S#@ %0 %(@ #% `+%+@ +D@!Q+@ %0 %(@# !,($ 0'4<䐜'!P'܉4B'% %%%($% ` %.t@A.q@A.o@6`@+$ h% @%@!B,@$܉'0%0 % @($ @D'胂$NB$, # %@@8'% %0%(`c% x@.@0 %0'@(@$ @̃'%0%(@̃%(@@B,W@$d&Rd%8@%0%(@2% `@''$$$% $$%  $$@$$% @4Bb%' )h`% @%@!B,@܉'0@$ % @@$$o(''H%++2@ !3+B@+Q@Ab.!S+"@Ab.@ % %0`%(@ #!3F  ,%8%0@ %( &!CbB$B0@bc$!@(@ $<@ '!(V!%dc$! !b$:B|, '!(V!%dc$! !b$:B|$'%0@%(7@Z'@$%'Y'@胙%8%0@%(N9''$($@` $胙%8%0`%(N9'p'$$6@$/''܉0% @+$ $$(" uh% @%@!B, @܉'0@$ % @M܉'0$ % @$$(@$($L 4@+;@! %0` %(#s!S%,'bB$B0@bc$@􃙏$@$! % @$$ % @Bb%'%@+B@,4+b@ 4L <'!胙Z9''<'!' HD@L<8%%C%,@ ,'% j%@ %($ % %@@ l胙h%8d%0``%(@Z9'%  %@Z% LHD@<%8P'$<'!',$H,X 00$$0@P4(  8<D!#T@'%%%L'd'%(  % f@ P $bT $ $@ lhdXW!HX'$t'%( % @ P$@|' b40,($ %8'Xt!bX8'%(%  x@ X <'%( % @ $CX|'4%0@%( % @ 4XD'@ XT$|'4T4%0%(  % @ P$H'% @ 0H%@@ B|C|$u<@C|$<@$TL+C@$x'^% '+ @!3+@ !3 !,% L '4< 8xtD%0%(`%@@ |%( a% %@@ 5% b CLB0b@L!D#CT+b@xS$<p4%8@0j% %@@ %(% %@@ 0L,%(݆% %@@ $0$.$L )$<|'!'4' $XT<P(4<@'<|'!'T8'40,<%%0` %%@ @Q$<84,% 0@'%(@N% `$C@$Cb<$C@@<$P% `@$B$<{'!'$ b%䂙('%% @'!S '%0 %(`%   3@B$B,A@H$'0$%0%(` % %@@ $H!$%0%( % %@@$$b $$ % @Ă,'&%0%(%   @P$P$,'D'4'<'\'v䂙c% %@B@F삙bB@s&삙% e肙% %@@dbhb' % @' % @' % @' % @ '@' T'@@%( L'%('@ %@삙i% b@$ %  %  %  % ܂9-$,'D'4'<'\' %  %  %  % ܂ %'$'@$섙3% @ %@%'삙% b$ %  adH0$%0%(` % %@@ $H!b$%0%( % 4'7@L$ % 0@ $H!C$%0%(%   <'1@L$ % *@ $H!C$%0%(%   k@ $H$%0%(` % $@P$D'\'P$D'<'\'D','4'<'$c\'P$D'\'o$4'<'D'$U\'S$D'$ %(&@$C BB$B0B,@` % %0@$$b L$ % @ 耙L'E $@耙$ T'@ $Ă!C\'%0%(`%   @P$ $!C % h<'T@ (yn,%@@ȅq% @Y%`T$U$% Q$O$% $% @!Q3 $C% b@,%8@ $,$"% %@/@ W^$hWlb@,%8@L$h$ % %@1@ TW$b@,%8@$$% %@,@ B^l$ %(@䄙 % %@^@ 胙@<l9'% %@V@ Qȅ胙@<n9'% %@H@ Cȅ胙@<%8,r9'X% %@6@ 1ȅ$gH$shH$Lh%H@ |J$u* J$j$B$p"<$8<<;$8G&ī|4@<$8<'!B$B,,@'$ % %$%$ ('$% %(% @@+R @!+D@!Q3 %0  %(@ 3B w$s$<>'!'$ $%%%$ $腙y$$ ('@w$$"%$ ('$Db$$"%$%(@ %09'('$ %(% @0@"+R%@!+D@!P3 %0 %(@$0"$ %(% @@"+R@!+D@ !P3 %0 %(@$0"3B 3B w$s$% %@@(@pĎ܉#0D!$ ! D((G4%@y$<,'!'ЉY  ЉhPY 2% '<|,'!'ЉY  ЉhPY 2% '<,'!#b0@@$>D@e0O# `c0`$#bB,@$,@ B$!DB!\@$nĂ(@(D@}%$z(@$$(F@$q(@$P(@${$`l$H(y@$$(@$9$Nm$l$KClC(b`T$p$CpC(`n$>Ci$$=ǂ(@$ Ƃ(@$$,z$$(o@$(@$ $y${$j$>C(`=$# $(<B$$b@ c0`$|$v$k$TC(|`j$#bC,`$CTd0$Dc0`s$n$Cw$‚(@$‚(@$(_@$9|$Ă(@$$$${$(@$$$$C$$o$}(@$(@$r$\$$T}Q$zC`$Js$Xn#$'#,@ $,@,@)$B0@0y$$$%1|$b$%$$z$%9|@$b$y$<'!'%8P('L%`$% D%%(`TH%8`JIH F eB$ c$JIH F%8`eB$ec,EC'@ .C$%@ @1$@(% C{$(hY d% hY (CTPLD% HX'@by$@Cy$腙 4%0%(% 9'(8%(% %`@.@0.腙$m ''% `04(9'8%@@bz$,@hl$'./% `%@@4$p%@@y$y$0y$($|% %@@腙(9'%(@%@@(aC%@<'!@'$ C%p45$ '%w$<<'!'$  @%<$<C%܉$$%( % @%( tH5% @%@@% $ % ('y$w$$$ % ('@<$"<C,y$% (?$D@<40,%`8H'$'?>%(%@@腙%0 %(X9'{% %@@@%@B$" $܉@Ć%(`0C<%0 B|g$c$#4%@<@c$B0<'!腙9'f$<'!腙9'_%8@<c$-%@<B$!c~D@<840(% ,H'(=% w$І_% D@<840(% ,H'(=% y$$P<B$z$(=(=$$by$@Ԇ$<<'!腙%89'%0R$<'!腙%89'%0I%(<'!' $@%B0 @@<ī|d$Dc$%C<c$C $y$w$І% $ % ('y$$B؆"&%@@B~$ % ('$y$<'!'$,( `%B0@$#b܆$%"%%@@ Db~,($ % 0'w$І% ,($ % 0'y$<'!'<$C% <$ d<@<%$% 0$$%  ('c4$C<%C<$%0@$C$e8|$ %@$@|e $)D$ $& &%@ $(,04w$@%w$@+E@w$y$%B,@y$腙0','(9'% %@ $@,(ЎN":@l$$p0cC% $`F%0@$k|φ0A$B$ p$ F,@$0$Cp$z$hY  d%  hY \XTPLHD@<%8`'4'&% %@ @,44% %@ @,(Ў7%(`% @$ގ, @,y$H ,%(% @@ y$,z$<%@ @,"p$<C%@$ C8|$A$C(@($4 (&% %8`%0%(@%@ @,腙(9'%(%@@ ,($4p$Cz$p$$(4 $wz$p$$`|4B($|!(;$4p$eCz$$ B,a@0@p$]p$$|4<'!'$%8$$('<'!'$%8%0$$('@%<$B < C%y$0% $ % ('<$bD܉d$%( &$("#'&%%C%HR&LPT$% w$z$<$'!'$$40,( b%w$0g% (740,$% (8','% %(@7%@@腙%0`@$X9'R% @%@@$"C$Cy$(2$ %(@% @)@$%+E @+!3 %0@(#%  4&#&GFE DB$ C&CB(% 7%@@!3 s$@`"9@"$B04C $"pD0IC0 $[C<%腙$9'5&@ $'%0%(@!p$%@@腙%0%(@9'=% %@@+@+V!3B+V@ !W3 %0%(@ % ww$ІF% p% 4* B\XTPLHD@%<`'$d $#P<$&bī|@ $$&dī|`% $+W@腙v$"c$&Cī|@ $+WL <'!'4%LH$'%D<TP@8%%0%(% @$(,04%@%@,'І% `8:% p% @TPLHD@< 8X'hh,'% %0@$%@@l0@v!bC0`B0 @$ b@b+T`#Tb$lh%0%( d&%@@b~bw$y$<'!'h%TL('% PHDd`\X@%%0%(`% @(,048<|7%$@ Q@%@%4'܉%0@!$ %  Іx%  pG%  % pB Bd`\XTPLHD @h'hx4'%0%(@ ,%@-@ 腙% R9'8%@@ "B0@$#b%8%0`%($& %@@c@܉!#C4'w$@І@%܉y$<'!x'hp%th@'% |ldx`%%0%(@% `\@DH8<% @ %@8'І%  p%  % 8D B\Nb |xtplhd%`'48'% %0D%@@ 腙`% 9'u8%@@ "B0@w$#$$b4'L'$,%8`%0@%(8$&%@@ 4bk$$,!$ ȁ,%0` % %@@ k$y$L <莜'!'Cu&`% ,$%0`% 솙y% @"@L",~bpLHD@84%@<P'<B$bXu& % %(\ % 솙X% @@L%@HD@84%@<P'z$y$<4y'!'腙0e9'%@$| 'X$%8`%0 %( 솙\% @@@HQA$$:B$B$By$脙z$ $B B.@$B $脙%@$9|C$By$脙A$b%`}$BB.@%@$D)|Cy$脙h2&%8`%0%(@ % 솙% @ @u%@$$pBy$脙%(@ % ms$<<\'!'p0@$4$P<80,('%h$% % %/@`%8%0%(%  솙% @%@@܉%0`%( % <840($%@,@'L%  %(<840,($솙% @@'t&`&%(%  솙% @%@@<@(dx%0 % @%@6@(xd%0!(P % `(% @ %@( % ` (TT 4( 4(솙r% \XTPLH`'쇙tp`$%0` %(@%@@( % @( % `( % @(% ` $(<4U'!'(h$$,% % @,($솙% @20't% &`& %( ,($솙% @!0'<$C<C<72%C@$ % tdb|%x'%$'$& %(%@@+P@+!S3+@ !3B b.%0`%(% @L $% U$솙% %@(%0%&% %@@( %(% %@@,@$%(i% %@@+V@+!S3+@ !3B Ab.%0`%(% @L w$L <;'!"@'<%(@c$ī|%<$C<C$$$&% ' $%܉$ %(w$<\:'! 'h`<%%0@c$ī|%<$C<eB0<%C %  % $:bD@<80,(b&4H'<'!'䀙0'D@<84,%% %% % '䀙 % @T$%( % @%0%( % @Z@$sC$CP$Xd@\`T$ %  % @D@<840%,H'$%(` % @X%0 % @@%0 %(@ % @@%( % @>@\@`\%0` % @T$%(  % @%0%(  % @%( % @%%0 %(@ % @@%( % @@X@\@%@``$$<'!܉\$ %(<'!$̓\$P$ $ $Eg<#B$ 91Z&0&7&3†7!6&m7!0!%&h#1$!$%4&E%!!y$4$S&L!!%^&G&"1†6!W&6!P!Y%&?2$!$%U&(%!!$U$q&(!!%~&(&/%2†7!v& 7!p!%&83$!$%t& %!!$t$2& !!%>& &x'$3†6!7&x6!0!%&x/1$!$%5&p%!!$5$S&p!!%^&p&hw.1†7!V&h7!P!%&ho-2$!$%T&`%!!$T$q&`!!%~&`&Xig,2†6!w&X6!p!%&Xn_+3$!$%u&PH%!!y$u$2&PE!!%>&PM&H'W*3†7!6&H87!0%!Y&H,O)1$!$%6&@%!!9$6$S&@!!%^&@ &8G(1¦0!W&80!T%!&8&0?'¾2$!$%U&0%!$q$U!&0&b<67&!2!6%w&m&!!y&h4&E#!y!4&&L&Y!p!&G¶3&"!!53&&&6!P&(!&Ž7?!!7&w&–4&(&!u&!7!r!4&(& &¦3!!(&&28!(& 3!6&!ž%&! &x&T¿6! !%&%&xŽ$&(!5&x!&p/!1!$&(&p–9& q&p!(&h!w.!(!9& &h¦%&2! &h!&`o-! !%&%&`ž$&(T&`!5&Xi!g,!3!$&(&XŽ9& &Xn!(&PH!_+!(!9& &P^–%&q&PM! &H'!p! W*%!&H8&%!P&(2&H,!5&@®$!5O)$!&(&@!0& U&@ !(&8¦9!(G(9!q&8& &!&8! &0ž%! ?'%!2&0&%&!(&0!9&$!97&$!(&m&D!& y&h!E&^.1!E#(1!&L& ¶2!p&G&! &%2! "&&!3&!P&!®$·?!5!y$&D1& !S!!Y& !!&2! !(! 2!($ ,1! !4 $$$ 0'X$8@DHLPTX\`dhl04<xptQ|%'<'!c'(!f+F$ 40,%%%?s2`B$`@$@.@;%-`@1&%( z% @&@@.40,($ 8'#+%@D&U&! +-@+$\B&3" %0 %( %(Y% @@!p&@.@!4 %40,($ 8'%D&! +@!3" %0 %( %%@!43 +$@!03 <䉜'!'?B0%D$! %9,$,($B`E܉&8$#0%( ! DB'%D|"W|T#[X%(@% %@@|""" |"""|" ""|"" "|"""@% ,$ %`(0'@$#D&C,$`! DC,`@%(@% %@@܉8$%( % @%(@% %@@@B$@$B$C,`$B$<ć'!h'l'|t%% %X%tw% %@@@U% tb%|'%0`%(@% %@@%(?% %@L <Ć'!܉l$ %(<'!$l$`$ $ $,<@ j < <|6 $Xc&p|>5&p&x/i5%XrD!!X&&h!i!PI&h&H!7!-!h$(**J*%x&BN*Bs"$x$X4"&(4!h&H@&N¸!(u"%X&B|,l,!H%&pN!H&&h* !i&h!X!&p!Xi! !H*#$ #&& !H8B.#Bk+%K! +&(!($H43&|3$hKu+¸&p%hM&x”9BL9L!!h&x&H2r!h! &H.&(C!x!x2$!8$($&&(!8B6$BK-%m!(-&0!010&$$Hmt1-¸&%H&pB<8¤8P!e!HI&(&p!8!p!@&&0&(d!p$(2'!PU'(&&(!PNB6'B(%!((&0!07&$$L7(&¸%&HBT/¤/T!%!r&(T&H7!PF!F&(&0!H1!H%$!u*"$0"&&0!iB."7!0B*% 7&(*&$!($ (&* &¸%B.¤.!0!q&W&tX!F&0t!%!F!(e,&! $e2! ¢%B3#Y2&g%#%C,&$&Xw!d&4$B%¸5#$C%&>&0&w´)B)\!3!!0& !0! &!&E!X!8²$$$$,&!8&"B$!'&!`HLPTX\d0 &Bk&%f$%@&h$f&$j%w&h(D!h '!84@<8!@ &,HLPT|lTxhXtd\X\p`"9'!C"%$($% %'+< B DC$+b!DC8 B$#+t7@PD&PU&! +I@+$B&3" %0 %( %(% @@s&!b.!4@%`%!(0% @&#p @g,!03`%40,($ 8'$b.@%PD&! +@!3" %0` %( %40,($ $8'%@!43 +$@!33 %`%<`'!' B0%D$!"%q,$$,(܉P2&`PEp$#0%( ! D# $"B/ % B7% |$$%f$B7|$#%#|#""|#"##%(@ % %@T@#"|#|"#"|# |" $# "|#|",#("|#|"4#0"|##| "'$8"<#||"#+(/,"@4D#@"|#3|0"74L#H"|#;|"8?<4.% ,$ %`(0'$#0%( ! D%(@% %@@܉p$%( % @j<<]'!', 0@\'%% %%%%(|% %@@4% b %'%0`%(@% %@@%(% %@$L <$\'!'P0B$<B$$'($@CEFIJLOQRTWX[]^abdghkmnpsuvyz|@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                              @ @@@ @ @@ @@ @@@ @@ @@@ @@@@ @ @ @@@@ @@@@@ @ @ @@@@ @@ @@ @ @@ @@@ @@@@ @ @@ @@@@@ @@ @@ B@@@BB@@@@BBB@BBB@B@@B@BBBB@B@@@                                _P$бU[D\X"NПWz|;AVj 2b_I@ޢXc\JFlKY"kV5!0 *1qƦJw᪩=0(bymWX* y+oM lacYɟ0y~$_?%}^Z _7Ͼk俟]5Qdp铗]|W&CVfke+~+\ } 3\pE*W j=_/G"<36] $LiExYԿ%%C -2#s+P' ȓݏuI/Iwogy}4 7EZ2;%~y?Tq5Nv屆nlwɣ?j%ATkb--zYWV 2r.#1{9|\Ȋ'Lqkך>~M>X3! y(HS!\ *|H.h_;%2MBnmbx"Ī~EKٲq]_lO[Nr!h hN!I=U%%ETÈ-S*_dw{9ۅՃ Xn?R's.M|z#2e`Ǘ"[wY6ݹ3}OSUn_)Rqڲ$}-(xf4wЪS9Gh\Ԑ 0YMf{9q W!nTnQ_>JUg'BWP cp|q]TɾY$J*dE޺OVf 60U1{9BڹdGvFa#X\U¿i>,u?0&<ߎ=]^ַ$g2t#s'xqs(cmr GTH]eģ&w:H[Y(- ΕbU~fyAA6Ќ^ҿ;HܮGTH]eģ&w:H[Y(- ΕbU~fy/ ""l(b"g%H> nS6ӔT""h+qXQ4('}^"F#H–MV'D~.q-{׳FުxMi.H!lUUgG|\[M0`Y6v$2B.h a]v7\wĩyB0zff/L,vP2qR|EY$/ڷV鬑d Ɵm,"ì􈪨ץhPؼF"`PԆ&mGZoE5>Xk9{4u,)G%'xG/ؔ?&ٮ ( @ɵ`t[[}3B93m]]>@$''KI~vQRCf+*+ln$ôr_nT({y.Eڢqޏ70"]H9ydg<=IUT>=J8B Ok.ݲL"Saׅ&I]N55ܕ)pd3x64Έzk@P%-սz1՚V\|onMbt{X"5y\xk/y sgؠB H{i\a%9O I~́F.0ahAxi_]Wo48j峨cp{Gmb~+%n갃=VN:t菽ݣ{.Xfq x7y de/a& Ƹ˜5scw8<Ϩz_ɭ+^Ձu)ةZMcN͑q*_Ϣ n5g>$5p_&YPRVnBe˥$8t(_RO^wm3hl[kh}*gr˿/OX yzeK/j/ ZA#U|Sylwsdo<@mqZ/ 􍓯Xdo$9dI1㗩T&! YSlB'9\6.C8+y9 zl(Kѽ`nbW\zC{A|. .*mVj %7CJ"˙fV 'OT>D5@it2Zogh+MeA|y7L3iVbBqs!U{Jz's'bk[ʢD,(PgxviBC'GnڔZ2[ߜ'7,50@iƔU`X<է'-T`1BnIȷvE}{2m! "UgB˺ٝo@W@-/O/#(:)!Pb}χ "rYbK Uΰicni4}hdUD6+l=͞i?D1@~OuH&mמ5gO]S$h.%ţnC%eIs5TY[bL򕢻5e,0Y (w ܐ>%T.3B8@'m::o9?Oc1vN*PR|vc؉E-N\]Y hZ`wL-ρl+7dr)9Gy/ ֫zU Vނ; ekl.#9Ip1ޯzpc2@XVQ V5Q{q_M{1^>KbIƏ3D4_B %r0Q tAe\-fͪA̻ c=!z[kD _}|\e&a׬b)JЁ8!ޔG<òS]C#qpOAT9&pS22F:W֒O%&[oKG]&k{0bLSvTXsV|4[ _j=BQ/}XM#̍Y/,׺~QVvg3cVqGŧ1rLW]{/>{sթ,>ׇhT r(Px vh$wzV]ӵ BYg1SzF4 AEmʏMmĄ(\@eB5 :DO-iRᚙܜ?ٙq=Ѱ[#-BEQ[Dkg('Z3dӅg"н̠<:k dYN"Q J\/I[sSf+L5:/7X)8d78;l[ً~#yP$L=ZP~EWBxI b$2 6n|Ǎ?\jdjsyZ#@A;ƍ5]Ժ{:2Z.tGM}ʵP}1BLۗyD :asU"xvVW2BeL R?o}'ݯyFN}e xEc2俑xXPGsXL0f4&j^MIKxaI2Q-R,yO .~yҾvqUr Z[<|L/AHK2kBr[7Tb~oOg/+_Vjק˚2#XBjdjWXVP`́$6=Q>W]&yT= ]w/dELۖ(+OUqH=W?YڹfmxA?c~dU oF|xiqZ .WӑL=~iS78r AyM 31n~[MOɌHh)ᵝar7BK'&OE˟:6Hr h(ᢏց i9^ YyKe1uOMQXv,TǼ17p,"&S8 tt~F ڥ\ r x#Fi fXY}vrtxM1[:P/v9&ڜ6Ln} XH$țrw YAjrK 5C⌾ h/H B`*7j}@6+-8P=7yKYkwA@ԸJ@]t'! nP]ס}!{EQw \4bΚjuFm5-2noM y} !XþeIW3O'ƸW QgnHQkU# yK5ۚ'ERcK](>Bڙ:1:GG[ė-ܝtgC\7n%I d^_I6>n EuXI5 Av6-='hDWID},_\;xj)9f1~~BjH3ި'(Yw^K=Mk`(!?9dB#f> d8oGɵ;Х Hk/QPfџv@rp<5a?P@&^r,f>'hDWID},_\;xj)9f1~~BjH3ި'(Yw^K=Mk`(!?9dB#f>?PkE4,=s5;R{~Q9V 񎑉[rڢ@!a>Qw]+(NIM`Ƒ0;z:aɕCA𥴗A?,_+ZVH躿衵Z͙~k4Sc %AHÅK+ X-zbtO,C J{5wIeyBNo+{ ~NUz1i4r? +u27j2; 4 JDsԔ)b)-t2g 7bf5Be XS2,W1&o'T4Z4@?ldbmF QجWoyͦ6ʭAozH܁&,ƆBrɶsd6{]2G-Q0elaIS2Cڦ5!LHi'z'7{o0F\دt#MV2=DG_8&mm8?l1IP:Ù0Z*! T ek@'s~eS~@7sZ^s+I~\!ݬ!>NQ*Rh\}Lv&|0#N_Bw!4(\eJ/Jf ^έ@ʲ0UtxH'4Br[mWF^K |q>nfu1?=>7X+f([8$WB!hq?B*RuQI6+D\0vYƢƶ pGآ 92#aȆJ|pbG݋! vdt!E1reKwBɪنUe#N5 mL QIȴuvS Cʐw?^! 5d̑wV}[~UP{<#H#c T<$ǚ%8ÄIf*mh\ēS c3g#CSGrD[*٤Pc|uis1KiHpbm[)0Avʃ1[B!APDMd1τ]<ZG,|X-@ MQYn8TMQ6`Vx'3Bɋj^F^ÔdYf~Z`\~ڂI.Z&5 k`K,T-1La{ Y0Qy2,{P!PA}+إ _$C.7T5w?u4Jvk; "f?]-Ԟ}.nM{Eyt)̇PeY Y$5F &aVbg7a]* 8l`Z2߿t-Y]e|0wq_U@ie?$W0 `$HWٶt QOV0K=$YY.u|.)Lu|yO#-T2Ċ; Oûlf%-o%A<07*WJx3f!9#Cv H%d/CWޠ(_=H$h$K 4t>JEcOOλ?sMS۽pO,N.h5P`Su_9k"Om|i9:XiJ"E]2['jwA\OP t>hUM m 2֮GxCsÃ<%%f&KAD];YgKNw#U+-\%5-tQ 9(M=] Ըč ?ktpqq+ڸ! Hom 48г*&_uö&$IdKlN0O-iYyl_<*AqPUtޒ?>+s.f3iZt\W:E/ $Txqg]I k"\cy/j)g?td3kPDq?E+DSg@x~\~B>rdg'ACfC~6KHA{a}۶cX9Ƃ#GZzͪڌ?eA;M"-%*(FҚRT|3nهPZ5~@3+G9YА$ vS&'+" *8.=<W-I8B3P>QV_Qh N҈(#XgKX,YLpDId~~M2| ?,mOe zT>JyZ]+ڼthI3o(J]ۧM d;NK]QiqsZ#Fc_ڭx:cغy41{zZ]}-K UWNn~iܳF/ضc|Pٌ7cF{8G-f3#HOJQr/ `D/s{tɳ[m_P ((mO1/H 9`0Ʊۗ`$}upl3bzV0=cTEo{B4Rql]7ta@0}m򮤶|PLLMzI-`_j¢Y#F,x7=,SRu{,xAvTVR˨_|Cz~α` 1|()ܒ]o,&J6 vr8^T:l)U]U8*TAYb;nt DZ7"ʇs)jzH X-7Mc_|Cz~α` 1|()ܒ]o,&J6 vr8^T:l)U]U8*TAYb;nt DZ7"ʇ*ȅ*.9VZPAn-k>/197pj[ěoP$OLya:rrXC'ei[fu.Z0%BBv[_$9]m7&6*`QP.MVRL5'1DhSq*ГDHbo]: =1 DLdU?0@odiHD }g^XZo_6~gMWv:N~&"#EK?OGe^Y"r_'4[cX\.O`$*I.j9B80p, |\F _ `K7}^$=yla2AX8Z*Lx,$Y(T:m]5Юz3ˬ'U1ݙʨ)]HIۂ_:8? )ɣFw~!ԣ(nLX4C%5AnQieO&k4=]DT[ OBAn/O>kh]_{aNQP MS#*8fR)sg>0T5 gסa; 3"=< }}7ۆ'|TL%O(^m7i@i@ ίH b XpvpȺK#: :YLX#{)<;S̰evU:5Z|pdXL@4(Դȴĵth\PD8, س̳xl`TH<0$ ܲвIJ @8`$plHT @`ŀുth ,8DP\444 444400dddd`XlXXxXXXXltllTTHHllll```` ,T| @H0h  @ 0 @@@@YYU +"+#+ ll88T\dT88T\d 0@  0@ 0@  0@TXJV '=<عŃ-66Ad3̓$>}/cc uazea$3_nЅceU=W^W5O pw⦉rX650OH:yz $aKjڷ`hOB9MVcr  mp4(4/ar酃O2;Los;. Ŏ}J&kB8a5[;e[48aoz&Y p CyDDRMdqK\m+"6: ! BHN kS< ?՝|%+fnoRMy0W}_B֟mwcU@[~1zq5Ȇ1j-h2` 0mxq8 )3ˋz=q@<*NΩ }ώɵZkMQAƊ~^  dElzNg},8S*:#DB>;T2v$ȑ{dL3Lp:ͭWq\>NF8GLw$qiU2.c@ؠ5 n0#X~8wٴv>NKew#*(9"a XG| F-S+tj^b),1bFP]-T3R5[-'+[;qk?Jib&1aW y8Ԥ2j6L8BZ1Qd?PChi^ ýK1B)U[/t|&e,)89үTPJNju(F5_\Y FQTƌ"pjFtQ1 p?!~l8&,QiB<P!{bHͭո0uw1J?/WຊO超]rn0]q~/t0g ID="aN*֌BLTXJV '=<عŃ-66Ad3̓$>}/cc uazea$3_nЅceU=W^W5O pw⦉rX650OH:yz $aKjڷ`hOB9MVcr  mp4(4/ar酃O2;Los;. Ŏ}J&kB8a5[;e[48aoz&Y p CyDDRMdqK\m+"6: ! BHN kS< ?՝|%+fnoRMy0W}_B֟mwcU@[~1zq5Ȇ1j-h2` 0mxq8 )3ˋz=q@<*NΩ }ώɵZkMQAƊ~^  dElzNg},8S*:#DB>;T2v$ȑ{dL3Lp:ͭWq\>NF8GLw$qiU2.c@ؠ5 n0#X~8wٴv>NKew#*(9"a XG| F-S+tj^b),1bFP]-T3R5[-'+[;qk?Jib&1aW y8Ԥ2eTXJV '=<عŃ-66Ad3̓$>}/cc uazea$3_nЅceU=W^W5O pw⦉rX650OH:yz $aKjڷ`hOB9MVcr  mp4(4/ar酃O2;Los;. Ŏ}J&kB8a5[;e[48aoz&Y p CyDDRMdqK\m+"6: ! BHN kS< ?՝|%+fnoRMy0W}_B֟mwcU@[~1zq5Ȇ1j-h2` 0mxq8 )3ˋz=q@<*NΩ }ώɵZkMQAƊ~^e_jTXJV '=<عŃ-66Ad3̓$>}/cc uazea$3_nЅceU=W^W5O pw⦉rX650OH:yz $aKjڷ`hOB9MVcr  mp4(4/ar酃O2;Los;. Ŏ}J&kB8a5[;e[48aoz&Y p CyDDRMdqK\m+"6: ! BHN kS< ?՝|%+f.7TXJV '=<عŃ-66Ad3̓$>}/cc uazea$3_nЅceU=W^W5O pw⦉rX650OH:yz $aKjڷ`hOB9MVcr  mp4(4/ar酃O2;Los;. Ŏ}J&kB8a(\<(ȹȹm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl%$? :6=,'.8+12>p!Y9*SRj!xIJPMtLDLLLM\MLMMMMMMM M M M M MTMLMDM M"L$L! M#L%LLlLM$A?$BBPTE0C  phOF@QPQLtPQ||\QD$hM )#|\NL0,/t3998FT9xB$\\|\8]]ȕab$cdLȡxtHqrsflgDԪܫ؛|Բ(تH(` a`a8LpPoploL0nȦP.0$\R0Q t> $o\!G8FF(E"|HLhHDOtT l"T#?4TPR>hG,8l#PXAhPHKx4xT zy@~(nhTh4<tD4 ,k YBYk0BlkYppBBHZkh`~,f$TxgV`<XTjD4X)L+$(((AC؀.+BtCx).!,P t[| Z+%V*,` @(!0%*(H[l@O{~ V`| ^^  P '('`t$v|l  @  $8XDdDLhlКdhTDhPؿPH8} wwjLggghhhpД(4 PhԲ@T4pl@whtt`\&x0 x0{T}kmDijQWtos@D4L  ,`xDd4P /h"wxH0 Dx$a $48:84TH;$  \LX"p((4<('HCH[m@|`t`dTD4$`Ќl_@`ԛěJ,tdTD _`4_$_J$``Ԛx`<_Ě,|j07070101AE2249000081A40000000000000000000000016A426C2800000265000000FE0000000000000000000000000000001300000000usr/lib/os-releaseNAME="OpenWrt" VERSION="25.12.5" ID="openwrt" ID_LIKE="lede openwrt" PRETTY_NAME="OpenWrt 25.12.5" VERSION_ID="25.12.5" HOME_URL="https://openwrt.org/" BUG_URL="https://bugs.openwrt.org/" SUPPORT_URL="https://forum.openwrt.org/" FIRMWARE_URL="https://downloads.openwrt.org/" BUILD_ID="r33051-f5dae5ece4" OPENWRT_BOARD="malta/le" OPENWRT_ARCH="mipsel_24kc" OPENWRT_TAINTS="" OPENWRT_DEVICE_MANUFACTURER="OpenWrt" OPENWRT_DEVICE_MANUFACTURER_URL="https://openwrt.org/" OPENWRT_DEVICE_PRODUCT="Generic" OPENWRT_DEVICE_REVISION="v0" OPENWRT_RELEASE="OpenWrt 25.12.5 r33051-f5dae5ece4" OPENWRT_BUILD_DATE="1782737960" 07070101AE228C000081ED0000000000000000000000016A426C2800004186000000FE0000000000000000000000000000001500000000usr/lib/libss.so.2.0ELF4t4 (p55>NN8000((QtdRtd>NNhh    /NNX p * Pppp ppcp pooooac1#, a\CS5 P[7 -_O F&G0*B+ U!@; b']A/^K">M$DIX6(4E%).=82NTH3:?9<JRYQZVW`L  =!E i] " O ) }  =q /   w " ...q. Qf.s.G.c.p.O P#$ `.&P.U@.!~ |0. .e.}.[QM-p-A -"! -F-a-o--p-Y !`-P-w@-J9 N 0-h -+-4"-A,,& ,$,1!#r y,I& ,] ,,Kp, "t`,QP,@, 0,A ,N. 4",,+li+++w9Y :+++!( +& : X) 5 %h Y0 0 _init_fini__cxa_finalize__deregister_frame_info__register_frame_infoss_rl_completion_ss_tablestrcmpstdoutfputsfflushsignallongjmpstrlenstrncmpmallocstrcpyss_self_identifyss_subsystem_namess_subsystem_versiondlcloseinitialize_ss_error_table_ret_ss_error_tableinitialize_ss_error_table_et_listss_add_info_diropendir__errno_locationclosedirreallocss_delete_info_dirss_delete_invocationfreess_execute_commandmemcpyss_abort_subsystemss_quitss_namess_errorcom_err_vass_parsess_execute_liness_listensigemptysetsigaddsetsigprocmasksetjmpfgetsstrchrss_perrorss_unimplementedss_set_promptss_get_promptss_add_request_tabless_delete_request_tabless_safe_getenvgetuidgeteuidgetgidgetegidprctlsecure_getenvss_page_stdinsigdelset_ss_pager_nameexeclpreadexitwritess_pager_createpipeforkdup2ss_list_requestsfdopenfprintffclosewaitfputcss_helpsprintfstrcatss_get_readline__dlsym_time64dlopenss_create_invocationmemsetcallocss_std_requestslibuuid.so.1libgcc_s.so.1libc.solibss.so.2GLIBC_2.0ii  NNNNNNNNNNNNNNNNNO OOO O$O(O,O0O4O8O*0g'tk`*Dg@=eeI@ r` r`\g mPHg@:ee"k`\g mPHg@:ee"k`\ggؚ$ eNm@9eeM "\gg0@=eeem m j @2iedgXJg8e@gddej @2iegdg؟0N@?eDde m j @2ie\g4p\@@ eju @2ie\g4p\@@ GejU @2ied$%x =$%x ;$%x :$%x 9$%x 6$%x 5$%x 4$%x 0$%x /$%x .$%x ,$%x +$%x *$%x )$%x ($%x '$%x %$%x #$%x "$%x  $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $' '%s version %s Can't allocate storageUnbalanced quotes in command lineUnknown request "%s". Type "?" for a request list.%sPAGERss_pager_createwfdopenAvailable %s requests: , couldn't allocate memory to print usage messageusage: %s [topic|command] or %s couldn't allocate memory for help filename/.infocouldn't allocate memory to print error messageNo info found for Can't fork for pagerlibreadline.so.8:libreadline.so.7:libreadline.so.6:libreadline.so.5:libreadline.so.4:libreadline.so:libedit.so.2:libedit.so:libeditline.so.0:libeditline.soSS_READLINE_PATHnonereadlineadd_historyrl_forced_update_displayrl_completion_matchesrl_readline_namerl_attempted_completion_function: subsystem_versionsubsystem_name?executeabbrevabquitqlist_requestslrlist_helplhhelpIdentify the subsystem.Display info on command or topic.List topics for which help is available.List available commands.Leave the subsystem.Enable/disable abbreviation processing of request lines.Execute a UNIX command line.Produce a list of the most commonly used requests.Return the name of this subsystem.Return the version of this subsystem.Subsystem abortedVersion mismatchNo current invocationNo info directoryCommand not foundCommand line abortedEnd-of-file reachedPermission deniedRequest table not foundNo info availableShell escapes are disabledSorry, this request is not yet implementedD 2 202424<2D2H2P2T2d202h2t2x22POOm 3 4 484L4`4x444444O2N2N2N2N3N3NX3Nx3N3N3moreQ...Q....p.O#`.P.@.!0. ...Q--A-"-----p-`-P-@-0- ---,,,,!#,I,,,p,`,P,@,0, ,,,++++9+++!(+) %YQ07070101AE2289000081ED0000000000000000000000016A426C28000020DA000000FE0000000000000000000000000000001A00000000usr/lib/libcom_err.so.0.0ELF4t4 (p//H000((QtdRtd// N[iq `//Xh  0 (ppp pp9ppooh oo %9' 41* -# )($ &82,0!3%6/ "+.75  ) Y a$ Y 9)   U$ y  q  $U ` =Y. = @[0 O1m  RUi  Hk0 L  /  \p1"$ |`uPJ@d0 c "4"y6jr_init_fini__cxa_finalize__deregister_frame_info__register_frame_infostrtoul__errno_locationgetuidgeteuidgetgidgetegidprctlsecure_getenvfopenfilenofcntlstrerrorfcloseet_list_locket_list_unlockset_com_err_gettexterror_table_nameerror_messagestrcpystrlen_et_list_et_dynamic_liststrcat__stack_chk_guardstderrfputsfputcvfprintfisattytcgetattrfflush__stack_chk_failadd_error_tablemallocfreeadd_to_error_tableremove_error_tableinit_error_tablecom_err_vacom_errreset_com_err_hookcom_rightcom_right_rstrncpyinitialize_error_table_rfree_error_tablelibuuid.so.1libgcc_s.so.1libc.solibcom_err.so.0GLIBC_2.0[ii //00' '<0'!'0@@ D@ $$0 '<'!@0$ $jt @2iedg8kTl*\𘘂L@:ege"\n @:eT @e*PP@:e@e"jTTkMtkkl "H@:eDe@:eNeCg|gx5*L@:e Xe@:e Ne%+Pnoml@:ee"T𘘂L@:ege "pH𸘢M@:eeP,pH𘘢ML@:ege;$PL@:eRe Cag0Xm@:eRe-`P PP@:eHe@:e𸘞egD M@:ep񐚞e@8ejPjT nM0X m@:eReaxd j jj @2ie|gx&T&۠jt @2iegdxK4oCg?hbMg &KߦOG.!dj4 @2id$ge+g7*H@:eҞej*XJ҂gPM@:eey"gpT@:egP@e@:e P@e@:e IJZeCaPX@:eH<`e+PD9` #**BBaPH@:ee*BB`@(1%@PH@:e&T"@:ewd``p\@:eP@e@:ere`pM@8e` +dQ ` Q`0Ik aJdkz+J0K kz+J0Kj @2iedg@ @ P\! PLg@:ee"g0\g@:e0\egL@:ee!"g@@:eg0\eg@:ePTeg l@:ee "g0T g@:ee@@:ee"p@ @:ee* jlr`PTg l@:eePTg l@:eXeg@:e `en"@8epdjs @2iedgҰDl@:eeM""gPX@:eҞe"0𰘑g@=ePe@8e@3 APDLNNdhhh((QtdRtd>NNtt P,@N 4 /NNX  ` `Pl ppp ppIp%pooL oo CI0/.>8 =(; #* 1 $ %H) 'F7+-4:&,"<62A!5?9@3GCDBE4 4 / LP //T/2//up/`/RP/N@/0/ /y//.Z.. . ....p.`.P.@.0. ...-$----\--s-p-I`-=P-@-"a0-+ ---,,,g,,,,"@,hp,`,P,@,."0, ,,,l+S+D+_fini__cxa_finalize__deregister_frame_info__register_frame_infoubus_add_objectcloseuloop_timeout_setblobmsg_alloc_string_bufferustream_get_read_bufblobmsg_add_string_buffermemcpyustream_consumestrdup__errno_locationopendirreaddirclosedirrmdirstrcmpasprintf__lstat_time64unlinkblobmsg_add_fielduloop_timeout_canceluloop_process_deleteblob_buf_initubus_send_replyblob_buf_freeubus_complete_deferred_requestustream_freestrlengetpwuidgetgrgidblobmsg_parse__stat_time64__stack_chk_guard__stack_chk_failmd5sumblobmsg_open_nestedblob_nest_endreadlinkkillopen__divdi3readcallocb64_encodeumaskb64_decodewritefsyncgetenvstrncpymallocpipeforkmemsetustream_fd_inituloop_process_addsnprintfuloop_done_exitdup2execvreallocsetenvrpc_pluginlibubox.so.20260213libubus.so.20251202libgcc_s.so.1libc.soGLIBC_2.0@ii VNNNNNNNNNNNNNNNNO OOO$O(O4O"p\ M@:eҞe1"pP8  M @:eRe;a0H @:ee*jlr aX J@:ee"g0 @=eўeL@:eeH@:ee"XJ@:ee jj @2ideg32m3gm5kl j 8eL@medej @2ideHDJg `\$gL@:ePLAeL@:eeD*Xm Jg T@:e"O`L@?eXB JA:eM1L@&MA@:e eܚPDAM@:e e@=eeA?e@M𼘇Ae=e@1L𼘞eA@=e0Xe@:e0X`񌙞e@:e0 e@8exdj @2iedgPTg:e@%geJ g8eL@mvdedD"@:eDdj7 @2iedg$g@HL8e@LA@8eudj @2ide\gpX@:e Ҟe"@ \g0D@:e Ҟe"@ jflr`r`r` r`r`r`ra jgH2xgIKi𘜠X& LJ:e@ OeO6 3@76&go5-@1B4B5C, g jؘ\  &NmL@:e"He&LXCJnfOmL@:ee *H@8e}d8mQgJg T@:e𘘢O L@?e B M@=ePDe<ܙ:@:e e@8ejjV @2idej  g>XCJnfOmL@:ee *H@8e}d8mQgJg T@:e𘘢O L@?e B M@=ePDe<ܙ:@:e e@8ejj @2ie dg0L @AjJXCJn OmL@:ee*XJ@:ee Af#@8ejlrYa\=g@:eReaXmJg T@:e0T eM!n@:e "gJJe 𸘑gpTM@:e J IJea0 @=eeܚPD@:e e@=ejej sdjV @2ide g<XmCJ nOmL@:ee*H@8e0H g@:ee*jlrga H@8eH@:e*|dej @2ideg>c0L@𘘢 jXnCJfOmL@:ee*XJ@:ee #@8e ҂g@@:e Ҟe"XmJg T@:ePH eMn@:eҞeL @:ee#*P@ @:e0 e@?eeܚPD@:e e@=eje'Bp\ IMg@:ee"p\𸘑gM@:ee"pP g M@:eRea Ңg0H@:eeo*PH nm@:eұgX8JIg@9eX B J @:e jlrXge?*PH nM@:ejҢgHen@:eRe abJix@9eeBҢgD@:e* @:ee0 @?ee0 @?ee0@=ee*M& L@9eecdj @2iedgH$g m@:ej`\Xp Jg8eeC@mudj @2iedgX" J@:ee"j@DXp蟂 JTmL@?eDdeju @2ideҀJ" J"gj@DXm JTpHL@:eDdj5 @2iedgX" J@:ee"jDXp蟂 J?T܀LmL@?eDdj @2idejgBXCJn OmL@:ee *H@8e"gQgd"g!R `*g caPPm@:eRea !m*jk !XmJg T@:ee-$XJ@:e@KeB2 !*0T NM@:e Ҟe* i @=e0e@8ejF0Xgnou@:eeH6X @:eRe"gWa ="Xmg@:e Ҟe" C`) C` c`)X g@:ebAjZ*Le g:e7@O0 e=e@"gQea 0%k `@=e@eܚPD>@:eiei~i)ej @2idegXmCJզOnmL@:e *H@8e"g  '8gI@9e Xg J@:e e$@9e@e{*j w$@9e@?B4@3@4B2lMe @l@:em MgPPe @:e @e@:e ReaJR ga $@9e@e "P\ gg@:eReg,aP g@:eC1epL @:eRe`i+0X @:ee@$%x =$%x <$%x ;$%x 9$%x 8$%x 7$%x 6$%x 5$%x 4$%x 3$%x 2$%x 1$%x 0$%x /$%x -$%x ,$%x +$%x *$%x )$%x ($%x '$%x &$%x %$%x $$%x #$%x "$%x !$%x  $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x  $%x  $%x  $%x  $%x  $%x $%x $%x $%x $' '...%s/%scodestdoutstderrtypesizemodeatimemtimectimeinodeuidgidusergrouplistpathreadmd5%02xwriteentriesnametargetbrokendata/bin:/usr/bin:/sbin:/usr/sbinPATH/%sexec%s %s/dev/nulllstatstatremoverpcd-plugin-fileunknownfifochardirectoryblocksymlinksocketcommandparamsenvubus_rpc_sessionappendbase64   P0q!O0#O|0O19O 1O0O(1 O0)%OD1L1T1\1h1<1p1x11111001<0110110101N<1PNQ/////p/`/P/@/0/ ///........p.`.P.@.0. ...--------p-`-P-@-0- ---,,,,,,,,p,`,P,@,0, ,,,+++Q07070101AE24B8000081ED0000000000000000000000016A426C280000212E000000FE0000000000000000000000000000001600000000usr/lib/rpcd/rrdns.soELF4t4 (p888pPPP//vhhh((QtdRtd//HH P  4B P 0// T `0 ppp pp0p%poo oo@ %0 & (* $% . !,'/) "#-+P  P  0 L0 yipQ`P@0 yT"r$6mp`"P@0 a."XGD_fini__cxa_finalize__deregister_frame_info__register_frame_infoubus_add_objectuloop_timeout_canceluloop_fd_deleteubus_send_replyubus_complete_deferred_requestblob_buf_freememcmp__stack_chk_guardrecvavl_findavl_deletens_initparsens_parserrns_name_uncompressinet_ntopstrlenblobmsg_add_field__stack_chk_failinet_ptonmemsetsnprintfres_mkquerysendcallocavl_insertmemcpyblobmsg_parsefopenstrtokstrcmpfcloseusock_portusockfgetsavl_inituloop_timeout_setuloop_fd_addblob_buf_initrpc_pluginlibubox.so.20260213libubus.so.20251202libgcc_s.so.1libc.soGLIBC_2.04ii J//////////00,080D0T0,1' '<ड़'!'01@@ Dx@x $$01 'XGOQACFTRS   T |p TS;SaS!SiSSS|SlpS`SPS@S0S SSSRRRRRRRRpR`RQPRb@R0RT RRRUQlQ}QQQZQ1QQpQ`QPQ3@Q0Q( QIQQP"PPsP)PPPPpPr`P>PP@P\0P PYPbPOOIO"jOOO"OO."PcpO`OPOw@O0O ODO_fini__cxa_finalize__deregister_frame_info__register_frame_infoubus_add_objectfopenreallocfcloseblobmsg_open_nestedmemcmpubus_abort_requestuloop_timeout_cancelubus_lookup_idblob_buf_initcallocubus_invoke_async_fdubus_complete_request_asynculoop_timeout_setblob_buf_freeubus_send_replyubus_complete_deferred_request__stack_chk_guardvsnprintffread__stack_chk_failisxdigitstrncmpblobmsg_add_json_from_fileinet_ntopstrlenstrcpymemsetuci_lookup_nextuci_loaduci_lookup_ptruci_alloc_context__time64uci_free_contextmemcpyblobmsg_add_fieldblob_nest_endtoloweropendirreaddirclosedirreadlinkbasenameatoistrstrstrtoullgetifaddrsfreeifaddrsglobdlopenglobfree__dlsym_time64fgetsstrtokether_atonstrtolinet_ptonblobmsg_parseavl_strcmpavl_initsprintfavl_find__calloc_aavl_insertavl_deletenlmsg_parsestrdupnl_socket_allocnl_connectnl_socket_freenl_cb_putnlmsg_freenl_cb_allocnlmsg_alloc_simplenlmsg_appendnl_cb_setnl_cb_errnl_send_auto_completenl_recvmsgsrpc_pluginlibubox.so.20260213libubus.so.20251202libuci.so.20250120libnl-tiny.so.1libgcc_s.so.1libc.soGLIBC_2.0Sii i`odoholoooooooooooooppp ppppp p$p0p8p\phptppr' 'eB5`6leggeggiVXJ KM@:e"genVa0 g@?ejxj  ֢K M oF QGkl " Om@?eeB ydejw @2ide$%x =$%x <$%x :$%x 9$%x 8$%x 6$%x 5$%x 4$%x 3$%x 2$%x 1$%x 0$%x /$%x .$%x -$%x ,$%x +$%x *$%x )$%x ($%x '$%x &$%x %$%x $$%x #$%x "$%x !$%x  $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x  $%x  $%x  $%x  $%x  $%x $%x $%x $%x $' '%02X:%02X:%02X:%02X:%02X:%02X0001000100030001/etc/board.jsondhcpodhcpddnsmasqleasefile/tmp/dhcp.leases/tmp/odhcpd.leasesstatusnetwork.wirelessipaddrsip6addrs/sys/class/net/%s/brifbridgeports.../sys/class/net/%s/bridge/bridge_id/sys/class/net/%s/bridge/stp_state0stp/sys/class/net/%s/mastermaster/sys/class/net/%s/phy80211/index/sys/class/net/%s/operstateunknown/sys/class/net/%s/mtumtu/sys/class/net/%s/tx_queue_lenqlen/sys/class/net/%s/ueventDEVTYPE=devtypeethernetaddressnetmaskremotebroadcastmactypeifindex/sys/class/net/%s/iflinkparentstats/sys/class/net/%s/statistics/%sflagspromiscloopbacknoarpmulticastpointtopoint/sys/class/net/%s/speedspeed/sys/class/net/%s/duplexduplex/sys/class/net/%s/carriercarrier/sys/class/net/%s/carrier_changeschanges/sys/class/net/%s/carrier_up_countup_count/sys/class/net/%s/carrier_down_countdown_countrx_bytestx_bytestx_errorsrx_errorstx_packetsrx_packetscollisionsrx_droppedtx_dropped/sys/class/net/usr/lib/libiwinfo.so*iwinfo_backendiwinfo_closeiwinfo_format_hwmodesIWINFO_OPMODE_NAMESIWINFO_80211_NAMESIWINFO_HTMODE_NAMESIWINFO_AUTH_NAMESIWINFO_KMGMT_NAMESIWINFO_CIPHER_NAMESiwinfosignalnoisechannelcountryphytxpowertxpower_offsetfrequencyfrequency_offsethwmodeshwmodes_texthtmodeshardwarequalityquality_maxbitratemodessidbssidencryptionenabledwepwpaauthenticationciphers #ipv4/ -*ff:01:dhcp_leasesdhcp6_leasesipaddrip6addrexpiresinterfacehostnamemacaddrduidiaid/%hhu%%s%s%s/etc/ethershostip addrstimeoutlimitlookupnetwork.rrdnsinterfacesifnamegetNetworkDevicesgetWirelessDevicesgetHostHintsgetDUIDHintsgetBoardJSONgetDHCPLeasesrpcd-luciluci-rpcfamily0d[u+x[E[YB[a;[[8o[(X4X@XLXXXdXWpX|XX[ho[0phoQrTSSSSSSSSpS`SPS@S0S SSSRRRRRRRRpR`RPR@R0R RRRQQQQQQQQpQ`QPQ@Q0Q QQQPPPPPPPPpP`PPP@P0P PPPOOOOOOOOpO`OPO@O0O OOr07070101AE2434000081ED0000000000000000000000016A426C280000413A000000FE0000000000000000000000000000001700000000usr/lib/rpcd/iwinfo.soELF4t4 (p888pPPP33?OO:hhh00QtdRtd?OO P+ 4 .OO0 = `P @ppp pp3p%poo oon %3, 0  .)*+   &#$2"'1!(%-/4  4  . LP ....|.t.p."`.TP.8@.0._ .. .-b--U-E-"-q--'p-K`-P-M@-"e0-." -<-D-_fini__cxa_finalize__deregister_frame_info__register_frame_infoubus_add_objectiwinfo_finishiwinfo_backendblobmsg_parseblobmsg_open_nestedblobmsg_add_field__stack_chk_guardblob_buf_initblob_nest_endubus_send_reply__stack_chk_failiwinfo_dbm2mwstrlenmemsetiwinfo_backend_by_nameIWINFO_ISO3166_NAMESsnprintfstrncmptoloweriwinfo_band2ghzIWINFO_FREQ_FLAG_NAMESIWINFO_AUTH_NAMESIWINFO_CIPHER_NAMESIWINFO_KMGMT_NAMESIWINFO_OPMODE_NAMESht_secondary_offsetvht_chan_widtheht_chan_widthIWINFO_HTMODE_NAMESIWINFO_80211_NAMESiwinfo_format_hwmodesiwinfo_htmode_nameiwinfo_htmode_is_htiwinfo_htmode_is_vhtiwinfo_htmode_is_heiwinfo_htmode_is_ehtopendirreaddirclosediriwinfo_typeether_atonmemcmprpc_pluginlibubox.so.20260213libubus.so.20251202libiwinfo.so.20230701libgcc_s.so.1libc.soGLIBC_2.0ii 3OOO O O$O0O8Ophhh((QtdRtd00/0/   0 p0/4/< * 0 @ppp pp4p%poo oof %4.0/1#   2'+!3&),"%$*(-0  U0  p |0 P@|0 [l fop[`P@}0 A"+Fp``PM@:0 "Dv."K_fini__cxa_finalize__deregister_frame_info__register_frame_infomemcpyubus_add_objectforksleepexecv__errno_locationunlinkblobmsg_parse__stat_time64pipewrite__nanosleep_time64waitpiduloop_donedup2chdir_exitexeclsyncrebootstrchr__stack_chk_guardfopenfclose__stack_chk_fail__fstat_time64mallocreadcallocblob_buf_initblobmsg_open_nestedsscanffgetsblob_nest_endubus_send_replyblob_buf_freestrtokstrcmpstrlcpystrlenblobmsg_add_fieldrpc_pluginlibubox.so.20260213libubus.so.20251202libgcc_s.so.1libc.soGLIBC_2.0 ii  0/4/8/$@mL@:e Ҟe" l`@!*Xmg@:ePDe# Mng@:eҞe jX@XX/K rKa 2IL`j j @VpXg X"gpi`PjN(pH b#M@:ere` @¢ ҂gX m@:ee* "0𰙂g@=ee "0𰙂g@=ee0?e@g0\e@:e𨙞e=e@gP\ e@:ejepH CM@:ere` x¬ pPCHgL@:eeg"PXCM@:epegl?e*ge"p\nB@:eee]g X r`JZ`K@* @X?" X? "b҂gX J @:e Xe:"PL@:egPLeB@:eCe)aC`@@ aX "PLg@:eJҰDegbm@:ee  @:e Ҟe *j7tdj @2iedgT n&Mg@:eXcJ XJ j XJ@:eB𘘰LeLm@:ee $XA J@:e@e" pL@:ee*Tl@:epeg@8ezdjeeeee%x 3$%x 2$%x /$%x .$%x -$%x ,$%x +$%x )$%x ($%x '$%x &$%x %$%x $$%x #$%x "$%x !$%x  $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x  $%x  $%x  $%x  $%x  $%x $%x $%x $%x $' 'sysupgrade--test/tmp/firmware.bin/sbin/jffs2reset-y-r/bin/passwd/dev/null/ @~<>=r/lib/apk/db/installed/etc/apk/worldpackagesP: %127sV: %127s = openwrt:abiversion/sbin/sysupgrade-npackagelistpassword_setupgrade_testupgrade_startupgrade_cleanfactoryrebootrpcd-plugin-sysrpc-sysallkeepuserpassword    P u/5/ / a h|8/008/) l1P@0 p`P@0 p`P@0 l107070101AE23B8000081ED0000000000000000000000016A426C28000041AA000000FE0000000000000000000000000000001600000000usr/lib/rpcd/ucode.soELF4t4 (p888pPPP==?OOhhh  QtdRtd?OO  0  `4OOh   @Pxppp ppWp%pooooDCW% !5T? FOE(4Q. /)* ,#@$ 9"M28R1:L6N&; 'VD0HB+C-3GAI7=<J>SPKU ] `4  P _@4049 44c433 33~3G333p3`3P3@303 3C3L392T22a22@222p2`2P2J@202 222s1111111v1D1p1Y`1"P1@1p01 1110n0(000\000p0d`0UP0"&@0w00 0."0Y0,/m//8/4///v/_fini__cxa_finalize__deregister_frame_info__register_frame_infouloop_timeout_cancelucv_resource_dataptruc_vm_raise_exceptionucv_resource_newblobmsg_add_fielducv_typeucv_boolean_getucv_int64_get__errno_locationucv_uint64_getucv_double_get_ucv_string_getstrlenblobmsg_open_nesteducv_array_lengthblob_nest_enducv_array_getblob_buf_initubus_send_replyubus_complete_deferred_requestucv_array_setuc_vm_stack_peekucv_object_newblobmsg_check_attrucv_object_adducv_array_newucv_int64_newucv_boolean_newucv_double_newucv_string_newucv_putucv_array_pushstrcmpblobmsg_check_attr_lenucv_object_getcallocmemcpyucv_uint64_newucv_prototype_getucv_prototype_setucv_getuc_vm_stack_pushuc_vm_callstderrfprintfuc_vm_stack_popucv_resource_datauloop_timeout_setucv_gc__stack_chk_guarddlopendlerroruc_search_path_initopendir__stack_chk_failsnprintf__stat_time64readdirclosediruc_source_new_fileuc_compile__calloc_astrncpyuc_vm_inituc_vm_scope_getuc_stdlib_loaducv_cfunction_newucv_resource_type_adduc_vm_executeuc_vm_registry_setuc_vm_registry_getucv_typenameuc_vm_freeucv_object_lengthubus_add_objectubus_strerrorstrduprpc_pluginlibucode.so.20230711libgcc_s.so.1libc.soGLIBC_2.0ii OOOOOOOO(P,P0P4P8PQ' '<'!'Q@8@8 D@ =$$Q '< '!H@HQ$ =$A`@2mb`3`3M`3@2mB2k leA`@2mb`3`3M4g`24m`3ml3ml JejW @2ide\gX J@:ekkJDd le$a`3뢤DD55mc`3m#e`3m4b31lK ijej @2iedgD$gL!L@:e0ge@8eudej @2id圚e2fL2gILfM@:eDdejw @2iedgX$gJ@:ee" -ؘNmg@8ejud@X"ؘNRp@8ej @2i3de5el215-eieg,6m36g;eggmxgX,mkJg8em@gvdejw @2iedgҐPg@:ere `Z`r+`8rIapT@:e @je mr`r`rO`ydjomg@8e PP@:e"gpHe @:e@"reaH@:egg"H@8e QXgi*_"3 2m 3ml"3m j mL gpP@:e@4MeB5`6%gnb4ee9gg9e`4b3$gg;e?B2Mg,g j  mPH@:eg"gPLe@:eJegmXJ ҂gPDn@:e e iT @:eCea 0@8eiPX g@:egOl@?eIeXJg PDn@:e M=e@"g egej7 @2ied$%x =$%x <$%x ;$%x :$%x 9$%x 8$%x 7$%x 6$%x 4$%x 3$%x 2$%x 1$%x 0$%x /$%x .$%x -$%x ,$%x +$%x *$%x )$%x ($%x '$%x &$%x %$%x $$%x #$%x "$%x !$%x  $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x  $%x  $%x  $%x  $%x  $%x $%x $%x $%x $' 'rpcd.ucode.requestCannot invoke defer() on invalid selfReply has already been sentAttempt to invoke error() on invalid selfFirst argument to error() must be an integerSyntax errorRuntime errorType errorReference errorExceptionubus_rpc_sessioncallargsusergroupobjectaclidnamepathmethodinfoubus.deferredrpcd.ucode.deferredcontextUnhandled ucode exception in '%s' method! %s: %s %s Attempt to invoke reply() on invalid selfFirst argument to reply() must be null or an objectSecond argument to reply() must be null or an integer/usr/lib/rpcd/ucode.soFailed to dlopen() ucode.so: %s, dynamic ucode plugins may fail /usr/share/rpcd/ucode/usr/share/rpcd/ucode/%sIgnoring ucode script %s because it is world writable Unable to open ucode script %s: %s Unable to compile ucode script %s: %s Unable to allocate context for ucode script %s: %s UBUS_STATUS_OKUBUS_STATUS_INVALID_COMMANDUBUS_STATUS_INVALID_ARGUMENTUBUS_STATUS_METHOD_NOT_FOUNDUBUS_STATUS_NOT_FOUNDUBUS_STATUS_NO_DATAUBUS_STATUS_PERMISSION_DENIEDUBUS_STATUS_TIMEOUTUBUS_STATUS_NOT_SUPPORTEDUBUS_STATUS_UNKNOWN_ERRORUBUS_STATUS_CONNECTION_FAILEDrpcd.ucode.signaturerpcd.ucode.deferredsInvalid object signature for ucode script %s - expected dictionary, got %s Invalid method signature for ucode script %s, object %s - expected dictionary, got %s Invalid method definition for ucode script %s, object %s, method %s - expected dictionary, got %s Invalid method callback for ucode script %s, object %s, method %s - expected callable, got %s Invalid method argument definition for ucode script %s, object %s, method %s - expected dictionary, got %s Unsupported argument type for ucode script %s, object %s, method %s, argument %s - expected boolean, integer, string, array or object, got %s Unable to allocate ubus object signature: %s rpcd-plugin-ucode-%sUnable to allocate ubus method name: %s Unable to allocate ubus method argument policy: %s Unable to allocate ubus method argument name: %s Unable to register ubus object %s: %s Skipping registration of ucode script %s The ucode script %s invoked exit(%lld) Compilation error while executing ucode script %s Runtime error while executing ucode script %s deferreplyerror$==i!=",P,P4P4PQ@404 44433333333p3`3P3@303 33322222222p2`2P2@202 22211111111p1`1P1@101 11100000000p0`0P0@000 000////////Q07070101AE2025000081A40000000000000000000000016A426C280000E11E000000FE0000000000000000000000000000001600000000usr/lib/libz.so.1.3.1ELF4t4 (p888pPPP$hhh00QtdRtd o  p    ppp p3p~p"pjooooooa~Y.KC 2J L"b'`4dN7[p_VW{U1Rc^M*5Q6l9r8vfjkAmZea,I](giHhsn }w|x+u)&3#q!? =GDz<BTPS% >\X:$otE;-F0/@O y  pb & `ae m}e ~= 6!  W N 5E Wm f ^13 Z)M,  ?IL |e4= g YA HA 4I1i hMb G . 9Ie ͦ Z - I" -}A }W" {A z " I rMA 5g( 5 5F2 ]%" O Vy y 2U] `  Ѧ-  " AP& 1Vf ]g^ 4M`] yD antEey j}Mu $5_u eI o3 aUM& !|  4 ;` } aH8 0I" 4E :H5 iF y " { ^P u -_ y9I T " eI& uq& & S  X1 B9 M( >< I2 M{ }1N UzQ 9 @ f lI" C ] Wa( GP@m0L J-Ч'"*ES "&4"FpO`P_init_fini__cxa_finalize__deregister_frame_info__register_frame_info__moddi3adler32_zadler32adler32_combineadler32_combine64deflateInit_deflatedeflateEndcompressBoundget_crc_tablecrc32_zcrc32crc32_combine64crc32_combinecrc32_combine_gen64crc32_combine_gencrc32_combine_opmemcpymemsetdeflateSetDictionarydeflateGetDictionarydeflateResetKeepdeflateResetdeflateSetHeaderdeflatePendingdeflatePrimedeflateTunedeflateBounddeflateParamsdeflateInit2_deflateCopygzclosegzclose_rgzclose_wgzbuffergztell64gztellgzoffset64lseekgzoffsetgzeofgzerrorfreestrlenmallocgzopengzopen64gzdopengzclearerrgzrewindgzseek64gzseek__errno_locationstrerrorinflateInit2_inflateResetinflategzreadgzfreadgzgetcgzgetc_gzungetcgzgetsmemchrgzdirectinflateEndgzwritegzfwritegzputcgzputsgzvprintfvsnprintfmemmovegzprintfgzflushgzsetparamsinflateResetKeepinflateReset2inflateInit_inflatePrimeinflateGetDictionaryinflateSetDictionaryinflateGetHeaderinflateSyncinflateSyncPointinflateCopyinflateUndermineinflateValidateinflateMarkinflateCodesUsedinflateBackInit_inflateBackinflateBackEnduncompress2uncompresszlibVersionzlibCompileFlagszErrorlibgcc_s.so.1libc.solibz.so.1ZLIB_1.2.0ZLIB_1.2.0.2ZLIB_1.2.0.8ZLIB_1.2.2ZLIB_1.2.2.3ZLIB_1.2.2.4ZLIB_1.2.3.3ZLIB_1.2.3.4ZLIB_1.2.3.5ZLIB_1.2.5.1ZLIB_1.2.5.2ZLIB_1.2.7.1ZLIB_1.2.9ZLIB_1.2.12GLIBC_2.0              '2$8$'$3$4$3$  4$-  5$:- 1$G: 2$TG 1$aT'$na\~ynii  ,8DP\ht' '<0X'!' @@ D@ ݄$$  '\g6T@:ee\g3Xh3=Ji;a7؀``=؀lbCp_j4^X:2Qgudej @2ide\gg0DJ@:e*gtaDdjKejG @2ide\gg0DgJ@:e *%ge` g|`ddjKj @2i de\gg0DJ@:ee3*]'g2`DxJC,a|jkB`jDJDXgM\g|P@=eGce(Pgvdh hjg @2ide\gg0D&gJ@:e *gۀ ۀ۟udjKj' @2idedEҮ21i)&3iҶ7GE]2].2]\gg0DJ@:e"`GgJvdgFr`r`*ԛtav(`a|Kb#[*j$D"EJǜ&NJ(ɜ&NJ($Jj jj23:1-@5IejG @2ide\g$g0DJ@:e Ҟe*]`C "A"`#as as `\gpHDFjK Ҡd+\gpHGFjje#\gg0DM@=eDe*J"e0DJAg*rD3Ha jTO2Ea lbaraAr Jg@:eJe"@ jej @2ide$DgCraYg"J *V`؟mNg@?ejKdd0䟐g O@?e*y#K#ejC @2ide 'd ##K ` dm IJ|gXJT jVXJUjWGjAra IN2  c d ` a 0OĚK*`AGZ `GZar` \g0D J@:ee"GjAjKGj\gXUJFGj j,fjKL Y a]gr 1B2B2rXgJ`\gXUJ #K ` dm IJGjAqrji ҋ`GjAQ" c`bgCg C`" C)`Cgi Ca\gX @:e k ei k i QkQ"e0D-JAg i `dg ?#K ` dm IJ"e0DJAgj[GjAؘ# ?%M ՠ IKY aaB{|gD2x Kik@8JD2IIbʮ2 [` |gBxD2Kik@8JD2IbDgZa0D@\TjVD@G@QJ\g@@@niOmMl@:eҞe "\gXJ"e0D-JAg[GjAYz:e} ]+` gF AD8L4[آ̛3`TnV 5 ac` #K ` dm IJuOaC $a gF ,,\gXJFGjAAGr``Tl*\gXJ"e0D-JAg %M ՠ IJGD0JD2I jlj3J IQaJB{$C8Kd3mآu(aC a jg5J Im ?%M ՠ IJ %M ՠ IJC a jg5 J I0D@\T jVD@G@QJ\g@@@giOmMl@:eҞe "\gXJ"e0D-JAg\ژUjWY@D5D@G@UJG@mJ\giO@l@:eҞe "\gXJ"e0D-JAgGjAr `GjA Z9a Z5a c d ` a 0O\g@?e0Ce D @ A O A'rajKH"e0D-JAgjHTv:ejKD O gLh3m Ձg ` _#K ` dm IM@+"Z)`kkdo gLfh3m C` ?"bgK ` di IM@ f f h" kL#jKH؜G j"e0DJAg@kL #\gX5 J"e0D-JAgklSG jAs# c 7ajK DOꑘgIQ F HmhQLG jAUw:ejKD O gLh3} Ձg` #K ` dm IM $L Ԁ IJ`[+`kkdo glFH2I c ` "J @ DI IM` F H F H@jl "\gXUJ"e0D-JAgjLG jsAs# c 4ajK DO꒘gIR F HmhG jA ?" RCU`SL`D"\gXuJ"e0D-JAg $L Ԁ IJMꮘo`˘SiqIcg`g `gqku uKjaQ*GjA "e0D-JAg Keg " Q@ J GjACgJCU" Y )a eehhkl>"'.Ec" gn7"\gXJFGjA "e0D-JAg $L Ԁ IK w E2"\gPH@:eGLcjle* ij GjACA"e?# Y +akl5"H j1`\gXJ"e0D-JAg\gPD B2`3i lb3i G`3i ?$L Ԁ IKji GjAj"e0D JAgAbggDO b-be eh ヘhk# #k cUE2"\gPH@:eGLBkZXgnpX2ia's"aJJGl[xg`3M -k ra*j"e0DJAg\gPDGsakKj"e0DJAgej @2ide\gg0D J@:e*"gG%阊@?e阧@?ejGQgudi+j^ @2i de\gg0D J@:eҞe8*'l(#g&%͙N`C``iC\ggX@:eLe͙`Aa\gX@:e"L@vd`CjKej @2ie d @2ide\gg0D J@:e*G0dB\kK2DdjKeej @2i de\g:e7'@1r4a8rXg0*g1$0&hE[%g,`FH*|gJpphCgi+ygpti؊nm@:e"kGfkg *ڎlڌdjudjKjjj} @2ide@$@ jFBL@'ka"!N K j AGr `G Z`Gr`Gr@`'r`j iGr`GrajK"eX1JAgBB"jl f jKLGjA%)@:e"ge*jKi˘ `[@:e"raJ!`|dIaB@D I JZa jlBf2klr'`r`r&a|gX9JT jVXJUjWGjA N2 Jk\gXUJFGjGjGjjl f jKL Za]gX1 B2B2r xgju`\gXUJFGjA 3 )@:e"ge "IaB@D I J )@:e"ge*j- *N K g L@:ee* Qg#`Cg C` `iC ` C` IC\gX @:eGi ek i Qk Qح*'jAjV )@:e"ge"IaB@D I JZa kV2ll nb53Kxغ3 LJK\Z`Z a\gXuJFGjj[xc-aZ^a0D@\T jVG@mJG@iJG@QJD@G@QJ\g@@@niOmMl@:eeJ"\gXJZ` )@:e"ge"IaB@D I JҜg{AC:Ld3 `l8Kd3m[؂ˮ3 Kӝ|gBxD2:Kik@8JD2IbDg[zYi{CT`vjKD OltH2Iac ` )@:e"ge?"IaB@D I Ja[` F [B8JD2Ibs`a JC"a F k[2*\gXJFGjAAGr ``T*\gXJ )@:e"ge"IaB@D I J7JD2I jlj3 JK{ژuyaJB{%C8Kd3m؂sEa JCa fjln3 JKl )@:e"ge "IaB@D I J )@:e"ge"IaB@D I J JCa fjl~3  JK ٘\T jV\gl@@:ee"\gXJn\ژUjWYD5lG@UJ\g@@:ee"\gXJPGjAY.a Z*a c !d` OPL` KL\g@?eCe D @!O P7lvDgD OltH2MAC Ңg` )@:e"ge "IaB@D I J@a :"Z8` i l F itH2M IC` )@:e"ge"IaB@D I J@a f  f  q%* *N K g L@:ee* Q@ J GjACgJ "eX JAg kL +@kL #\gX5 J{'j6klSA*lwDgD OluH2Iac ӣgD` )@:e"ge?"IaB@D I J* )@:e"ge "IaB@D I JscajK DOꑘIQ F kҫ`A[ 8` M l F iuH2I mc` )@:e"ge"IaB@D I J`A F  F @jl"\gXUJ lRs#scajK DO꒘ R؆ okc#alC!`\gXuJ )@:e"ge "IaB@D I J  *K N gL@:ee*kR S%`k iqcg`g qjM MJJa Q*"eX JAg S j"eXPJAgjK"eXJAgd $g %'@?ejGddjKeeej| @2iedgT nm@:e*)D4qjaDgioa+IJ)++@k@BL`!ʀb#mb@D2XJKMK-JJagkmd3S@ aMuNa#(@#q@a,m`;eomaMexg}1uLNan*ja((#s`kzL ԺH dgj)4〬$4gDQK-E5N- k yg#g`gC`gkd;eK(sayg@[`+g` - kkk  o aDaa4`e 〬nogo fh3mg.Bkd lo,# CD6FQLL1,.t" )AD2I@C0`l+`,ll g#Aalgew .A@Lc~`Cazokk@'oA& `9g?eMOdgoiygf;e]`ENadgm;eMK nygl 6agw`?eol'nc`9g>eENcIaMզgn9g,gw g?e` ?;`d8#\gXuJFGjA2Kkmg@ރ`KJAC`JDܯp8dM!$g9>eNְg+-Cm2`n)&g Na@@`-mC`)i9g9I*aCagZ6`"r aAL_kdgegqKjao-Cm`n)&g NaKޣLߣJĺ{`g`aNa?dgJZL?`"r`CDCDñ@ol /Oygla} 7\gXUJ@o /dAogMh3 jL.\gX5 J'jeeee\ RaExBܢI`¢xb3EBܢI`jXj\ܠRaxelDDDmJjaHD`DmJjaqlDDj@KCg*kt̢LܢHܢPܢ@ܠFFH2IdBp!(3m2B`N6!3db`H7A|ah08e0ygc an (mBBxaJB70`a+!BBx`N6gD2ej[ @2ide@gBk @ CjBP jBT҂gjKBaBPRaG2 \g XJ :e@g Je *BPa oBJH2IAa@ Bpng@:eBta@h3mA8KBt AT(3mH4ନ5%IBBXCaAEnBX]gN1AAga@!B @:eRe~`a JBTm nA0(1A A B D1L@g \gT@:e %jAl UXa, AHkJmd3 aLa b`d@"BPӡBJH2IBaimBKL5AS#`KӁBJH2IBah2QmmlBâhKh #IlAKLk(Je2IA\H3;egah3maKb`Lqg aB'ad1%!ܩegN!aH2I@MȘmh #gaIlILMdjB2I!|*#K!|!~LK!~TD2I!|K!|` R` jk i_#d3m!-KMjJH3m A|bah3m `ȘM$2 8Ji`CmjlLf3D5,@ J JeA d"honKh3mifEnk9e9g"`2dhoK `*.``H6aa|.!*0ahok"N&H3maܫNaˡ|K| S``K`dKdFggNM>egQgkhohoe dA"hnFEkj:ekB`3dhn@YgJD```=`h3mجaa>egdn?1`x@I`x@b3`eg1!Jx̢*@ "J@ ahnj:ج%,#3maa^egdnG1`!@%ܢx`✢x!@b3%`Jeg1 \ܢxYg򼬢جeg>dn?1`x@I`x@b3`eg1!JP1 ag륜1Eœx̵`eCœ5mâ|mwGXK|qDMHx̢i RZ``#go$1@`Ŝ1F8o ج!@%"6Mܜg1U&agNFgDme1CܢXm@ExBܢb3I`¢\kOJ\qg1J1DMMx̢ f%g$-i1`@Kج@6g1 S| agMEgDeCœ1mX@ExBœb3I`¢\kOJJ1DMKH:eKKgjhnhnj @2ie\g:e@ d*ª\egdhB1 a:jXuKi5ՠK80*5nACegd-1x`JG`圢xGb3`Ǣ|{i\ܢ@CaYgPP@JH2IaPgD-i{1`圢XGœK@圢XGœB2@ǢPg1g[ O6|,'gH1gnb1`eXCOm@eXCB2m@â|{Eg1|gN^Pd`7塨0g$-iУb1`eXCMm@eXCB2m@â|gPg1uygXxK`_#gH1goc1X`KE@ťXEB2@Ţ\_M|&7ख़ExBI`ExBb3I`¢HFegJ1x̢\3d|sXg*eCœmeCœ5mâX̢\ܠSaExBܢI`¢XB2X̢\J\ܠjz @2idegҐDDXXJ!@܁HD!DXJ!LqLD!PX𸝝J!XjX̒Mj\@=eDdej @2ide1Ң\gggdR&g1UaExȁB؂I`ExB؂b3I`¢\kOgg1J\\gx𸚐gRM@=eEaBIeqg`…QgDآ1B5ąoDآe`eC؂mlB2@!Beq C` )C `J `)C\g Xg@:eE%%udej @2iegdM@=eDdej @2idemҢ\جegdR1?aExBœI`ExBœb3I`¢\kOeg1J Rx̢\"aEBܢI`ExBܢb3I`jX̢\Jg\M@=eDdJJj9 @2ideҀDgR|a$DKraDDqgm%-KJ4axd+|a+h^+d@Z,JjajK\g@XgbgK;e@!@;e@gge\gܘ8g2 I@9e!Ș@@9e1@@:eme\gX{JI@JH2IC*MuaH4QGD JHآLLBN46`HragjmBgJC"a "g\gP<g@9ee\gg𸚒M@=ee"\gRM@=evd\xR=,L14agCgeCآ1mX@ExBآb3I`¢\kO1J\\gؚzNMgSO@?eem1JL1agCgeC˜1mX@ExB˜b3I`¢\kOdgB1O Wܘ!( aF1DgDme1C☢Xm@ExBb3I`¢\kOdgB1L Tؠag1GgDme1C؂Xm@ExB؂b3I`¢\kSggg1J R\؀aE1gCgeC؂1mX@ExB؂b3I`¢\kOgg1J\AEx:el|gx\{Kme`gKh3mRggd1ZaExȡBآI`ExBآb3I`¢\kKggg\1J\LYgxaD@g\ggXbgK;e@H@gg;e@"ge\gg1B*@F1DM1GLQg1DM1EDiE11JJj @2ie@aB`܂xI¢@aB`܂xI3`¢@aB`܂xI-6TJT΢@dnZ XgPMJP\g]PP@H2IxKx\gPT `@H2IhKh5@eeeeejY @2ide@@W"j@j \g H 8nMg@:ege;**j * j\gmD @:e"ge"! @kk!@ "`\g L@:eq `q`EA*i"h Pgdj Ҧ#EA*jgjy @2ide\g L@:eDdej9 @2ie\gXJ jj @2ieFD Z `j\g4pH @ lj @2ide\gP@:eDdej @2ieggd@=eDdeeee%x }$%x |$%x {$%x y$%x w$%x v$%x u$%x s$%x r$%x q$%x p$%x o$%x n$%x m$%x l$%x k$%x j$' '1.3.1out of memory%s%s%s: compressed data errorunexpected end of fileinternal error: inflate stream corruptrequest does not fit in an intrequest does not fit in a size_tout of room to push charactersinternal error: deflate stream corruptrequested length does not fit in intunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N60w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      @@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler   0@`  0@`  (08@P`p        L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c      4,)) )% %% % % %|L̫ث 5F6Cy9 % ||Šy13%3yDZbH9I%J1NNfegWUz`BEefq5gP@0 Чp`P07070101AE2286000081ED0000000000000000000000016A426C2800038927000000FE0000000000000000000000000000001A00000000usr/lib/libblkid.so.1.1.0ELF4t4 (p888pPPPtFtF R R R77hhh00QtdRtd R R R--  D @ RRdD  Ё2Pppp pp"p#pDop0ooo|2oo,."TjYA7 3WD*'/N0RQhcZ1}g?&m\OKn-C$UE@;FeLMfuaoxlzVr^p S"B<i>yb=62HJIP{G4(d9]5,:  )q! 8tX[s~`wvk_|.#+%     ! D D @qV We  F & H P5 5M 6 " q0 z U  & ! b= ( ! M y6 N ". =$e !VQ  l ` & )  UL A    " iWP mx    Q   v W  E5 ٭) L -(  " +!z f  M$  q$ ?  - & x $ I*  y E" 4 7 Qt| r& .JV{  %5 pF`+PM@0 ". E5 !k  qe c= 8I SpS `U" U Y y PZ@=   0E5} )    JP Yt KL 9$ _ L]%  p`sP@M0 m8< 49  d# )T]I ŨV 8p ` @P@T0o ) s h>`eE & U* @ | q" e  i $ 9  )$ up` =* ف \ PR@f]> 0C$ [  *) ["mv". |X 0o%j 8p `APo @0\  U UI $Yu9  A'I & ͍ J " p  `PA@0q  0 ^ "G;p`4"Pt@Z 0T 4 " c+ }J d p ` & )J 3xHp`P@5j $ 0J ?o 0 M_init_fini__cxa_finalize__deregister_frame_info__register_frame_infostderrvfprintffputcblkid_init_debuggetuidgeteuidgetgidgetegidgetpidstrtoulstrdupstrtok_rstrcmpfreeblkid_get_library_version__stat_time64blkid_get_cachecallocblkid_put_cacheblkid_free_probeblkid_gc_cache__stack_chk_guardfgetsfeofstrchrstrlenstrncmp__stack_chk_failfopenfcloseblkid_dev_devnamefputsblkid_dev_iterate_begin__errno_locationmallocblkid_dev_set_searchblkid_dev_nextblkid_dev_has_tagblkid_dev_iterate_endreaddirsscanfblkid_get_devblkid_verifyaccessblkid_devno_to_devnameclosedir__time64strstrdirfd__fstatat_time64blkid_probe_allblkid_probe_all_newblkid_probe_all_removablemempcpyblkid_devno_to_wholediskblkid_encode_stringmemcpyblkid_safe_stringstrnlenstrcpyblkid_send_uevent__fpendingferrorblkid_evaluate_tagblkid_parse_tag_stringblkid_get_devnameblkid_evaluate_specblkid_get_dev_sizemunmapblkid_new_probememsetblkid_probe_reset_buffersblkid_probe_hide_rangemprotectioctl__umoddi3lseek__assert_failmmapreadfcntlblkid_probe_step_backvasprintfmemcmpblkid_probe_get_devnoblkid_probe_get_wholedisk_devnoblkid_probe_is_wholediskblkid_probe_get_sizeblkid_probe_get_offsetblkid_probe_get_fdblkid_probe_get_sectorsizeblkid_probe_set_sectorsizeblkid_probe_get_sectorsblkid_probe_numof_valuesblkid_probe_get_valueblkid_probe_lookup_valueblkid_do_wipestrtoumaxwrite__nanosleep_time64fsyncblkid_probe_has_valuememmoveblkid_reset_probeblkid_do_probeblkid_wipe_allblkid_probe_enable_superblocksblkid_probe_set_superblocks_flagsblkid_probe_enable_partitionsblkid_probe_set_partitions_flagsblkid_do_safeprobeblkid_do_fullprobeblkid_probe_set_hintblkid_probe_reset_hintsblkid_probe_set_deviceposix_fadvise__fstat_time64blkid_new_probe_from_filenamefdopenstrrchrstrtoullstrtolstrndupblkid_get_tag_valueblkid_find_dev_with_tagmkdirfchmodunlinkrenameblkid_tag_iterate_beginblkid_tag_nextblkid_tag_iterate_endblkid_probe_reset_superblocks_filter__gettimeofday_time64blkid_parse_version_stringblkid_partition_get_typeblkid_partition_get_startblkid_partition_get_sizeblkid_partition_is_extendedblkid_partition_is_logicalblkid_partlist_numof_partitionsblkid_partlist_get_partition__udivdi3blkid_probe_reset_partitions_filterblkid_probe_invert_partitions_filterblkid_probe_filter_partitions_typeblkid_probe_get_partitionsreallocarrayblkid_known_pttypeblkid_partitions_get_nameblkid_partlist_get_tableblkid_parttable_get_idblkid_parttable_get_typeblkid_parttable_get_parentblkid_parttable_get_offsetblkid_partition_get_tableblkid_partition_is_primaryblkid_partition_get_nameblkid_partition_get_uuidblkid_partition_get_partnoblkid_partlist_get_partition_by_partnoblkid_partlist_devno_to_partitionstrsepblkid_partition_get_type_stringblkid_partition_get_flags__ashldi3__divdi3__moddi3__clzsi2__lshrdi3isxdigitblkid_probe_invert_superblocks_filterblkid_probe_filter_superblocks_typeblkid_probe_filter_superblocks_usageblkid_known_fstypeblkid_superblocks_get_nameblkid_probe_set_requestblkid_probe_reset_filterblkid_probe_invert_filterblkid_probe_filter_typesblkid_probe_filter_usagetolowerabortblkid_probe_enable_topologyblkid_probe_get_topologyblkid_topology_get_alignment_offsetblkid_topology_get_minimum_io_sizeblkid_topology_get_optimal_io_sizeblkid_topology_get_logical_sector_sizeblkid_topology_get_physical_sector_sizeblkid_topology_get_daxblkid_topology_get_diskseqpipeforkdup2setgidsetuidexecv_exitgettextwarnxflockprogram_invocation_short_namewarngetcwdrealpathwaitpidreallocsetenvprctlsecure_getenvsendfileexplicit_bzeromkostempumaskgetdtablesizereadlinksyscallstpcpy__bswapsi2__bswapdi2vsnprintffaccessatopenatfdopendirrewinddirreadlinkatvfscanfbasenamewcwidthiscntrl__ctype_get_mb_cur_maxmbrtowciswprintmbstowcswcstombslocaleconverrxstrtoimaxstrtodstrtold__fixdfdi__floatdidf__subdf3__muldf3__fixdfsiisattystrspnstrcspnfgetcisalnum__progname__environlibgcc_s.so.1libc.solibblkid.so.1BLKID_1.0BLKID_2.15BLKID_2.17BLKID_2.18BLKID_2.20BLKID_2.21BLKID_2.23BLKID_2.25BLKID_2.30BLKID_2_31BLKID_2_36BLKID_2_37BLKID_2_39BLKID_2_40GCC_3.4GCC_3.0GCC_4.3.0GLIBC_2.0            q e A $ A $ A $+ A $6+A $A6A $LA A $WL A $bW  $mb  $xm  $x $ T&y P&y `_' ii  RRRR R$R,R0R8RL@:ee* jlr`LL$028e@Dej @2idec$g0mXl@:e"ge["X`jl-"\@ D@:e|egD>K ~OM@:e*"g0IO^Mg@?eeGAJBC !"@"\@:e0Iٞeg@8e jwdܘ> N0\ljK jj6 @2ideҀ$g$gP@@:eX @kle*"\@ D@:e|egD>K ~OM@:e0IO^Mg@?eeKa k@l*"\@ D@:e|egD>K ~OM@:e0IO~ Mg@?eeB GAJnX*@=e󬘉e@=e eg@8eydP@=ee kJ @l-"\@ D@:e|egD>K ~OM@:e 𼘑gš0@MIJ@:eeP @=ee B Jn*P @=eejv @2ide$ g@6*a{dT @:exRke=`+#\@ D@:e|egD>K ~OM@:e0řIO6M@?eeP𤘑g@=e6Hebgjm6H@#\@ D@:e|egD>K ~OM@:e0𜘩 OL@?eejV @2iedgҰ\  Xg:e@gg8ee@ lvdej @2iedg\ @ Ұ\ mg@:ee *L @:eZeXgK=0L mg@:ee*L @:ee7"0Tg@:eIek`oB#a l+@ rR` rP`"#r`pD nMg@:eef*L@*j #0@8eX`jl*"\@D@:e|egDKM~O@:e𜘱gL0iO@?eejI\ IJO#hDK[` L`gCN^` Kg$IJ%+jC۞jpD nMg@:ee*󬘄@=eKe"\AL@:eeDzpD n Mg@:eei*I "GAJ @"BR 1`0L ,m@:e"ge"j@L M@:ee "L >M@:ee *j h3m@ JB?!AAX`jl"\ D@:e|egDKMg~O@:e >L8X`jl?"\@D@:e|egDKM~O@:e𜘱g^Lydj @2iedgXml@:ee""gjKC*0L𜘞 L@:eҞe*\~JXk @l*"\@D@:e|egD𼘾K~OM@:e0iOL@?eeT M@:eҞeP* `jl*"\@ D@:e|egD𼘾K ~OM@:e0iOL@?eeB*@jAjBD *\L@:eDٞeCJ*jC\"g@8eVL@:ee*0@Jg@:ee" `jl*"\@ D@:e|egD𼘾K ~OM@:e0iOL@?ee󬘄@=e󬘞e=e@ge@8eiQgwdj @2ide$g$g󬘄@=e eg@8eudeeeeeeeju @2iedgҰ\ $X@l *DgMg@:eeX ֑g@:eg8ee@ lvdj @2iedgXPml@:e"ge4"X`jl("\@ D@:e|egDK ~OM@:e0MJHg@8eGAJ !BCQgwdju @2ideO$g$gX`jl+"\@ D@:e|egDK ~OM@:e0řJOMg@?eeA`A`ڂGAJ*󬘆@=e󬘅e@=e eg@8ewdP@=eee$F* Ejej @2ideg ,𜘰  L@8ewd\$gŜ@𼘂gDM@:eDeʙ> M@:eoND홞e̙^M@:eDeș~M@:eDeЙ~M@:eBe GAJn" "ĚD M@:ee @0HL@:eeej @2ideҼg ,P@=ek`jddg=e@l"``dkbceL(jU @2i de$g'$`n#*g!% &g\@:e\e@:ee"*@=e e@8ejKvd肙@=e e@8eBCjL(j @2ide-jKudg$`n* @$AJ`@D- j\gØPg@:ee*eL(jU @2ide$`gn*a k@l*"\@ D@:e|egD𼘾K ~OM@:e0O L@?eeP𤘑g@=eHebgjmH"g@ jKejS @2i,de$HklgI"@l@:e@eg@ggR5`*\2`Xk@l'"\ D@:e|𼘞egDKMg:e~O@0mH?L@8ej pd0@@=e\?J ҂g@e@:eҞe "X k@l{"\ D@:e|egD𼘾K~OMg@:e0O _ L@?eeQJ \ ~JҢgL@:eeA"\ JҢgL@:ee3"0T @:eJ ҂gHe@:e"gea" ܘP  Ng@:e@eg@:e󬘞e ґg@=e e*pD@:ee*7J ҂gL@:ee "L @:ee"0T @:e"g0T e@:eEHIeg@:e Ҟe:*X @:eeX@:ee\ J @*0@A J@n@:eBe#*@l@:e@DHebgjmeHP@@8e ܘ P Ng@:e0@ k J@:e eܘP ?Ng@:e k@el("\ D@:e|egD𼘾K~OMg@:e0O L@?eA0  @ Ij@9e e@=eepD @:ee?*X @:eeX k @l*"\ D@:e|egD𼘾K~OMg@:e 0OL@?ee @@:e Ҟe * J'BkRkL I# raL𼘑g~M@:ee"L𼘑gM@:ee"p\𼘑g?M@:eey"L𼘑gM@:eem"pH @:egLeog@:ee[*jlrTa b3r3 @2mkKkl}g lm@" k@l+"\@D@:e|egD𼘾K~OM@:e  0@gJL@:eAg0  I2j @@9eepD @:ee_*X @:eeCjKxj @2iedg8j`l'"\@ D@:e|egDK ~OM@:e0ML@=e0@lJnm@:e @kle'"\ D@:e|egDK~OMg@:e0 HL@8e wdej @2iedg8j`l'"\@ D@:e|egDK ~OM@:e0M?L@=e0@lJnm@:e @kle'"\ D@:e|egDK~OMg@:e0 H_ L@8e wdej @2iedg8j`l'"\@ D@:e|egDK ~OM@:e0ML@=e0@ Jnm@:e @kle'"\ D@:e|egDK~OMg@:e0 HL@8e wdeeeeej @2iedgҰ\  Xg:e@gg8ee@ lvdejr @2idegA$0T@:e"ge :"g0T@:eeAQH@:eҞe""(!gP\ g@:egeP\n%M@:ege"P g@8egj@vdijj @2ied #r aR r` "S.rapD @:egey"R "JZ`Ekfjl"S.raT"J.r`pH @:eg@ KgL ӧ@e go M@:ee*kl ra ja ja0@ MJ:@:e?@Xe`@jl-"\D@:e|egDK~OMg@:e?0@ M L@=eeX @:egpH @:egLeo @O M@:ee*klr_`ZRr aL M@:ee_ "Hl@:ege_"0@ MJ:@:e@؞e*󬙐g@=ee,>@A>&ej @2idegc\ @ BҐ@o@:eeO*j\iJ @ ~*))D)X`@jl*"\@D@:e|egDK~OM@:e0 O L@?ee B`n"0@8eg\@:e"ge"X`@jl"\@D@:e|egDK~OM@:e0 M ? L@=eeHl@:eҞe"\ @:ee@ *󬘃g@=ee J`!"gX!`@jl+"\@ D@:e|egDK ~OM@:e0 OL@?eeP  =e@󬘀e@=ee@=ee*) A󬘀=e@󬘞eg@=ee)A󬘀=e@󬘞eg@=eeacQgdej1 @2ide\gD@:eEdej @2ie dg\ @E?T M_L@:eҞe*iL𜘱gL@:ee "\mg@:ee* ҂g\m@:ee*i0L  gM@:erea EjaL g@:ee*iD@:eX`@jle0"\@D@:e|egDK~OM@:e!ܘ_N0@ J EL@:ee ?`n "0@8eܘ_ NQg rdeeeeeeeT` jK@J"jK J"jKJ"jKJ"jKLL $ j j j j j j jej1 @2ide\g0@g.Jg@:e3"r3`egV,`Kjar/`r/`r'`r'`knlta?lNx3BaSaS'aabara1sajKDdkkkkrallt`l \rejq @2i de,jKwd""ij i@ *.")`j\g0@J@:eReg)a+a1C` C`` C\gTg@:e JIe CAc` J]g \r"`H@J Za!jKlJZ a\gg0LL@:ee "J`)I`\gܚ7PNg1@:ereaIej1 @2i dee$d%c&\gg\g@:ee=*k hmj@ @ "hBK^[3`H Ca ikjudߦ v`(FIY`LT`$' eKCE`g Na$#Kolmokl r`JZ`_jH@\gg0@J@:eReaAjKeeeej1 @2iedgҰ\  Xg:e@gg8ee@ lvdej @2idegc8\` @Ҁjl +"\@ D@:e|egD𼘿K ~OM@:e0 OL@?eeL?M@:ee*MPT5@:e5g0Te@:een[UPD @:ee *`jl*"\@ D@:e|egD𼘿K ~OM@:e0𜘎OL@?eeT @:ee "`jlq"\ D@:e|egD𼘿K~OMg@:e0𜘎ML@=ee|LM@:ee*MlL M@:ee*M[L?M@:ee*?MJLM@:ee*_M9`jl *j =#0@8e\ D@:e|egD𼘿K~OMg@:e0𜘎OL@?eejl raPL@:eecdj0 @2idegc8\` @Ҁjl +"\@ D@:e|egD𼘿K ~OM@:e0 OL@?ee*jK `n"0@8e "T@:eҞe*jl raob5lL5@2mMܘem7 Pg Nm@:eT eM@:e Ҟe"g0H @:eT e@:e @ e@:e D e@:e eo+9" *P\@:e@ re.``jl*"\@ D@:e|egD𼘿K ~OM@:e0𜘎O L@?ee`jl_ "\ D@:e|egDK~OMg@:e#*ܘN0𜘎O L@?ee*P\@:e` se``ڐjKҺܘNcdej @2i dej `$#Fg JV2H2IJ0aXkK@l&"\ D@:e|egD𼘿K~OMg@:e𜘐 LH@8ejvd耛KjKej @2ide\gnD@:eZXgDd Kej @2iedgҰDn@:e Ҟek"L2kH2Ii] F * aXkK@l%*jyd Ebg(2I@  -jlQ" 62H2IkG L@:ee6" J\ D@:e|egD𼘿K~OMg@:eL2kH2I] LH@8ejKkl" 62H2I䀚d`Iej @2idge G@]J*ud\gL0 M@=ege jn @2idegp!jKl$g=e@PwGAUJjes`X@bgjl)"\@ D@:e|egDK ~OM@:e𜘰ML@=eej W j9akK@l-"\@D@:e|egD𼘿K~OM@:e 𜘐  H L@8e WXzd j J c xgI J@bg J@g i c gi Ґ 0 MBL@=eej @2ideg  B bgCgixg ҉I OOa3*1`Xk@l&"\ D@:e|egDK~OMg@:e𜘐 _LH@8ejK{d7j\J. *"Pbg jmPj Paja C|a cxgCgcha+dah  # KIXk@l/"\@D@:e|egDK~OM@:e  M L@=ee0Dn@:ePe m@:e0De:e@nJe fPk lPk lj @2idePgbgl!+P\gP\ @:e`e"g\g P@@:e*jl"p@jmP@P@kwd lp@j @2ide "K ~OM@:e 𜙘OL@?ee\g@:ee[+"\@ D@:e|egD>K ~OM@:e 𜙘OL@?ee0\𼙐g M@:eҞe"jҰ\Amg@:ee*D@:e HebgjKl gH67Fg`n"0@mJ ҂g0L@:eg m@eL(?%\D@:e|egDKMg~O@:e @L왘O@?ee&@Di\\r?a\Am:e@e?"0Tg@:eBJer` J j@LI *0\l@:e Ҟe"pD nM@:ee|gx l*TH Уgg@:ee^"P\@:eg@reTa@ m@:eeJ"@rG`k@l)"\D@:e|egDKMg~O@:e L왙O@?eej @=e> Ien"󬙃g@=e dT @:eRe X`P\@:e@re[aj T M@:e  e @bgjl*"\D@:e|egDK~OMg@:e O aL@?ee *P\@:e@e ҈ *pX m@:eRe)`k@l"\D@:e|egDKMg~O@:e !LHjlra0T @:eBHHeg@:e Ҟe"gܙP gAN@:eL e@:eReg_ ag\m@:ee9"@bgjl*"\@ D@:e|egDK ~OM@:e𜙙O aL@?ee\g@:ee0\𼙐gM@:e Ҟe" >> a R a>HbgjKl>Hj T @:e@ e@:eD e@:ege@*;  *P\@:e@ re0`@bgjl)"\D@:e|egDK~OMg@:e𜙙O L@?ee j_` R `p@ @:ek@el_ "\D@:e|egDK~OMg@:e𜙙O L@?ee"G "pjl*E@/r`j I@bgjl0"\@ D@:e|egDK M~O@:eǘ.ܙ N𜙙OL@?eeNoʘLmD ӡM@:eeȘ &D M@:eeB G@Jn *DŘ M@:ee\ l@:e  0He@:e\ e=l@:e  EeҐ\"l@:ee"@ *\ "l@:e @e"r`\ra\ \l@:ee \@:eJe(P\@:e` se`ں0T @:eJ ҂gHe@:egeV"gܙP N@:ep@eg@:ePX eg@:ee2"@bgjl+"\@ D@:e|egDK ~OM@:e𜙙O gL@?ee󬙐g@=eeP @:ekel5"P\@:e@ Ҟe \D@:e|egDK~OMg@:e O !L@?ee) \D@:e|egDK~OMg@:e𜙙O AL@?eejjK"eLZJAgeeeeeeej% @2iedgҰ\ $X@l *DgMg@:eeX ֑g@:eg8ee@ lvdj @2iedgҰ\  Xg:e@gg8ee@ lvdej @2ide$gD$%Bg GAJn*i9 L@:ee2*Xk@l'"\ D@:e|egD`K~OMg@:e𜘐  HAL@8e Qgwd @ej @2iedgXml@:e"ge5"Xk@l("\@ D@:e|egD`K ~OM@:e𼘐 MHg@8eGAJ !BCQgwdejD @2ideP$gkX$g@l,"\@ D@:e|egD`K ~OM@:eLęJaMg@:eeA`󬘄A`bC=eA@`󬘅e@=e eg@8ewdej @2ide$gGAJ*hPgud\g L@:ee"ejD @2iedgH&g@:ee)ZXgknud " g@8eZXgjej @2i de"Bi jK Jn*2!pjl*Lg@:e"g"pjl* L@:ee* Dhb `pXm@:ee* $H @  *PP@:eR aj *kHl_*0X@:eR_a Җeej# @2iedgҰ\  Xg:e@gg8ee@ lvdej @2i$de Ҁ%$g%g@l@:eL MҰTe@:e Rev`Xk@l1"\@D@:e |egDKM~O@:e P\e@:eř! L옜O@?e eP\@:e@ oB[ea r aXk@l "\@D@:e |egDK~OM:e@Ӑ𜘜OaL@?ekCxgkMlB+aN,c&a=jZ*Oc4a*Nc a*Z`pjmPٻX@bgjlC"\@D@:e |egDK~OM@:e̙홥 > jZ*=ӁLC2 <NoҐLӜJ@:e e\()n@:e e_*JJ *\@:eJ eJS"0Pε@:e Re1`k@l"\@D@:e |egDKM~O@:e P\e@:eřLjJkӊPno@:e e"\@:e ePg@8eiQg ud0\g@:e Ҟe@@:e e["@=eJ mXe@:eJ jm0Xe@:eJ mPHe@:eJ mpTe@:eJ p@e@:e Ҟe1"P𤘑g@=e ieJ0\@:ejJk Pmeon@:e \e@:eDnog@:e e0Lm@:e eZ*LmNo)(kpJjmPJHbgjmJHJ҂gT@:e ҞeB?ak@l"\@D@:e |egDK~OM@:eGҐL(J)AL@:e et@l@:e Lٞem٤D@:e e(*҂gpD nM@:e e0*L!M@:e e*?MDg@:e eJ҄L!M@:e e* Mp\AM@:e e*eej`+.s`K [`H5U5Lej @2iegdgaL'%\aJ@X@:eDdeej @2iedgP$g@:ee"judTg@:ege "noaM@8e*Jjee32mm3m4l e a $ a%a"CXgk n j jej# @2ide M@=eej)#0@ J:e@ e`*@kKl`"D@:eegD@:eAL@:eee @@:e Xej0Do@:e Ҟe? "gP@@:ep@e Ԡo@:e pDe1^Ur a_r aJjB L@:e XV"@:eP*B L@:e Xeig- aCXgCa*``jJl("\@D@:e|egDK~OM:e@Ӑ> O L@?eJJrҗa Jj @:e Xe C"@:ee;"B @:e Xe ,`jJl*"\@ D@:e|egD𼙿K ~OM@:e> OL@?eeJJra]IJZaM ca\o@:ee0"`jJl"\@D@:e|egDK~OM@:e> OL@?eTj0Do@:eҞe"P@@:eep@o@:epDe@:ej( mygCXgCa2*/`@kKl"\D@:e|egDKg~OM@:e!L> M@=eeE*-c'a@kKl"\D@:e|egDKg~OM@:eA L JeRbawgP@:eme"\g@:ee*P@g@:ee*@g@:ere&`r&`r&`cr&`r&`raj|L2KI pHg@:eRe `"eL~JAgjjjjj " i cXg 0L @:eҞe*P\@:e@e"r`JjaX @:e Ҟe*T@:e Xk@Kle("\D@:e|egD𼙿K~OMg@:e> MaL@=ee b `D @:ege?* J wdeeee@n@5B3B5 @2mb@Cg1`3B2mcBCg1`3B2m Cej@ @2iedgҰ\  Xg:e@gg8ee@ lvdej @2iedgpL%g@:ee!j@0Lm@:ee *P@8e@Kwdkl"j~UsDas@akJds3aXK@l)"\@ D@:e|egD𼘿K ~OM@:e𜘐 HM L@8e!j@ټJKsajj  @2i de @2iedgҰ\  Xg:e@gg8ee@ lvdej @2iedj7 @2iedgҰ\  X֑g M@:eg8ee@ lvdj @2ide\gnD%g@:ee *\gP\@:e@"Kxdg\g\g@:e`g`h4m`j`3`3`e4m`m`̠`3`ΠB266m`oF2`36M55,+`["`zC `\``]`|@2m`~`3`3M`_@2mBWMCXg@3L2M5j D`+`a\gDg:e@gҞe@"1P 1MR@2@2-@2l 1MC "1QgCq LM `Z`* aBIHXkK@l)"\@ D@:e|egD𼙿K ~OM@:eLMCL@=ee@B30@20D2mjK i`Is ar@a DB30s ar aj `BIcagq4B3@2D24BCXgKijҰTkg @:e h3XKeT*jhj 9XkK@l4"\@D@:e|egD𼙿K~OM@:eBcҐL LJcL@:ee kJr@H ӊa@@h4m@j@`3`35m@m@`3@44m@o`3@@Ȣ4@ʢ@66@74@̢@΢@O66@2caNn+l` U XkK@l+"\@D@:e|egD𼙿K~OM@:eLM gL@=ee @23ŞD25m43d3646n,N- uTg vg wgCXg@2b4D2`3d3CcgJA Er`ra I YD n@:ee?KJdE@2m r`r ` *H@lnM@:ea`3날44mce`3 Oo0T @:ee"Qp@2mr`3`3MS@2m" K "X nN @@:eeH @M@:e@eܙ BN@@:eQ𲠀p@25m5MS@2ML e@:eQ𲠀p@25m5MS@2MP e@:eQ𒠀p@24m4MS@2e=e@M`q``3``𴠀44m`s`3e`ue`3`n55m`w[`3Xgm?e@M egDg@:e`Qe`Ҡ`p@26m6`M`U`@277M`W`s@2MD`3 m@:eje>L@noLm@:egegA`@2mb`3`3MC@2me`3놠44mg`3@g?enM@ Le g m@:eeXkK@l"\@ D@:e|egD𼙿K ~OM@:eLO L@?ee qdj @2ied"KudgJ Z7` \4`kĘg.-d*+kn&*X "X n@@:eeH @@:eL e@:e0 e@9ejjeeeeeej @2idmejlrg0aE4@34CB2cF2xgJI@23D2mҀ2D2 Ҁj\g TkӐg@:e"ge*\gP\@:e@ "K \g0X@:ee*jxd\gnP@cMg@:ee*AyNQgk C` g,B``Dg AASM1a\gl0Tm[gog@:ee" PZ`\gá@"Mg@:ee*j\g 0Pѐg@:eZXgknee32mm3m4l ej  @2ideI\gkXK@l1"|g\@ D@:e e|gg|~OK|gMD@:e e\gg𜚕OCL@?ee r`I#B3@2m1Z` ra嘀"\ggXuJ@:ege`Cg1`3B2m"gB1g1@24MC1bg1@2b3MEg1B2511ꥨh ?-A]?`44I#?aC?aKC`3gt3,?-c?`j\gTk no@:ege"n@:e  `3@44m@ae`3O0T ko@:ee"X A nM@:e Ae!M@8ejeeeeeej @2iedgD`n@:ee *P@8e@ "Kud"gPBH @:ekI𼘞eȡ`3@2 mMM@8ejjeeejj @2ideGf@2M&s`jwd$ggN.Ih@2mJ Z `Ml@24m4MO|g@2M\ng@:ege|gn\0qM@:ege|g \@ M@:eq`3뒠44mse`3k|gg0Tog@:e\g0X@:ee" a @`3M B @2@2m c`3M E@2 44M G@2ꄙ+en*ejJ @2iedgҰ\  X֑gM@:eg8ee@ lvdj  @2idejg\gkTg@:ee *\gP\@:e =)iQgxd"$2)aB\ggX bl@:egeA*"`knKC2S "JbgZa~kCgJ_"*@@NM@:eZ Xge?*0L@NNM@:e ZeXgjra*L𼙇@ML@:e e * T:*L𼙇@M.L@:e Ҟe,*Tr$`knKC2'oGg#[a"oaB#0L@M@:e ZeXgjjK"e XJAg*L@:e Pe@:e je"e XJAg*jjw"*jj9{deeee32mm3m4l ej @2idejj@jjJ\g𼚰Tn &Mg@:eie(2HJiJk@@2H2 `j\g T7@:ege *\gP\@:e )iQg~d+@}@\`3M@^@@2@2m7M\ggXJ @:e Ҟej ` a aN\gT +* r;a Z?aAM` caC`I#aTn@:eXJ@:eҞe + Z `i$L&g@:eP&eg@:epDM@:e me * ra ZaAM `"CXg*c`GA JCaTn @:eX J!@:e"g !@kKle,"\@ D@:e|egD𼘿K ~OM@:eX@Jgm L@:ee@&gM@:e>m"+Z`mBC`[amKmB2hej @2iedaC4aCm瀤`4mpghAah|`C=ew`a!u6a0-1E@1]d`kkm`3h3KmB8aUk`1d ,CaqKq0 t*@ }*xdJ J @ ,"0T @:e egpD @:ee* "X J@:e@WgX5 J@:eҞeHH\J J @ 5"0T @:e egpD @:ee*0L /m@:ee" "X J@:e@WgX5 J@:eҞeHH\ JjX @2iegdl@=eDdj8 @2iedgҐT@:e"g\e@:e.e"jvd0P@:e"gPe@:e.e*ҰXnoml@:ee"P @8eeeeeej @2idej jk\gTm@:eFdejx @2idegi, j\g D ng@:eRe `\gP\@:e@ re`rar `J\g(L@1@@2-I%gLn=1*17-%efgN-@b1|3 - m%glN9166 - Ti+%EGgn)B1>1@@2 - `I%gLn = 1 *17@- mefgNg @b0|3 m e8g!eglgN066 e8e9gg!I:eGgng B00@@2 IgLn775 }bgNb7t3mgnL766 ]CgnB7@2X2`IgNl775@}bgNb7t3 @mgnL766 ]CgnB7@2X2 IgNl775 }bgNb7t3gmgnL766]CgnB7@2X2 IgNl775}bgNb7t3`mgnL766@ Ign]27 7MFg=eglg005 8e9g!miB3P2 mImggN@b6`3l3 mgNn7676ggn775뷵]CgB7P2ImgN}@377mmgNy36b36 mڳmbgb55`3ԵmIgnU25MβIgn]@277MȲICgB6@26@2¶ImgNy3f36 mmgNu35m mbg@b7`3l3뱷mIgn]27B27M﫲IgnY2F26MIoB5X2ꟵIuMb5`3h3뚵gmmN@577On66@5 퍶oE926MImiB3@2H2 mꂳImM}@377m|mNb55@`3 vmOm65pYnB6@2H2jIoM@766d}Nb77@`3^mOm75 Y]nB7@2H2SIoM@766 M}Nb55@`39dabcI CexjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆj @2i deD3MC$ggd`eKe@b3meN2?kl>"GAJq@jkc|gXg"`IC``ICg@?evd0`GAQJCag@?eAe\gMg@?eAJeI@ZGAJg\gT`7`cagg@:eI`CgAKgA`QKcaAg@nL@:eAe\gMg@?ee@HJKc`g@A9KLc`mcej5 @2ideD?ngEN2KMejk=#xgUygnxgU&g ;e yge3;exg`7ygmxgf36mexxg>e9#xgygnx&gg e fggg7eg`76f3 U>e9#gggI#IcgU\g&X#",J@:eqd@aBcDe8Fgnj  CgO'=‡녱y7ly[ֵ'`O'=y5zNacwgV/' jej @2ied|gjH*o@8eddoej @2ide\g0lH@:eDdj @2iegd@=eDd jjs @2iegd0n+O@?eDdjS @2ide$L~M@:ee3*jqPِT@:e\e@:eNe.#qPmqPٰ\@D@:eeOgM@8eqP*qPkmqPwdq0P@:ePe@:eNe+$BJBܠej @2ide@gRaOnnM L@8e$g "g\@:eҞe="󬘃@=eC0Deqpjl*jwd\@ D@:e|egDK ӥOM@:eHMg@8e jKDg$Cj @2ideg$g %\g@:eҞeI"T a\@:ejKe@󬘁@=eA0Deqpjl*jwd\@ D@:e|egDK ӥOM@:eHMg@8e jKeDg$AjP @2iedg0Dqpjl)"\$g@ D@:e|egDK ӥOM@:eMHg@8ewd jDg$Pe jj @2ideg,OnML@8e@R`XJ@:ege "pm@8eZXgddjjejP @2ideg,OnML@8eA$g*OnML@R`XJ@:eҞe*P@8e@Kwd0Dqpjl+"\@ D@:e|egDK ӥOM@:eO%Mg@?ee0@8e@ejP @2ideg,OnML@8e@$gR9a0Dqpjl*"\@ D@:e|egDK ӥOM@:eO%Mg@?ee@8ejK@wdj @2ide\$B$gJRBV`g0Dqpjl*"\@ D@:e|egDK ӥOM@:eOEMg@?eeP"𴙑g@=ee򼘑g@=e󬘁e@=e󬘃e@=e eg@8ewdej @2iedgXml@:eeK""g0Dqpjl*"\@ D@:e|egDK ӥOM@:eOMg@?eejBJ@"gP քA@:eReaA*pg@8eiQgxde$@OB2 jj @2i degC'XJ ֧g:e@!e!`/saI"`/saJ/dO)$L~M@:ee3*j@ِT@:e\e@:eNe.#@m@ٰ\@D@:eeEOgM@8e@*@km@wd0P@:ePe@:eNe+j @2iedg0@@:e"g eG"F!$p@=ejeB "0󨘂g@=ee B0D`jl'"\ D@:e|egDKEOMg@:e 2HeM@8ejvdjKej @2ideg& \o @ 3L ll@2r3mkKkl}g lܘmPN.mg@:e0L eg@:e Ҟe*@ @:eRea0@ @:e"g0DeO)`jl)"\ D@:e|egDKEOMg@:e2O M@?eeX ml@:e"ge\"gܘ0D N@:e0P es M@:ee`jl*"\@D@:e|egDKEOM@:e2O M@?ee @ ApL@:ee `n"0@8e jK  qdej  @2iedg0T l@:ee""g"g0Xg@:ee0\ g@:ee "pg@8eiQgwd0D`jl"\@D@:e|egDKEOM@:eM2Hg@8eej, @2ide\g0@@:e"BDdej  @2ideaL/mg@:ee+"B0Tg@:eeBB(a`C`C`CTg@:eM@=ee"#00@9ejAcdej, @2ie dg\k @kOR L &g# rhaD!@/r aL/mg@:ee["!B0Tg@:e J҂g0Te@:eCe"`pDgg@:ee*"i`ps aAJ ZXg O,#0@8eK [P ܘ mOM Ng@:epH e@:egHeong@:eZej zdj, @2iedgpLm@:ei"\SJ@:ege*@8eQgvdpT @:e"Ij @2idegj pLk m@:e .*jkopT ng@:ee!"P@ܘINg @:ee* jaPDܘF Ng @:ee "\ SJ@:e"ge*X @:e0D`jle)"\ D@:e|egDKEOMg@:e 2HM@8e ydej @2iedgpLM@:e"i\SJ@:ee*@8e!󬘑g@=ee@8eiQgvdB\ L@:e"gej+ @2i degj P nm@:eDeo@:eReUa"gPH@:ege"PL@:eePL M@:ePPe:e@gPTe n@:e"ge" a#`C`C`CTg@:eeP@8eQg{diij+ @2ide"QgwdXܘN @:eRea !pDnEMg@:ee*L-mA@:ee"AKB1pDngeM@:eZe8g @8ej  @2idcec<g@1Ңg\J@:ee"T@:eZeXg#0@8ejcdj @2iedgc< @n 3Ңg\J@:ee *j 1#0@8eT @:eҞe* ҢgPn@:eReaJi |p\@:eZXgkencdej* @2iedgc< @"j pDn  L@:ee *j"I#0@8e *\dJ  ܘP Nm@:eReaJZ`T M@:e Ҟe"g@  M@:e D e@:e rea Acdej* @2idegc\ @  ,\dJ *On& MdL@8epD n L@:ee+*T @:ee* j @=e e@=e `en"0@8e J \ @:e Ҟe"*j "#0@%X5l@:eҞe&"c`PP @:ee" \J@:e @pL e:e@g"ge@=eQa k)`Qgvdj?j' @2iedg0T@:ePe@:eZeaPPnl@:e!Be)jl*jh jҖ\g(0Hѐg@:eҞe*jl"8t#`\gPP@:ee"k |j !(JJ"), 0g;*@`B\ggH@:eҞe6*jl"j\ggX@:ee*j@j I\gIPT@:eaBe#KOaAgh \gpLnl@:ee\g\J@:e"ge\gpLg@:ee#a`# 3"JI r>`r `0g"\g0@[,...]|" debug masks: %-8s [0x%06x] : %s info about all subsystemsblkid tags cacheconfigconfig file utilsdevice utilsdevname/proc/partitions evaluationdevnoconversions to device nameevaluatetags resolvinghelpthis helplowprobesuperblock/raids/partitions probingbufferlow-probing buffersdevices verificationreadcache parsingsavecache writingtagtags utils[%p]: Device %s exists/etc/blkid.tab/run/blkid/blkid.tabBLKID_FILE/rundefault cacheCACHEalloc (from %s)freeing cache structfreeing cache tag headswarning: unfreed tag %s=%sfreeing non-existing %syesCONFIGconfig file: missing newline at line '%s'.SEND_UEVENT=CACHE_FILE=EVALUATE=udevscanconfig file: unknown evaluation method '%s'.config file: unknown option '%s'./etc/blkid.confBLKID_CONFreading config file: %s.%s: does not exist, using built-in default%s: parse errorDEVallocfreeing (%s) dev: NULL dev: name = %s dev: DEVNO="0x%0lx" dev: TIME="%lld.%lld" dev: PRI="%d" dev: flags = 0x%08X tag: %s="%s" tag: NULL ..DEVNAMEopening %s%s: (%d) %mdevice: %d:%dsearch canonical %s%s requested, found %s in cachedm-/dev/mapper%s/%subi/dev/mapper//sys/block/%s/holdersmd/sys/block probe /sys/blockchecking %sremovableext_rangeread device name %s%s/size Probe partition dev %s, devno 0x%04X Probe whole dev %s, devno 0x%04X freeing %sPROBEdon't re-probe [delay < %d]/proc/lvm/VGsprobing LVM devices under %s%s/%s/LVs%s/%s/LVs/%sProbe LVM dev %s: devno 0x%04Xprobing UBI volumes under %subi_ctrlProbe UBI vol %s/%s: devno 0x%04XBegin blkid_probe_all()End blkid_probe_all() [rc=%d]Begin blkid_probe_all_new()End blkid_probe_all_new() [rc=%d]Begin blkid_probe_all_removable()End blkid_probe_all_removable() [rc=%d]/dev/devfs/devicesDEVNOfound 0x%llx at %sshmdirectory %sblkid: couldn't find devno 0x%04lxfound devno 0x%04llx as %sisis NOT/proc/devicesBlock devices: %d %64[^ ]major %d %s associated with '%s' driver#+-.:=@_\x%02xEVALUATEevaluating by udev %s=%s/dev/disk/by-uuid//dev/disk/by-label/PARTLABEL/dev/disk/by-partlabel/PARTUUID/dev/disk/by-partuuid//dev/disk/by-id/unsupported token %sexpected udev link: %sfailed to evaluate by udevSUCCESSFAILED%s: uevent '%s' requested/sys/dev/block/%d:%d/ueventwewrite failed: %s%s: send uevent %sevaluating %s%s%sevaluating by blkid scan %s=%s%s=%s evaluated as %sBUFFER remove buffer: [off=%llu, len=%llu]LOWPROBEallocate a new probeallocate a probe clone free value %sresetting resultsResetting %s valuessaving %s valuesappending valuesfreeing values list%02Xincorrect checksum for type %s, got %*s, expected %*sreturning %s binary dataprobing filter inverted%s: a new probing type-filter initializedResetting probing buffers buffers summary: %llu bytes by %llu read() calls hide-buffer overflow (ignore) hiding: off=%llu len=%llu read-buffer overflow (ignore) too large read request (ignore) read-buffer out of probing area (ignore) reuse: off=%llu len=%llu (for off=%llu len=%llu) read: off=%llu len=%llu read failed: %m mprotect failed: %m../libblkid/src/probe.cbf->off <= real_offbf->off + bf->len >= real_off + lenfcntl F_SETFL failed to set O_DIRECTfcntl F_SETFL failed to clear O_DIRECTchanging probing area: size=%llu, off=%llu -to-> size=%llu, off=%llustep back: moving %s chain index to %dstep back: moving to previous chainassigning %s [%s]SBMAGICSBMAGIC_OFFSETPTMAGICPTMAGIC_OFFSETSBBADCSUMreturning %s valuenotdo_wipe [offset=0x%llx (%llu), len=%zu, chain=%s, idx=%d, dryrun=%s] %02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02xzeroize wiperwiper set to %s::%s off=%llu size=%llustart probeend probeENABLEDDISABLEDchain probe %s %s (idx=%d)wiping all signatureswiping one signaturechain safeprobe %s %schain fullprobe %s: %spreviously wiped area modified -- ignore previous resultsupdated hint '%s' to %llunew hint '%s' is %llu magic sboff=%u, kboff=%ldresetting hintsfree probeYESNOfailed to get device sizeno UBI char devicearea specified by offset and size is bigger than deviceignore private device mapper deviceCDROM: read sector %llu failed %mCDROM: full size availableCDROM: reduce size from %ju to %ju.session_offsetready for low-probing, offset=%llu, size=%llu, zonesize=%llu, iosize=%lluwhole-disk: %s, regfile: %sfailed to prepare a device for low-probingallocate a wholedisk probeskipping re-read of %sreading cache file %sREADline: %sfound device trailer %9sblkid: missing ending: %sblkid: empty device name: %sfound dev %sunbalanced quotes at: %stag: %s="%s"PRITIMEblkid: device %s has no TYPEblkid: bad format on line %dTAGlooking for tag %s on %s devicein cachefrom disklooking for %s%s%s %s(null)SAVEskipping cache file write/run/blkid//run/blkidcan't create %s directory for cache filecan't write to cache file %s%s-XXXXXX%s: fchmod failedwriting cache file %s (really %s)device %s, type %s%s unlinked temp cache %s%s.oldcan't link %s to %scan't rename %s to %smoved temp cache %sfound cache tag head %sfreeing tag %s (%s)update (%s) '%s' -> '%s'setting (%s) '%s'creating new cache tag head %strying to parse '%s' as a tagparse error: '%s'looking for tag %s=%s in cacheblkid_verify: error %m (%d) while trying to stat %sreturning unverified data for %sneed to revalidate %s (cache time %lld.%lld, stat time %lld.%lld, time since last check %lld)blkid_verify: error %m (%d) while opening %sPART_ENTRY_PART_ENTRY_UUIDPART_ENTRY_NAME_ID%s: devno 0x%04llx, type %s2.41.516-Jun-2026aixGEMBGMLNXSWPRAWatariXGMfreebsdnetbsdopenbsdWARNING: BSD label detected on unknown (0x%x) primary partitionWARNING: ignore %d more BSD partitionsWARNING: BSD partition (%d) same like parent, ignoreWARNING: BSD partition (%d) overflow detected, ignoreWEVmissing boot indicator -- ignoreprobably GPT -- ignoreprobably FAT -- ignoreprobably NTFS -- ignoreLVM2_memberempty MBR on LVM device -- ignoredosparse EBR [start=%d, size=%d]Bad offset in primary extended partition -- ignore#%d: EBR data partition outside extended -- ignore#%d: EBR duplicate data partition [abs start=%u] -- ignore#%d: EBR link offset is zero -- ignoreEBR link outside extended area -- leaveEBR link does not advance -- leavechecking for subtypesU #%d valid PMBR partition checking for GPT header at %lluGPT header corruptedGPT->MyLBA mismatch with real positionGPT->{First,Last}UsableLBA out of rangeGPT header is inside usable areaGPT entries undefinedGPT entries unreadableGPT entries corruptedEFI PARTgptGPT entry[%d] overflows usable area - ignorePMBRmacmac: map_count too large, entry[0]: %u, enforcing limit of %umac: inconsistent map_count in partition map, entry[0]: %u, entry[%u]: %uWARNING: minix partition (%d) overflow detected, ignoreminixpartlist reset%s: ---> call probefunc()%s probefunc failed, rc %d%s: <--- (rc = %d)parts: create a new partition table (type=%s, offset=%lld)parts: add partition (start=%llu, size=%llu)parts: ----> %s subprobe requested)ERROR: parts: <---- '%s' subprobe: overflow detected.parts: <---- %s subprobe done (rc=%d)ISNOT=> checking if off=%llu size=%llu covered by PTpartition #%d overflows device (off=%lld size=%lld)<= %s covered by PTPTUUID%.33s-%02xparttrying to convert devno 0x%llx to partitionfailed t init sysfs contextstartdm/uuid-mapped by DM, using partno %dsearching by offset/sizenot found partition for deviceparts: initialized partitions list (size=%d)--> starting probing loop [PARTS idx=%d]PTTYPE<-- leaving probing loop (type=%s) [PARTS idx=%d]<-- leaving probing loop (failed=%d) [PARTS idx=%d]parts: start probing for partition entryPART_ENTRY_SCHEMEPART_ENTRY_TYPE0x%x0x%llxPART_ENTRY_FLAGSPART_ENTRY_NUMBER%jdPART_ENTRY_OFFSETPART_ENTRY_SIZE%u:%uPART_ENTRY_DISKparts: end probing for partition entry [success]parts: end probing for partition entry [nothing]partitions probe done [rc=%d]detected corrupted sgi disk label -- ignoresgi AWARNING: unsupported solaris x86 version %d, ignoresolarisWARNING: solaris partition (%d) overflow detected, ignore `detected corrupted sun disk label -- ignoresunSun VTOC sanity=%u version=%u nparts=%uھ)WultrixWARNING: unixware partition (%d) overflow detected, ignoreunixware `%uadaptec_raid_memberapfsNXSBbcachefs: unknown checksum type %d, ignoring.%u.%uUUID_SUBLABEL_SUBbcachefsƅsNEʂeHmƅsfΐj`π=bcachebe:volume_idlittle-endianbig-endian%016llxbefsBFS11SFBbfs-FVE-FS-R-FVE-FS-X-FVE-FS-XMSWIN4.1BitLockerceph_bluestorebluestore block device(btrfs) checking conventional zone(btrfs) checking #%d zone [start=%llu, len=%llu, sb-offset=%llu](btrfs) write pointer: %llu sector(btrfs) unknown checksum type %d, skipping validationbtrfs_BHRfS_Mcs_fvault2CScramfsE=((=Eddf_raid_member%llxv08v09drbdtktltmv%lludrbdproxy_datalogDRBDdlh*drbdmanage_control_volume$DRBDmgr=qvEXFAT %02hhX%02hhX-%02hhX%02hhXexfatexfsEXFSext2_sb.compat = %08X:%08X:%08XEXT_JOURNALext2SEC_TYPELOGUUIDext4devSext4ext3jbdf2fs gfs2pgfs bad allocation size - ignoreH+HXBDhfsplushfshpt37x_raid_memberxZxZhpt45x_raid_memberIHPFS%02X%02X-%02X%02XhpfsI%c%c%c%c-%c%c-%c%c-%c%c-%c%c-%c%c-%c%cCDROM%/@%/C%/ESYSTEM_IDVOLUME_SET_IDPUBLISHER_IDDATA_PREPARER_IDAPPLICATION_IDBOOT_SYSTEM_IDJoliet ExtensionHigh Sierraiso9660CD001Intel Raid ISM Cfg Sig. %6sisw_raid_memberjfsJFS1JMjmicron_raid_member1.01.21.1%u.%u.%ulinux_raid_member$XIDE$lsi_mega_raid_memberSUBSYSTEMLUKSSKULHW-OPALcrypto_LUKSLABELONEDM_integrityDM_verity_hashDM_snapshot_cowSnApLVM1_memberHMLVM2 001minix version %d detected [%s]BEh$x$$h$xZMMZmpoolmpoolDev%u.%02unssSPB5nilfs2: primary=%d, backup=%d, swap=%dnilfs2NTFS: sector_size=%u, mft_record_size=%u, sectors_per_cluster=%u, nr_clusters=%llu cluster_offset=%lluFILE%016llXntfsNTFS ReFSNVIDIA nvidia_raid_memberocfs1ntocfsMOUNToracleasmORCLDISKocfs2OCFSV2ocfsOracleCFSPromise Technology, Inc.promise_fasttrack_raid_memberJR3.63.54reiser4ReIsEr4reiserfsReIsErFsReIsEr2FsReIsEr3Fsromfs-rom1fs-silicon_medley_raid_membersqshsquashfs3hsqssquashfsPOOL_UUIDBLOCKDEV_SECTORSBLOCKDEV_INITTIMEstratisfilesystemraidcryptootherunknown*** ignore (noscan flag)*** ignore (size <= 1024)--> starting probing loop [SUBLKS idx=%d]filter out: %s[%zd] %s: call probefunc()USAGEfailed to set result -- ignore<-- leaving probing loop (type=%s) [SUBLKS idx=%d]<-- leaving probing loop (failed=%d) [SUBLKS idx=%d]ERROR: superblocks chain: ambivalent result detected (%d filesystems)!a new probing usage-filter initializedVERSIONBLOCK_SIZEFSSIZEFSLASTBLOCKFSBLOCKSIZELITTLEBIGENDIANNESSLABEL_RAWUUID_RAWsuperblocksincorrect swap versionnot set last swap pageV SWAP-SPACE0SWAPSPACE2S1SUSPENDs1suspendS2SUSPENDs2suspendULSUSPENDulsuspendtuxoniceLINHIB0001linhib0001swsuspendswapsysvxenix+UDDU+UBI#w%dr%dubifs1NSR02NSR03BEA01BOOT2CDW02TEA01OSTA Compressed Unicode%02x%02x%02x%02x%02x%02x%02x%02x*OSTA UDF CompliantLOGICAL_VOLUME_ID*UDF LV Info%x.%02xudf%08x%08xufsvdodmvdo001 look for label in root-dir (entries: %u, offset: %llu) found fs LABEL at entry %dJFS HPFS JFS/HPFS detectedFAT16FAT32FAT12msdosRRaARRdArrAaNO NAME LABEL_FATBOOTvfatMSWINFAT32 MSDOSFAT16 FAT12 FAT via_raid_member%02x%02x%02x%02x-%02x%02x%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02xVMFS_volume_member VMFS^/vxfsXFSBxfs_external_logxfsleft %zd nvp_size %unvlist: size %u, namelen %u, name %*sguidstatetxgnamenvstring: type %u string %*snvuint64: type %u value %llupool_guidashiftversionprobe_zfszfs_memberzonefsSFOZerofs%luinitialize topology binary data--> starting probing loop [TOPOLOGY idx=%d]%s: call probefunc()MINIMUM_IO_SIZELOGICAL_SECTOR_SIZE<-- leaving probing loop (type=%s) [TOPOLOGY idx=%d]<-- leaving probing loop (failed) [TOPOLOGY idx=%d]ALIGNMENT_OFFSETOPTIMAL_IO_SIZEPHYSICAL_SECTOR_SIZEDAXDISKSEQtopology/usr/local/sbin/dmsetup/usr/sbin/dmsetupdevice-mapperFailed to open pipe: errno=%dtable-j-mFailed to execute %s: errno=%dFailed to forking: errno=%d%lld %lld striped %d %d dmevmsioctl/usr/local/sbin/lvdisplay/usr/sbin/lvdisplaylvmStripesStripes %dStripe sizeStripe size (KByte) %dsysfsalignment_offsetqueue/minimum_io_sizequeue/optimal_io_sizequeue/physical_block_sizequeue/daxdiskseqwarning: %s is misaligneddiskprinterprocessorwormromscannermo-diskchangercommenclosurerbcosdno-luntapeLOCK_BLOCK_DEVICEnonblocknounsupported lock mode: %s%s: %s: device already locked, waiting to get lock ... %s: device already locked%s: failed to get lockOK /dm-%s/sys/block/%s/dm/name/dev/mapper/%s./../lib/crc32c.c(exclude_off + exclude_len) <= sizeLANG=LANGUAGE=LC_BASH_ENV=ENV=HOME=IFS=KRB_CONF=LD_LIBPATH=MAIL=NLSPATH=PATH=SHELL=SHLIB_PATH=/tmp/TMPDIR%s/%s.XXXXXX/proc/self/fd/proc/self/fd/%d../lib/fileutils.cssz > 0../lib/strv.cULPATH_DEBUGulpath../lib/path.cpc->dir_fd < 0CXTnew prefix: '%s'new dir: '%s'(re)set dialectpcpc->dir_pathopening dir: '%s'closing dirdealloc%s/%s/%saccess '%s' [no context, rc=%d]access: '%s' [rc=%d]stat '%s' [no context, rc=%d]stat '%s' [rc=%d] [redirected]opening '%s' [no context]opening '%s'%sduplicate dir path reading '%s' fscanf [%s] '%s'%lldulsysfsdeinit%s redirected to parentULSYSFS_DEBUGnew parent/sys/dev/block/%d:%dalloc new sysfs handlerinit sysfs stuff%s/start%s/partitionpartno (%d) -> devno (%d)slaves/sys/dev/block//subsystem/removable/sys/dev/block/removablefixedLVM-stratis-1-private%u:%u:%u:%u%s%s/devices/%d:%d:%d:%d/%s/sys/bus/scsi%s%s/devices/%d:%d:%d:%d%s%s/%s_host/host%d/%s/sys/class%1023[^ ]%s%s/%s_host/host%d/dev/%s/sys/block/%s/hidden../lib/sysfs.c%s/sys/block/%s/%s/dev%s/sys/block/%s/dev%s/sys/block/%s/device/dev/sys/dev/char/%u:%u/sys/kernel/cpu_byteorderlittlebig/sys/kernel/address_bits../lib/buffer.cbufKMGTPEZYkmgtpezy%s: '%s'neveralwaysautoBKMGTPE%d%s%02llu%d%s'"../lib/strutils.coptstr*optstr%zu,%zu,%zu-%zu,0xy x p@blkid_probe_get_bufferۘ9֗0eC@ @d n;0&AvQkkXaMjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ul_crc32c_exclude_offsetkp;P5&dXي۲x8(k;CML('x$<^o^lD5☷e4pPsӯ% 6ĠhW{Tl׉]vHx&KMNގ )*}3'šL6i5wdUX_K%4Am •1Ō~I0ʈF9E#y]YBZ-)~:}QHa[ja}bˏun{AKm@H+Rᆠ tTgWysEp95*l8 oQS!h%QYN$')uBMd;=w8):qf e]6baa`r}\~7TtgG HtZ$ Y8O\,E,F? Tq$b@iD9W0R A* 5|z6ݛ<*)h/x;{pKcȦglEd/W_3̦K6 PQpCRF"eNRMсvi(jnڞɝ;vzuc 3Xr~@>.S=Euf!"f*8Zٜ+V>= mN&ǥ13V"0۱2|,,/BG ~TI?oZΎj|oӨb!\2_vI"Cr@d Yg:a1JZJ{.xl^0+[ [`?$O7is"҈!zgs\=HO>#uonvU>j4i{Ɲ՞ '7y܋MGNj-#FLR_QS}6B&mSᅵ[><"BEf3ILڨ ]j|yD"مf-oa-ИQO] wUa5ϪU-$KGXAi^nDx=f| 9$5(ZjZ,0i/_I7Qmwm徭2d<Q\du[j%Uw1ߢwqZvIJ3&0h+38;x yz !zM=)fr(2IkPk /IkQv'U|mTՆXB`F=u=^䬔FnՉxI >30[/,ۺUS`Β e: y>1"GhJ/K2~}f`^.KϋWlX5u&6\O顑Jh%mg21%;t|*bEbTG{=0Dq1n.ůL_lDt9xVڛ?]O*`?~i-\Ch%Y*)pθڏrH%DV#{; N[Bpj28šHp)SC UPq9Ru {..t2l`vGG$3@!tԠHg-e5%I!c1Y] .lt2}^B+ .&sx/ 1psɿnb94 R@(:NxsaJ)d]ȡl&Uc2}v AoO-?w_o,!<،N˕3m"?ǐ9D|7^&Wzn+{JpE8\HFF(VQX^Q@Eb@)sh sC7KVb e's*\?:Ipx5%a$Ϧ6̓Rzrs_YC1gRyȍFPt@>^9ˠb-JorJ6N|_%T''}4d̜&l\oe+Mڗğ\I.6N#R…  kn~W{RoMl8(B#JyA+dNAc:Kx*v =w'Ż ($3@U^,qc>>n8$W`m=e0{`<'GB-"cݢ\ۋ_+Ϻ1"iz؈x;qc y`MVs,Z M͎Kr6;&o0 п*JU~2+kT\#ϸӍ< oA AQ)Z:ggSij :S ?вKTdHwE]Rqlx5ӒgJF2vپFV<^*hwu3IdeL4'߸opp5F 븳W,VBSRnrK;0w7&P]kZ;] ] y{210d^ٞ|&n@햏>HuYfBLA 7>(ϟԁ{{*Z{GjJlҬ*m:_4C.VKo-ia?YcӲ4]!Q%og &ul_reopen/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqul_strv_removeul_strv_splitul_path_close_dirfdul_path_get_dirfdul_path_is_accessibleul_path_set_prefix__sysfs_devname_to_devnoul_buffer_alloc_dataul_buffer_free_dataul_optstr_nextDADpDt\4xd0 @ $0<` h|t x     @ 4  x)   ]*]* 2e4$ XY7!;<9>@ \Ch||| Ah5S     Ib   ,d<d @@ @ @,k8X<)mDLTntUq|<<<@Qst Mw{ px8|mx8x8Tx8x8aQ@@)  )HP)    DaTaX d!1Mɨ33 08!D !HHHHݫx|pax3Ѿ A 1LQT@\Ah4t @4 @4h@4h%qH"j`Pe9#-"" " " # " " " # " ?" ?" ?# ?" " " # " " " # $#U" " " " " ?" ?" " " " ,#!4#<#@#0QD#T#a\#$t#  |#    #  d#  l#  #   $$$($%%R%R$%6,%68%6D%6P%T%X%%%%%%%%%q &5%&)&1&&!&@(qq)))T)\A#)$++++++++++, ,, ,(,SSSc@WPVpU  33))!)U))*     RUV$TTTUWS@WPVpUHSfe]de@zokmc0cWXeX0X([<]<^]gg(gfpf8fxzDvhx Z(\xps{{^P__`d``CYH!XZI[[I\}}}|=IQ!C=ٌMI-Ցm{u{yz| yUzy ɸ 9EaiiEuQѽIQ9M=a r%p`P@0 "5!k=Ip`UUYyP@05} Y9$%p`P@0 ]Ũp`P@0 eEU*q$9 )$p`=*فP@]0$ )"%p`P@0 UYuI͍"p`P@0 p`P@Z0 "} Jp`P@5j0 o$07070101AE228F000081ED0000000000000000000000016A426C280004DC83000000FE0000000000000000000000000000001900000000usr/lib/libext2fs.so.2.4ELF4t4 (pDDxxx H000((QtdRtdxxx A+A9AAA  @Qx|XH lA  ppp p9pp p!oooo =xb<Ii"%(P)9,3S.Y^S9MU#a&7V{^0EqK5fk @U`X!hoeZ f/lRO P b*gssl !  }eK/JI(AWmHmwM]ZOmu:(x1Z[;c614+1'gsv]r8:T"gN >vtQ?L394RF=&;H zA2pC7WE i7B>_Gv8VN^4_X|#d6Fr Cy'$BE@S--*0)yL[|Fk{GQO}RG ju_N?w pXth$|+oID)e= #p:Kr xwo`cWD;0,j3i\J]~- nY!5d6cQanTyfz2q&$Lu2VUC JHT`<}b j>+q.Mlk%/<d[z~tn\Pa~.BAh'{8\ 5*%"D@ ?,   Y 4] =, I " 5i) >H *& Q5 @: F: "% 8| 5 /" 6$  % AY= 0" ; 4Ua % 9 K B % 8=\ 32'6 2-y 9;m 5q -" ? 5) $a 6)" }" .E" u.!" "  7E N7I 1 " 9ѿ @Q 7]E " J ] }/ 5." ." S ), 7E ;]u -m" h7ѐI ?F m& pն & 9 -= ED /" 3!P, 5k2 -I" s}E W/A" |(* B-Q  - 9 )" e6ю1 . U." ,& D?e " ." m9I= +m J$! 7( p4Z9 $   y 7E 7ُ( &% ." EB > (- : UH 89%> 51> ]#)4 tey  " n=& r* 1%& ? 9 ?! $A *" += :ٿ " A! _& @1" AL*" 4ay ~Y, 9 y? = [;l e! b-, A" - $ )& ,1 }6- 1 z]T( >]d :Y um" O*I& &F9 (9 .<9 &] /" % !G M  : ,m1 ;%! ^<!* $i 2A$y (5 !I 6* 5! g 86 8 95 $q P+9 /& x<M* , %=   ?>& \&  G 8 }m "E 7S( >L JA  Gq >- 6* $ m%UA # -%" f0I" k 9, +Y9  j1( * " ) S * /}& 0" ݶ1 )@M & =& D= -" 9ɿ  1 %6@  1 ) 81  " 07EE )# =1 )" !a! %-  A" $I  9 m* !( $A 6Y( & E 18M *4V, V>- G1 r-) ) % Y "0= ( R6* ,m :0=A t*q" p$5  yw( O#% ,Um 41M" 0& I ;/" ++= 3$ -5 @;& ա A#  >& 1,1 K-! 4` 1"  H= /" z>A " Q[. .i" <0 ")  = Y '9& ^$)  2- 34$ q,!5 4]$ A 0" 6-* 9Ϳ $U  $& yYI X=$ R0} "  0  Y" u" o:  1 0m& a iM q/e - 8 d569 #= M  KQy A 6 uF }FA (= !iy }(m  _@ Qհm = `} Q'- S4X EA !] =% DQQ3aL &5 Eն L%Q =. XP  ` Z8 <(M !! >P>PP/*Y ;u 2ypA m$ ] }5P3m< EP. ?  h ) !Va * ( G " * 7Ѣf #P@P"= opP!`P  5Y1 ] O8PPY@PUe UM J9e> %  U @9;q = <4  g 0PKm "+%% ]39( x P1!i 5P." PM1qQ =9 O 5]b QU 2- u= (OE,Y a {  !Or5i 5U  &XM F3a8] 1  g"E 7O -O( RIP& i8Eq , e P6. _ɮ1 & ^: i@O% $'E= 4\ 5h Y /:OzOD m!`K@PK(% ~"\ @K 0Ki: K(iH \-K<E 3MP d'-   ]] #KZJl= ,- I <J 9 !U 2+(  =FA = ]  ,  'am 3@% `&) y%M 4=Z  i  JXQ 5J!%E (@dw% :'= *Y !J:ե" ' (Q#. y T  e!J4aLm U" Q # " "e DD969( PM JJ# 8M *  5JAUq I5! ;u 8  Y <pJK#  -* >`J2A k,PJ  1 " 2:@J#0J!S* h i S ; J( 5Oy V=ME "Q l>JQu u JD #I{ ] P5]{ *5z }; _fini__cxa_finalize__deregister_frame_info__register_frame_infomemcpymemsetstderrfprintfext2fs_image_super_writemalloc__errno_locationext2fs_image_super_readinitialize_ext2_error_table_ret_ext2_error_tableinitialize_ext2_error_table_et_listext2fs_set_alloc_block_callbackext2fs_set_new_range_callbackext2fs_set_block_alloc_stats_callbackext2fs_set_block_alloc_stats_range_callbackext2fs_remove_exit_fnmemmoveext2fs_u32_list_findext2fs_u32_list_testext2fs_badblocks_list_testext2fs_u32_list_delext2fs_badblocks_list_delext2fs_u32_list_iterateext2fs_badblocks_list_iterateext2fs_u32_list_equalmemcmpext2fs_badblocks_equalext2fs_u32_list_count__time64ext2fs_get_bitmap_granularityext2fs_set_bitext2fs_clear_bitext2fs_test_bitext2fs_warn_bitmapcom_errext2fs_set_bit64ext2fs_clear_bit64ext2fs_test_bit64ext2fs_bitcountext2fs_group_of_blk2__udivdi3ext2fs_group_first_block2ext2fs_inode_data_blocks2ext2fs_inode_i_blocksext2fs_get_stat_i_blocksext2fs_blocks_countext2fs_group_last_block2ext2fs_group_blocks_count__umoddi3ext2fs_blocks_count_setext2fs_blocks_count_addext2fs_r_blocks_countext2fs_r_blocks_count_setext2fs_r_blocks_count_addext2fs_free_blocks_countext2fs_free_blocks_count_setext2fs_free_blocks_count_addext2fs_file_acl_blockext2fs_file_acl_block_setext2fs_file_block_offset_too_bigext2fs_bg_has_superext2fs_super_and_bgd_loc2ext2fs_super_and_bgd_locext2fs_update_dynamic_revext2fs_inode_size_setext2fs_crc16ext2fs_crc32c_leext2fs_init_csum_seedext2fs_mmp_csum_verifyext2fs_mmp_csum_setext2fs_verify_csum_typeext2fs_superblock_csum_verifyext2fs_superblock_csum_setext2fs_ext_attr_block_csum_verifyext2fs_ext_attr_block_csum_setext2fs_get_dx_countlimitext2fs_dirent_has_tailext2fs_inode_csum_verifyext2fs_inode_csum_setext2fs_set_dir_block2ext2fs_dblist_sort2qsortext2fs_dblist_iterate3ext2fs_dblist_iterate2ext2fs_dblist_count2ext2fs_dblist_get_last2ext2fs_dblist_drop_lastext2fs_set_dir_blockext2fs_dblist_sortext2fs_dblist_iterateext2fs_dblist_countext2fs_dblist_get_lastext2fs_dirhashext2fs_dirhash2ext2fs_get_rec_lenext2fs_set_rec_lenext2fs_initialize_dirent_tailext2fs_inode_io_intern2sprintfext2fs_inode_io_internext2fs_u32_list_iterate_beginext2fs_badblocks_list_iterate_beginext2fs_u32_list_iterate_endext2fs_badblocks_list_iterate_endext2fs_write_bb_FILEext2fs_dblist_dir_iteratestrcmpinode_io_managerstrlenstrcpyext2fs_u32_list_createext2fs_badblocks_list_createext2fs_u32_copyext2fs_badblocks_copyext2fs_get_inode_bitmap_range2ext2fs_get_block_bitmap_range2ext2fs_image_bitmap_writeext2fs_image_bitmap_readext2fs_set_inode_bitmap_range2ext2fs_set_block_bitmap_range2ext2fs_get_free_blocks2ext2fs_get_free_blocksext2fs_map_cluster_blockext2fs_find_inode_goalext2fs_add_exit_fnatexitext2fs_u32_list_addext2fs_badblocks_list_addext2fs_add_dir_block2ext2fs_add_dir_blockext2fs_dirent_csum_verifyext2fs_dx_csumext2fs_dir_block_csum_verifyext2fs_read_dir_block4ext2fs_read_dir_block3ext2fs_read_dir_block2ext2fs_read_dir_blockext2fs_dir_block_csum_setext2fs_write_dir_block4ext2fs_write_dir_block3ext2fs_write_dir_block2ext2fs_write_dir_blockext2fs_process_dir_blockext2fs_extent_block_csum_verifyext2fs_extent_block_csum_setext2fs_free_inode_bitmapext2fs_free_block_bitmapext2fs_copy_bitmapext2fs_set_bitmap_paddingext2fs_allocate_inode_bitmapext2fs_allocate_block_bitmap__lshrdi3ext2fs_allocate_subcluster_bitmapext2fs_fudge_inode_bitmap_endext2fs_fudge_block_bitmap_end2ext2fs_fudge_block_bitmap_endext2fs_clear_inode_bitmapext2fs_clear_block_bitmapext2fs_resize_inode_bitmapext2fs_resize_block_bitmapext2fs_resize_inode_bitmap2ext2fs_resize_block_bitmap2ext2fs_compare_block_bitmapext2fs_compare_inode_bitmapext2fs_set_inode_bitmap_rangeext2fs_set_block_bitmap_rangeext2fs_get_inode_bitmap_rangeext2fs_get_block_bitmap_range__floatundidf__divdf3abortext2fs_group_descext2fs_block_bitmap_checksumext2fs_block_bitmap_locext2fs_block_bitmap_loc_setext2fs_inode_bitmap_checksumext2fs_inode_bitmap_locext2fs_inode_bitmap_loc_setext2fs_inode_table_locext2fs_image_inode_writeext2fs_image_inode_readext2fs_inode_table_loc_setext2fs_bg_free_blocks_countext2fs_bg_free_blocks_count_setext2fs_bg_free_inodes_countext2fs_bg_free_inodes_count_setext2fs_bg_used_dirs_countext2fs_bg_used_dirs_count_setext2fs_bg_itable_unusedext2fs_bg_itable_unused_setext2fs_bg_flagsext2fs_bg_flags_zapext2fs_bg_flags_testext2fs_bg_flags_setext2fs_bg_flags_clearext2fs_bg_checksumext2fs_bg_checksum_setext2fs_inode_bitmap_csum_verifyext2fs_inode_bitmap_csum_setext2fs_block_bitmap_csum_verifyext2fs_block_bitmap_csum_setext2fs_group_desc_csumext2fs_group_desc_csum_verifyext2fs_group_desc_csum_setext2fs_clear_block_uninitext2fs_block_alloc_stats_rangeext2fs_block_iterate3ext2fs_block_iterate2ext2fs_update_bb_inodeext2fs_block_iterateext2fs_flush2ext2fs_flushext2fs_close2ext2fs_close_freeext2fs_closeext2fs_set_gdt_csumext2fs_init_dblistext2fs_copy_dblistext2fs_dup_handleext2fs_dir_iterate2ext2fs_dir_iterateext2fs_new_inodeext2fs_new_block3ext2fs_new_block2ext2fs_new_blockext2fs_new_rangeext2fs_alloc_rangeext2fs_reserve_super_and_bgdext2fs_reserve_super_and_bgd2ext2fs_allocate_group_tableext2fs_allocate_tablesext2fs_check_descext2fs_inode_alloc_stats2ext2fs_inode_alloc_statsext2fs_block_alloc_stats2ext2fs_alloc_block3ext2fs_alloc_block2ext2fs_alloc_blockext2fs_block_alloc_statsext2fs_bmap2ext2fs_bmapext2fs_crc32_beext2fs_blkmap64_rbtreeext2fs_blkmap64_bitarrayext2fs_ext_attr_hash_entryext2fs_ext_attr_hash_entry_signedext2fs_ext_attr_block_rehashext2fs_get_ea_inode_hashext2fs_set_ea_inode_hashext2fs_get_ea_inode_refext2fs_set_ea_inode_refext2fs_xattrs_countext2fs_xattrs_flagsext2fs_extent_header_verifyext2fs_extent_get_infoext2fs_decode_extentext2fs_file_get_fsext2fs_file_get_inodeext2fs_file_get_inode_numext2fs_file_llseekext2fs_file_lseekext2fs_file_get_lsizeext2fs_file_get_sizeext2fs_find_block_deviceext2fs_sync_devicefsyncioctlext2fs_warn_bitmap2ext2fs_fudge_generic_bitmap_endext2fs_get_generic_bitmap_rangeext2fs_set_generic_bitmap_rangeext2fs_mem_is_zeroext2fs_fudge_generic_bmap_endext2fs_set_generic_bmap_rangeext2fs_get_generic_bmap_rangeext2fs_ext_attr_hash_entry3ext2fs_ext_attr_hash_entry2ext2fs_expand_dirext2fs_read_ext_attr3ext2fs_read_ext_attr2ext2fs_read_ext_attrext2fs_write_ext_attr3ext2fs_write_ext_attr2ext2fs_write_ext_attrext2fs_xattrs_closeext2fs_extent_freeext2fs_u32_list_freeext2fs_badblocks_list_freeext2fs_free_dblistext2fs_free_generic_bitmapext2fs_xattr_getext2fs_make_generic_bitmapext2fs_allocate_generic_bitmapext2fs_copy_generic_bitmapext2fs_adjust_ea_refcount3ext2fs_adjust_ea_refcount2ext2fs_adjust_ea_refcountext2fs_free_ext_attrext2fs_xattr_inode_max_sizeext2fs_extent_open2ext2fs_extent_openext2fs_copy_generic_bmap__gettimeofday_time64perrorstrcatext2fs_xattrs_writeext2fs_xattrs_iterateext2fs_xattr_removeext2fs_xattr_remove_allext2fs_xattrs_openext2fs_extent_getext2fs_extent_goto2ext2fs_extent_gotoext2fs_extent_replaceext2fs_extent_fix_parentsext2fs_extent_deleteext2fs_fix_extents_checksumsext2fs_extent_insertext2fs_extent_node_splitext2fs_extent_set_bmapext2fs_max_extent_depthext2fs_count_blocksext2fs_file_open2ext2fs_file_openext2fs_file_flushext2fs_file_closeext2fs_file_readext2fs_xattrs_read_inodeext2fs_xattrs_readext2fs_file_set_size2__divdi3__moddi3__ashrdi3ext2fs_file_writecallocstrncmpext2fs_xattr_setext2fs_file_set_sizeext2fs_freeext2fs_find_first_zero_generic_bitmapext2fs_find_first_set_generic_bitmapext2fs_test_generic_bitmapext2fs_test_generic_bmapext2fs_compare_generic_bitmapext2fs_compare_generic_bmapext2fs_get_generic_bitmap_startext2fs_get_generic_bmap_startext2fs_get_generic_bitmap_endext2fs_get_generic_bmap_endext2fs_clear_generic_bitmapext2fs_clear_generic_bmapext2fs_mark_generic_bitmapext2fs_mark_generic_bmapext2fs_set_generic_bitmap_paddingext2fs_set_generic_bmap_paddingext2fs_unmark_generic_bitmapext2fs_unmark_generic_bmapext2fs_resize_generic_bitmapext2fs_resize_generic_bmapext2fs_test_block_bitmap_rangeext2fs_test_inode_bitmap_rangeext2fs_alloc_generic_bmapext2fs_free_generic_bmapfputsext2fs_fallocateext2fs_mark_block_bitmap_rangeext2fs_unmark_block_bitmap_rangeext2fs_djb2_hash__stack_chk_guard__stack_chk_failext2fs_warn_bitmap32ext2fs_safe_getenvgetuidgeteuidgetgidgetegidprctlsecure_getenvsetmntent__stat_time64getmntenthasmntoptstrncpyendmntentext2fs_get_dio_alignmentsysconfext2fs_hashmap_createext2fs_hashmap_addext2fs_hashmap_lookupext2fs_hashmap_iter_in_orderext2fs_hashmap_freeext2fs_iblk_add_blocksext2fs_iblk_sub_blocksext2fs_iblk_setext2fs_icount_validateext2fs_get_icount_sizeext2fs_read_ind_blockext2fs_write_ind_blockext2fs_fast_set_bitext2fs_fast_clear_bitext2fs_fast_set_bit64ext2fs_fast_clear_bit64ext2fs_swab16ext2fs_swab32ext2fs_swab64ext2fs_get_memext2fs_get_memzeroext2fs_get_arrayext2fs_get_arrayzeroext2fs_free_memext2fs_resize_memrealloc__floatunsisf__divsf3__mulsf3__fixunssfsiext2fs_resize_arrayext2fs_mark_super_dirtyext2fs_mark_changedext2fs_test_changedext2fs_mark_validext2fs_unmark_validext2fs_test_validext2fs_mark_ib_dirtyext2fs_mark_bb_dirtyext2fs_test_ib_dirtyext2fs_test_bb_dirtyext2fs_group_of_inoext2fs_htree_intnode_maxrecsext2fs_log2_u32ext2fs_log2_u64ext2fs_log10_u32ext2fs_log10_u64ext2fs_div_ceilext2fs_div64_ceilext2fs_dirent_name_lenext2fs_dirent_set_name_lenext2fs_dirent_file_typeext2fs_dirent_set_file_typeext2fs_inodeext2fs_const_inodeext2fs_inodes_per_orphan_blockext2fs_orphan_block_tailext2fs_get_memalignposix_memalignext2fs_flush_icacheext2fs_free_inode_cacheext2fs_create_inode_cacheext2fs_close_inode_scanext2fs_set_inode_callbackext2fs_inode_scan_flagsio_channel_set_optionsstrchrio_channel_write_byteio_channel_read_blk64io_channel_write_blk64io_channel_discardio_channel_zerooutio_channel_alloc_bufio_channel_cache_readaheadext2fs_check_mount_pointfopenfgetsfcloseext2fs_check_if_mountedext2fs_llseekext2fs_zero_blocks2ext2fs_zero_blocksext2fs_default_journal_sizeext2fs_journal_sb_startext2fs_create_journal_superblock2htonlext2fs_create_journal_superblockext2fs_add_journal_devicentohlext2fs_mmp_new_seqgetpidsrandomext2fs_native_flagext2fs_load_nls_tableext2fs_check_encoded_nameext2fs_casefold_cmpext2fs_fast_test_block_bitmap_rangeext2fs_test_block_bitmap_range2__ashldi3ext2fs_fast_test_block_bitmap_range2ext2fs_test_block_bitmap2ext2fs_test_inode_bitmap2ext2fs_icount_fetchext2fs_fast_test_inode_bitmap2ext2fs_fast_test_block_bitmap2ext2fs_mark_block_bitmap_range2ext2fs_fast_mark_block_bitmap_range2ext2fs_fast_mark_block_bitmap_rangeext2fs_unmark_block_bitmap_range2ext2fs_fast_unmark_block_bitmap_range2ext2fs_fast_unmark_block_bitmap_rangeext2fs_find_first_zero_generic_bmapext2fs_find_first_zero_block_bitmap2ext2fs_find_first_zero_inode_bitmap2ext2fs_find_first_set_generic_bmapext2fs_find_first_set_block_bitmap2ext2fs_count_used_blocksext2fs_count_used_clustersext2fs_find_first_set_inode_bitmap2ext2fs_get_num_dirssnprintfext2fs_get_pathnameext2fs_lookupext2fs_get_device_size2unameext2fs_get_device_sizeext2fs_get_device_sectsizeext2fs_get_device_phys_sectsizeext2fs_free_icountext2fs_create_icount2ext2fs_create_icountext2fs_create_icount_tdbumaskmkstempext2fs_get_journal_paramsext2fs_initializestrtoul__muldf3__fixunsdfdiext2fs_calculate_summary_statsext2fs_mark_block_bitmapext2fs_mark_inode_bitmapext2fs_fast_mark_block_bitmapext2fs_fast_mark_inode_bitmapext2fs_unmark_block_bitmapext2fs_unmark_inode_bitmapext2fs_fast_unmark_block_bitmapext2fs_fast_unmark_inode_bitmapext2fs_test_block_bitmapext2fs_test_inode_bitmapext2fs_fast_test_block_bitmapext2fs_fast_test_inode_bitmapext2fs_get_block_bitmap_startext2fs_get_inode_bitmap_startext2fs_get_block_bitmap_endext2fs_get_inode_bitmap_endext2fs_mark_block_bitmap2ext2fs_convert_subcluster_bitmapext2fs_mark_inode_bitmap2ext2fs_fast_mark_block_bitmap2ext2fs_fast_mark_inode_bitmap2ext2fs_unmark_block_bitmap2ext2fs_unmark_inode_bitmap2ext2fs_icount_incrementext2fs_icount_decrementext2fs_icount_storeext2fs_fast_unmark_block_bitmap2ext2fs_fast_unmark_inode_bitmap2ext2fs_get_block_bitmap_start2ext2fs_get_inode_bitmap_start2ext2fs_get_block_bitmap_end2ext2fs_get_inode_bitmap_end2ext2fs_group_of_blkext2fs_group_first_blockext2fs_descriptor_block_loc2ext2fs_descriptor_block_locext2fs_group_last_blockext2fs_inode_data_blocksext2fs_inline_data_initext2fs_new_dir_inline_dataext2fs_inline_data_ea_removeext2fs_new_dir_blockext2fs_open_inode_scanext2fs_inode_scan_goto_blockgroupext2fs_read_inode2ext2fs_read_inode_fullext2fs_read_inodeext2fs_inline_data_sizeext2fs_inline_data_getext2fs_get_blocksext2fs_check_directoryext2fs_get_next_inode_fullext2fs_get_next_inodeext2fs_write_inode2ext2fs_write_inode_fullext2fs_write_new_inodeext2fs_write_inodeext2fs_inline_data_dir_iterateext2fs_inline_data_expandext2fs_inline_data_setext2fs_linkext2fs_mkdir2ext2fs_mkdirext2fs_add_journal_inode3__fstat_time64ext2fs_add_journal_inode2ext2fs_add_journal_inodeext2fs_mmp_readext2fs_mmp_writegethostnameext2fs_mmp_clearext2fs_mmp_startsleepext2fs_mmp_stopext2fs_mmp_update2ext2fs_mmp_updateext2fs_mmp_initext2fs_nameiext2fs_namei_followext2fs_follow_linkext2fs_open2ext2fs_openext2fs_numeric_progress_updatestdoutext2fs_numeric_progress_closefcntlstrerrorpwritemunmapmmapftruncatemsyncext2fs_get_data_ioext2fs_set_data_ioext2fs_rewrite_to_ioext2fs_list_backupsext2fs_sha512ext2fs_is_fast_symlinkext2fs_tdb_errorext2fs_tdb_errorstrext2fs_tdb_lock_nonblockext2fs_tdb_lockallext2fs_tdb_lockall_markext2fs_tdb_lockall_unmarkext2fs_tdb_lockall_nonblockext2fs_tdb_unlockallext2fs_tdb_lockall_readext2fs_tdb_lockall_read_nonblockext2fs_tdb_unlockall_readext2fs_tdb_chainlockext2fs_tdb_chainlock_nonblockext2fs_tdb_chainlock_markext2fs_tdb_chainlock_unmarkext2fs_tdb_chainunlockext2fs_tdb_chainlock_readext2fs_tdb_chainunlock_readpreadext2fs_tdb_transaction_startext2fs_tdb_transaction_cancelext2fs_tdb_transaction_recoverext2fs_tdb_transaction_commit__select_time64__utime64ext2fs_tdb_traverse_readext2fs_tdb_traverseext2fs_tdb_firstkeyext2fs_tdb_nextkeyext2fs_tdb_dump_allext2fs_tdb_printfreelistext2fs_tdb_increment_seqnum_nonblockext2fs_tdb_fetchext2fs_tdb_parse_recordext2fs_tdb_existsext2fs_tdb_deleteext2fs_tdb_storeext2fs_tdb_appendext2fs_tdb_nameext2fs_tdb_fdext2fs_tdb_log_fnext2fs_tdb_get_seqnumext2fs_tdb_hash_sizeext2fs_tdb_map_sizeext2fs_tdb_get_flagsext2fs_tdb_enable_seqnumext2fs_tdb_open_exstrdupext2fs_tdb_openext2fs_tdb_set_max_deadext2fs_tdb_closeext2fs_tdb_validate_freelistext2fs_tdb_set_logging_functionext2fs_tdb_get_logging_privateext2fs_tdb_reopenext2fs_tdb_reopen_allext2fs_do_orphan_file_block_csumext2fs_orphan_file_block_csum_verifyext2fs_orphan_file_block_csum_setext2fs_default_orphan_file_blocksext2fs_numeric_progress_initfflushext2fs_punchext2fs_truncate_orphan_fileext2fs_create_orphan_fileext2fs_read_bb_FILE2feofsscanfext2fs_read_bb_FILEext2fs_read_bb_inodeext2fs_create_resize_inodeext2fs_write_bitmapsext2fs_write_inode_bitmapext2fs_write_block_bitmapext2fs_rw_bitmapspthread_attr_initpthread_createpthread_joinpthread_attr_destroyext2fs_read_inode_bitmapext2fs_read_block_bitmapext2fs_read_bitmapsext2fs_symlinkstrnlenqcow2_read_headerext2fs_swap_group_desc2ext2fs_swap_group_descext2fs_swap_ext_attr_headerext2fs_swap_ext_attr_entryext2fs_swap_ext_attrext2fs_swap_inode_fullext2fs_swap_inodeext2fs_dirent_swab_in2ext2fs_dirent_swab_inext2fs_dirent_swab_out2ext2fs_dirent_swab_outqcow2_write_raw_image__assert_failext2fs_swap_superext2fs_swap_mmpext2fs_numeric_progress_opspthread_mutex_lockpthread_mutex_unlockposix_fadviseext2fs_tdb_flushset_undo_io_backing_managerset_undo_io_backup_fileext2fs_open_fileext2fs_statext2fs_fstatext2fs_parse_version_stringext2fs_get_library_versionext2fs_rb_insert_colorext2fs_rb_eraseext2fs_rb_firstext2fs_rb_lastext2fs_rb_nextext2fs_rb_prevext2fs_rb_replace_nodeopendirreaddirclosedirundo_io_managerpthread_mutex_destroystrtoullstrtollsetrlimitgetrlimitpthread_mutex_initatoiunixfd_io_managerunix_io_managerext2fs_unlinkext2fs_inode_has_valid_blocks2ext2fs_inode_has_valid_blockssparse_io_managersparsefd_io_managerlibuuid.so.1libgcc_s.so.1libc.solibext2fs.so.2GCC_4.2.0GLIBC_2.0GCC_3.0+A``' PAii ZAP&y dAx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dlpt|  $(,048<@HLPTX\`dhlptx| (08@\`dLTX\`dhlptx|DHLPTX\`dhlptx|TPL' '<ɜ'!'@8@8 D,@, @̄$$ '<ɜ'!D@D$ @̄$`JaV`N+j++Uk2lSdg3j4LLr2ik lede>eĜyg xgwc XgO=aja8aL7$@+"aa`J&1#'!8gaaaJa+a8g +/l7"\g @:ee0*pH m@:ee%*X m@:ee*1 @8e o cXgSIcxgzdJ"k1 @=ee`tJ,#jKDLP@8eejr @2ideP$gkX8Lșlja$ @ Aj* a a -gKJ#M N5l@8e" 0\0L@:ee"vdHlL4 J Hف+F+G+j @2id`e&JaBagB%gaH4dJB\g@XND@:e"BJBudA"oBh3q倜`#`aBH2Ia j6`aLBagKmBK a4 AJAlJ+F+j @2ide\gq@@:eDdej @2ide\g@@:eDdej @2ide$g  L Ga*Fa Ij"\g0@n Jo:e@$ge *\gqXg@:egPgwdj\g0@n3Jog@:ege* \gTg@:e* AnZghhej @2ide$gj\gT@:ege* bl *\gpXg@:e*Pgvd +j @2idej\g@@:eFdejQ @2ide\gpLog@:eEdej1 @2idej\gpLgo@:eEdj @2i deDkYl*jwd\g0 n Io9e@ge* og@9ee* K\g0@ZJg@:e*bj\g0@n3Jog@:ee* \gTg@:e* ۴Bl* +j1 @2iedgP :e@$ge *j @8ewdj @2idej\gP\@:eFdej @2ide\gDog@:eEdej @2idej\gDgo@:eEdjQ @2idW#ea.&ja jl)*@B\g@@:eF؞e*E kDYl* Z`vFj~djC jB) Ңg\gPP@:ee* -caZakL+ cgLB` @*AB, .=, 9,s6akl6"j Dc逘a e bg :e@ Re`J jl"\g PP@:ee*JjL#iPkl*Jaiiၘj:" lF JN2#I  c(`B EJ#a)Ңg\gPP@:ee#*ZEakL+fKB`CaN)  JC_ ai*k$2m;m~ J ҿji*@B\gP\@:eF"kje#+j @2ideJo@:eedej. @2idegDlSEgK\g0@>Jo@:eedej @2idegDlSEgK\g0@nJo@:eedej @2idegDlSEgK\g0@Jo@:eedejn @2ideLi \g0@ +h C"aAA" dEocgK1c#6gU\g 0@J;o@:exd jj *2I`AAsa*0gHH+"\gHg@:eaAe"+0g##6oDbgEgoc g1cgU J;@:eei+ejm @2i deDgk#~ kk g`jyd k % xIFe \gX Dc\g8 `@gL@:ee@*Eg ҂g\gMPT@:ee* d jD gz+o[*dś \gPL@:enag@8e* x@iejm @2ide\gg0@g@:elbg؝L$:\a|`3`3mddej  @2ide\gg0@g@:ebgDlXL$hjdd jkej @2ide\gg0@&gg@:ed ژk#hvdj @2ide\gg0@g@:elbg؝M$<\a}`3`3mddejM @2ide\gg0@g@:ebgDlXL$ijdd jkej  @2ide\gg0@&gg@:ed!ژk#ivdj @2ide\gg0@g@:ebgDlXL$jjdd jkej @2i deE$gT4\gH@:eҞe"jGCah\gDg@:e me "J E + C `b\g@=ePg{d BCC3KXgi m giA\gP@:ecea+ C` *J !R a j   \gT@:ege* jlES" sT$`j\g\o@:eSe6a J Jc xgI J i *K$hK$H b`bgisT` X\gL@:eaBe +\gT@:eea exn* 2gII i ҷB@ hD+;+%+j @2idegE$gT4H@:eҞeq"j GCaDg@:ee/D g@:e meR"J * J !R a j exP@:eaBe+T@:e@e Ґ@=e zd n#*  P@:e Ҟe* C2gII  k j e;+$+jm @2ide\gg0@&gg@:ed"ژk#jvdj- @2ide\gg0@g@:edgFk#v`3`3dd mej @2ide\g$g0@gg@:edʘk#00udj @2ide\gg0@g@:edgGk#w`3`3dd mejm @2ide\g$g0@gg@:edʘk#00udj- @2ide\gg0@g@:edgHk#x`3`3dd mej @2ide\g$g0@gg@:edʘk#00udj @2ide\gg0@g@:edgNk#y`3`3dd mej @2ide\g$g0@gg@:edʘk#00udjL @2ide\gg0@@:eDd Ij  @2ide\gg0@@:ekiDdej @2iegd0gg@?eI ddj @2ide\gg0@g@:eim ddej @2ide\gg0@g@:eil ddjl @2ide\gg0@@:eDd Oj, @2ide\gg0@g@:eddej  @2ide\gg0@g@:e"gDkYel""\gmP@:ek#~<[ a}`3`3mN[Xgvd1jj @2ide\gg0@g@:e"gDkYel"\g P @:ekMɸ#~<[aB2B2]ud jej, @2ide\gg0@g@:e"gDkYel""\glP@:ek#~:[ a|`3`3mN[Xgvd1jj @2ide\gg0@g@:e"gDkYel"\g P @:ekLɸ#~:[aB2B2\ud jej, @2iedg0@g@:e"gjexl%"^yjl"Og jOn𐚰P@:eegg@8e owd 1 jPHlnhM@:e1gPHe:e@n1gPHegn@:e![eaP1ANMg@8ejL @2iedg0T$g@:ee"P g@:e eґg@8eN[Xgvdjj  @2iedg0T$g@:ee"T g@:e1 egg@8eudj @2ideGC'` ?" {+*"gBp\@:eBC g}j g0@YJ@:e QDeӐg@:e Ҟe GJn * Jl"Jno  *PTg@:e me* jgT@:edz Ne+ jgT@:e *PP @:e Pe:e@g ez"pLg@:eg \eg@:e e?eB@g eno=e@ e?en@g eg@?e e {+z"gBD@:egjYcgJg 0@YJ@:e QDeӐg@:e Ҟep\g@:egYc3g *Dg@:e me+* JgT@:e e*J @=e e$*PPg@:e eg@?ejdPTg@:egYc3g}J j m"pLg@:eg QDeg@:e egang,e`mIggi\g@:e Zen\7@:e e?e[@g e?en@g e?e@g eKjXgk_@=eicgi k eCg ҋu eH+jF @2ideҠLg " 'Gnj @?ee i gLc a"'n g@?ejyd "Ae` gog@:ee\g̘Hgg@:ee*Ij @2id$geE \gP@:e ӑ`Jeadj"~OCl *\g0pXMg@:eҞeS*hGCRa j oBC gJI j\g PP GC2`DkXl*gPPg@:e QDe ӑg@:e Ҟe \gp\g@:e Cegaja C`\\g0@=e{d\gTgg@:eHe aJa Ca\gDg@:ee* g@;ee\ggPT@:e Cegaja C`9 aJa Ca\gDg@:ee* ;e@ge\ggD@:eCg ceaJa c`"oDgcLxgQ ca+ ajKcaJ4\gDg@:ee* g@:eA@gxgeIS+++++j& @2ideDgegK,@*  ;* j\g Lg@:eeBP "  @:eeL" j\g 1Tg@:ee\gH@:ege"Pgzdgř\m@:ejPe @:eeg*j\gg@=eڡj @2idej\g0@@:eFdej @2idej \g0@ggo@:e* `gdjE @2id.jR*@j$gAnE@:ee* H0jl "@@AnF@:evd@$* jl """ey\g\g@:e*@AnF@:e*@J@`ڲ_+j @2idej EJ2[*$ggm0f H8e g@L * ґg@8eydej @2ideggҐo@=eEdj @2ide@ I"\gP%g@:ee+C``DEC`j@j R#`CdBaH4 JC\gDX@N!M@:ee"CJCGjwdDbBH2I``jK\go@=ejeF+j% @2ideW hg 7L Lj\gD@:ee"Dj}AJA\g@=eejj\gL@:eg m" @@a"jPjNj @2ideLg j\gpD i Ja*xddoc g1cgi U @:eAA#"gxgIejD @2idde eL c ӳxgo ` m+{d je DcaRa CO`GAJqg )#ggB\6m@:epDe!\gg@@:eD EqC Xgi'Ceaja` caCa c?`cxg9 a+ c`CXgi Can* aDAk  cgcxge  gg%uxgcaN +`c8gk'Pg-" oc gcgiU)X,aj)*2@ 3M@54\gg\m@:eL2QC3eKguCԱggg@:eJcxgIO@gIeg%j @2ideLg j\gpH i Ja*xddoc g1cgi U @:eAA#"gxgIej @2ie dgp,@9e00 HO8e@gg@9eudeeeejC @2idejgi Bavd\gPX@:elJiee+dKiIHej @2ide\ggPXg@:eҞei BaQgvd@BabaB҂g\gPX@:eBeab a\gpTg@:eReaIHdgjaa+b#Kj3 +B7T2KB4@24@2ꀝKMdgjaa+b#Kj3 +B7T2KB4@24@2ꀝKMDoNjd``+C!dc #B0@20@2 n`Kyj B c Ie e`JaD@j訷+`Ja&G@%@Gj訷+@ rabAC a jM[*baJBa jew+jC @2id`eJ8a\g$g\gg0nm@:e𔙠`2P2I"j# m-`ءbcدd2iH2E؀X D gF HjJJK؁ijud+ jN.CbA@`BkBekcDaJDjE jeG+`n* A j+`n*GD J je+`n* B j+dJa #saPtI}gXg܀%j!dsaD~Ie+G+j @2idej\gkPg g7@:e `fde`Ja^dA`j+jc @2ide\gp\@:e*,CgEdjejC @2iedgHl@:ee""gPX @:eBHe@:ege@*g@8eudP @8e @A j @2idej \g p0 Lg@8ege\g0 L@8ege\g0-L@8eke\gpT )?( zd  :e@e\g@=ege\g@=e e*(J* \g!@=ege\gg@=ee\g!@=ege\gg@=eeej @2iedgX%g@:eJe*@8e )iQgvdPX n@:ee"T@:eP en8e@ ")ea K j# @2ideggGŜ$U &0gNl@9evd0ĘlN@9eeEgJ aDa#C@ jFgj @2iddgҚe Eg"#JaaOGCa榛6G6`C``C\gPT@:ejddG+jB @2ideEg "$`JabcaOGCa{6G6`C``C\gPT@:ejddeG+j @2ide*\g@5g :e@gge0* j\g 0T5kg:e@ Ӟe|g pX5pDng og@:e(ne *\g5Hg@:egPgzd( 2"g @5g@:ege*egyC+g]1D g@:ege*g pP 7g@:e0Te5 g@:ee+++++(+j @2idej\gTg @:ee* +\g@ ѐg@:eZXg` n$+bsa"wd ꗷ++j" @2idej\gq\@:eEdej @2ide\gqTgo@:eEdj @2ide @2ide#Ne.aAbjl7"6'td2iP2]J." +dŞm"%m`Kb\g0@ J@:ejudmaxg!ee++++j~ @2id`eBJXaAgbjly" t!td2iP2EJl"\g Xm@:ee=*\gӰXӐg@:ee/*\g 0@ ӀTRaAoBCn*\g X mg@:ee*ja* w\gpHg@:eqd 2P2Emigk\gH@:e* g J@:ee+++j^ @2ideG@ gaA$gbjl|"`{#|L2P2I Ҋr$UqaT%\g6@D6M@:e CeJC AB A( ڀT="jl2*g X mg@:ege&*gXg@:ezEeÙDB2gF2KG0T@:egjeK\g @=ePgzd Lڹ @(t+ʀ\gg0@ J@:ege+++y+j @2ideDkYl*j{dg$g&,hl"B Ґ\g@:eҞe"%n*b# lB gҰXm@:ee'* jl*X m@:e je a0@ J@:ee" X m@:ee" N#1 @8eB٢{++|+j @2idej@ aAk$gBL@#@* Pgwd\gXm@:ege*\gXg@:e Ҟe *"k҄2Ӊ`ؙP2U젝uaŝ աq,td2iP2I J"/" #c+J` @ /* AF2"k /\gH@:e Ҟe" n 2cgK7lLFg*j\gk0TÙg@:egeg \g\@:egeb* Ct`Cg JCu`ĝ ֊JMせBBa\gX mg@:ege*\g/0@g J@:ege*\gpHg@:ege"j $@ \JD4Q\g4pP@:ee""j  @ ` @ _+j "\g@@:ee\g @=e/  I c` J\g PT n@:e /AE kJ{+ eCLB /Ad6kJD5U 5y6`C_a\gPT@:e e\gcP g @:ege*A j\gP@:ege*T*\D6Y 6C ` C?a\g PT@:e k@abeKcڀ|XK| JXC ga\g0@ J@:ege_* \g X f#mg@:ege?* Ҡ@F k\gmHg@:ege?*\gpHg@:ege*Cg \ggpPno@:ee\g 0Tg@:ege_`C= `Cp /Ak aC/k Cۂ mg@:e i ek\g Hmg@:ege*   \gmLg  he++F+++j @2ide\gm0@ J@:eDdj @2i de@@ laA$gbjlo"n td2iP2AAbbajc*\gm0@ J@:egeJ*td2i`P2A㪘C% jl"C MJCCR aJD6Y\gE@6L@:eeC`JCA JAA\gmHg@:ege *\gg0@ J@:ege"\gmXg@:ePgud@BjMK++++j @2i$deH I @bgJ6aajbL#dg|Ki #J|LL] ոgM +n;*oBCgJI n1, N.+ n** JB%`gҰXDm@:ege_ * J KBCXgiԏBCXgKiҴ (CLa +c`mDkmjwa jsarpa mI"`"&$%IcgV* NS,"#Icg NJ- G* C* JB?`"gҰXDm@:ege*&J&ҰHDm@:eXDem@:ege*XDm@:ege*TD@:ege*h(DHm@:ee BCXgKimgI +n* m*Jt"oBCgJIj+ng*oBCgJI n], NZ+ nV* JBQ`gҰXDm@:ege_* J KBCXgiԏBCXgKiDHm@:ege?*TD@:ege?*\D@:ege*XDm@:ege"DL(mj a n*aBCXgaB CXgDJҰHm@:ege*TD@:ege* m?"N"&$%IcgD* NA,"#Icg N8- 5* 1* JB-`"gҰXDm@:ege*&J&DHm@:ege*TD@:ege*DXmDL(m.gPTgn@:ekҰHDemg@:ege_* m "LD(m@:ege"\ D@:ee_*HDm@:ee:ADUcxgIcJxgLDm@:ege ""\*+D@:ee*XDm@:ee\ D@:ee*.><e+++|+}++j @2ideAgE8hBK j[*XD"n*@wd0P ml@:e0 e@8ekZ*J@j @2idej \g \@:ee"hi !\g1@=ezd jC` C+j @2idme&gGg ֫Za `+87Ki \g@ 7Za@*hh J`C`aK m 4Dbg4CJ6`4ldd2i4L2bI7hB@K JK7\gaXJ#(j  B LQ\gpP@:ee*/ ` IC` 4@:ee"`J\ggPX@:ee` IC\g PTg@:ee& AA Mq`Ca\gPT@:ee lAiBA@4aADX*#x`Cw+7aA Mca$8I Kca77B\gMPT@:ee*™8I`Ca\gPT@:eeAEۄc#*84g\gPT@:egex*Cj~`n{"\g4@@:eged*4Fbgja5Ybg)jb`=V`CAi*9cagBPTM@:ee? *4nD@:ege2*gPD@:e((e(+M&"T@:eC3e™*+oqD@:ege\gPL@:ee Pgzdno44DJD@kJklE{   eF+Z++  ++++jX @2idejb @ la\g$g0𠚊M@=eeXEaADsA#@XG@}Jc9`j *@yM ` CXg*`DEC`\gnPT@:eF ne*g@}Ky\gOp\JOg@:ege*DEA҂g\g\@:e megS"E+ C`,Pgxd\gP@:ecea+ C` \gPT@:ee5*f\gq\ g@:ege* `n*Ag\gp\ NJO@:ege "\g @@:eh+Z+++F+j @2ideA$gS7"@`J5a \ `l\g pP@:ee)* !"@\gp\@:ege *\g Xg@:ege\g @@:ePgxdlog+F+j @2id`e җJנa$gEFg*DFADM^g\g1D@:e Ҟe"" pdBCxgB\goH@:e Aeg\ggpHMg@:e e"wdW-j\gŘ0Xo@:e MeҀ #\ggp\ J@:e ҞeD*B \gŘHo@:e Ҟe\g1Xnog@:e e#*mT"jlP*\gPT@:e e"K \g0TAN@:e e" xj\gT@:e Ҟe*\g\m@:e e\gPk@:e Ҟe\g@@:e eJ* JmCXgCc|ggJ?e@Uҩ gxgeBC\ggKu@?e cea+C `jKk\gkTТAoN@:e}{+R+F+jx @2ide @ aljl$g"Ak l "\gTD N@:e ge*tX+CV`ҠHc`iC``iCgPT@:e Ұ@e虢 AN@:egβ e%"(pyCTg]ـ"^da*`\gg@@:e"`ڛ\gH @:e ge *\g@ AN@:e ge~*j\ghp\r"g J@:e Ҟe* 𐙀Eo\gqP@:e keC`gnZ\ggp\rJ@:e Ҟe*ljmLHqC7`IC_ a\gPT@:e@d me *BZXgrXg Bbgwl7"\gHmDl@:e ge*qen"Pg}d`iCB N\g@?e e\gD@@nM@:e Ҟe"a@d@jM\gg@=e he A嚠@A jҀX|ҠH\gN1X@:e Ҟe"\gg@=e e "^Йd[a*Wa" @d@ @N\ga0D@og@:e e "\gg@=e efjL#\g pPAnoM@:e e\g 0TAN@:e ePmCXgpـTiik\gg@@:eg*.e++@F+M+jW @2idej Aa"g"JgJI-QXgi!\g p\\gX(m@:ee*+%*can,$Ca#aJaCalHjN#Vc aaCaBCgC(gW=eggwa-g`()KCgo-CXgi !#.aJaC(a!  jocXgK+cxgI T Up JSR @:ee *jaj? `\g*\+@:ee*,*nm+Xgm\gPT"Ӄg(:e@"#CXgi!Ce aCgn*C`%l[( j\g1XUTRo@:eҞes*()m#*j\g 1XUTRo@:eҞe-*()6(hJcxg%Ca*aCaU.nE*\gT0TR.@:ee, j\gLR@:eaBCXg+n*Baj\gLR@:eҞe" ydHj hҮjje+|+G+H+j @2i deBgCg%gacaJC`Řg@?evdBSQ@:eJBajҐHe-+j3 @2i deBgCg%gacaJC`Řg@?evdBSQ@:eJBajҐLe.+eejaT3I`LI`@Cac Xgj Kj @2iego0ȞyN5`ca`jOejS @2idƤҚeAa\gD0X$gM@:e *B``CJCjudjj @2iegd@=eDdej @2ideDg|$ '\g0H@kJhI;e 耢m3m%Ox'Nieig$d!9g]#mg KjSa),asLabKI+~jL_?lx3mX2MjKUj[* j@jKA@ j[* MC|g@8ej[* 8ebM@B BL!A@8e BLj@ vd蠣 1 ! J#K iyg#jej @2ide\ggTB"a` +AbE"A@*Nf*jjks a*EJEAFA@xd|gp| K"o@M@:e"ge*jK@ \g0h@9KH2i @`C`jnN?+B*EJEAaBa@Ar*aA Ҁ\gT:e@ eKE @:e eIABB*N"j o@M@:ee"A"nB`ob`Oo+kk!nOeB#Df*@:eKE@:eIeAX"B!*@:eeKE@:eEe!Ds `jOCnADBFE8DCFG3j @2ied@:ee`*Djl r aHI j  > ? B Cj >&@/r!a0Dg@:eex*?e@e* m ">ja? j`X@:eҞe* m"0@H>g@:ee*>n* ?n*j@ * 0m@Hbgjmng@0HM@:eReg`T@:e@rea@bgjm@PLg@:ee*g@?ee*Djl r a mR*nm@IHf҂g\@:ejKL@2P2B2Mpe a0Hm@:eRegagPX m@:eP@eg@:eRe_ af j_ag j_ah j?ai6HjaI ja@@:ee?*ja jaj0@ېPM@:ee"@bgjm@ " L@:ee0𤙁0DM@:ee("9(p\@:eej m"> ja? jaB jaCj  Ґ L g@:eeP@@:ee 0D0𤙐gM@:ee"0D0𤙐g.M@:ee "0D0𤙐g. M@:ee*@bg jm@ۛPsde+j @2iedgPXi@:eRe `0 l@8eR`jRavdeh j @2ide\g%g5D5Ml:e@g" ak"dcudejR @2idgAgg:e@&g`{+el\gH@:e" !`bh3mEkecd#EdC+DjvdjKej @2idgA g:e@&g`{+eJH2A B*a\g pTg@:ee*Pgude@"D@"@Cejr @2ideGD Jjg@Ca\gg@=ewd )JJC %@=ee\gg@=e eeGdeDj ,"(`t, (00g=皜h4ggqg"`j1dk$OjeddGk :e4#(`T, (00g=皜h4gaJagaggg#`Tj1djOjDdhYL hl *EB2F2XYg}Zkdc2x `Tj!d"Ojj @2id`e#JaCdgC$g5`0Ę00.NNM@8exd l3m`ca B00H.NNM@:e e K a0dj je +G+$`n* D j je +j @2idgebjlꁜg"LJ `\gŘ\mg@:ejddAnE@:eedbjl *gnAF@:eDdjejQ @2ideXygm -l,\gT@:eDd2Uj`LjDm @Ŏ2UjLj`DOl @e@52MkjD`m @e@52MkjD`Ol @Ƃ24 1e32mm3m4l ej @2iegdpeOg@?eg@gbgPgddjq @2iedaCg ja C6a JcxgJI T lm@:eC Peg Mu@?ek KgMUcxg cea + `˘ @?ebJ g@:eeHԀHԀ/+j @2ide\gp\@:eEdej @2ide\gD@:eDdej @2ide\ggDo@:eDdej @2i d`eJa0%Eg,aK*\gP$@9ee"j@jvdj$ @9ee"\g g@?ekcaj1 +G+j @2ide\g0\@:eDdej @2ide\gD@:eDdej @2ide  I Xg$Ig'gm[`/ [xgk "\gnmg@?ezd\g g@?ee:`IZ`J \g PPg@:e"gECe Jan*DCEaF G C=aCg ja #6a JcxgJI \g Tlm@:eeC\g Pg u@?eoA #gM+Ucxg cea + `\g˘ gb gg@=eeHԀHԀ-+jn @2iedgҐ@=eEdejN @2iegd@?eDdej. @2ide  I Xg$Ig'gm[`/ [xgk "\gnmg@?ezd\g 욐g@?ee:`IZ`J \g PPg@:e"gECe Jan*DCEaF G C=aCg ja #6a JcxgJI \g Tlm@:eeC\g Pg u@?eoA #gM+Ucxg cea + `\g˘ gb gg@=eeHԀHԀ.+j @2iedg@=eEdej @2iegd@?eDdej @2ide $@Ygm['g`jM!\gm@?ej \g0T @:e* Aۀ}dIiZ`J \gPPg@:eҞe \gPP @:eea,acan,C a#a.,  `\gg gm@8e6%Ӑg@=ee*\gTʘ@:e#gga.+ c` g ځjB Gg@:ee"ACcxg ҉  Caja C`jpeHԀHԀj @2ide \gpX@:e* ۡGdej @2ide j\gpXggo@:e* `gdj @2ide $@Ygm['g`jM!\gm@?ej \gH @:e* Aۀ}dIiZ`J \gPPg@:eҞe \gPP @:eea,acan,C a#a.,  `\gg gm@8e6%Ӑg@=ee*\gTʘ@:e#gga.+ c` g ځjB Gg@:ee*ACcxg ҉  Caja C`jpeHԀHԀj @2ide \gX@:e* ۡGdej @2idei  j \gPL Caa C`  @:ee "ra aj{d   g \gPH@:e*  gK#IDgIg0g }raj gk qxg I#gII#g ҹj @2idej gk P:e@$g Ҟe*ڙj DJCC3 gMPPu@:e@a ydejm @2ide j\gXggo@:e* `gdj- @2id`eJaDgiJjN2 gc aD@C`Qg@jwd\gp@g@:eCe` EJ\gp@g@:eee+j @2idejg !aPT!l@:ee"wQg~d!r a0MP@8ei0M#K+PT!l@:ee*0M!  p\JX n @:e"gW.e/*X#0Ę N mg@:eePXg@:eBPT!e@:eeI*g0ĘN mg@:ee;)9)   Bp\J@:e"ge&* *!PX@:e"g e "gPX@:eA eQPT@:e"ge"@ @:ee@8eB A A"@@:ee@0M@:ee@ %@:e!e`0.MeF+J+j @2id`eJ,a IgmDe i \g PT@:ee";t@X? `C(6bl?*BϘB\gpP@:ee? *),?` IC- k@l*'bl *\ggpPG@:ee*` IC_a\g PT@:elMiMNeonsjl" ` IC%$IC! +;+B++!+F+ ++j @2ide\goH@:eDdj @2ideD$gs#@xǰ` axjl`*Q** kg@:ege"Pg{dD@ca\gPT@:ee@*Ba",\gmDg@:ege>"j\gPg@:ege"\g@@:ejJ#`ǜL3m_a`gC`C``C\gPT@:ee`gC<`Ca\gPT@:eBkle "L.#DK,s/+kF \ggD@:egCg e "D E+C`iJ`C\g0Tg@:ege"z@xJoBCXgc JxgI \g P@:e cea+C` x Jg Xg l FODl  *bjmBh9 Ec]` ҀH bac `@ j\g T@:ege*H b cڀ Q C6` IC?ag PT @:eH @ejP @:ege * i k Jc xgI j ҕ ` iC+)+A+++;++F+j @2idej\gH@:eEdejE @2ideD&gsP#@X\g 0X@:egCgbe+R@aaB+Dc;aR;`*P8apgbc+R3aaB+;c.aR.`*P+apgcd+R&aaB+3c!aR!`*PaPgDra\g P go@:e"gQgvdj%%##!!\gH@:eҞe0"g\g\m@:ee\gnPTg@:e j@Cg|JeE*gP @:ee=e@"g iej @2idej\goH@:eEdj @2i8deB&gCA jmAg \g@@:eFٞe*l*FhBC A jK 0}dh\ LjN {4j^4g \gzP m@:ee.j@ \gbPPgAK zg@:eke|gjXznom@:egjgLe ԭ,|g4 ^Pz m@:e e|g%j@ PPgAzN@:eke|g jXznom@:eMj e"4 \g{0Tz@:ee*JLj _* ,Kb8kcj\gkXznom@:eMj e"\g 0T{z@:eFٞe"jM jKLj ?*z{ ҂g\gp\J@:eFٞe"jM&#cقj\gkXznom@:eMj e"\g p\#J@:eFٞe"jM\g@@:e+J+jD @2ide j@@ a?p\J@:e ge*@:e ge *0\?>@:e ge *@ ?>@:e ge *kk@Plr a>pP@:e Ҟe`* >dj" j`@kF2lD2 ?hHC m  C˃g@?e .j H>E Jk  jBHe?e@bg cIk m CI@L %j JCgJ eBB 1N `C_aPT @:e PJjePP >@:e ge*i ib a> >EҷWP@:e get* " >M@?e e>jDno@:e geX*?P\>@:e geH*>Dx@jl""cm""b>l" ҢgpPno@:e ge,*> kE?> jj1Xo@:e ge*0T ?>@:e ge *0>n@?e e@@:e e"@@:e e@@:ePgd`C C?` C- ;\ Dex@jl""( l"Ґ\?>@:e ge*1@=e e"?l"j0T>@:e ge*D?>n@:e ge*@ o@:e gPLee+F++j @2idejg  .\g @g@:ee,*4=Z,`A!L`IC `&g`4IC\g4PTg@:eeg10T0g@:e*p\#J@:exd\g1PX0@:ee*\g1@0@:ee*de @ Nabjl$g"\gp\\g@Zg@:e ge8*bej "gPTg@:e e`*<҂gPX@:e=j p\eb<\gPT@M@:e e "\g@@:ePg0dj@B HjkJZӑg@:e ge*BҜ\`Dk`񠚬#Lؚk+kca\g<p𼚺M@=e ekJmJ2< K=l\g0D<>@:e ge*jA^b`@JT2Ji?XZga!L  j@:e ge>*|g2p\cJ&"j#$2'Ҁg3PX@:e4ҁ 5҂e6Dk:E8|g"jX 79(og@:e (e(9(7*@C``+ uԄ[!yoB<S `xl+kc_`EggyCZg]1D@:e ge? *gHo@:ej jkDe kmg@:e ge*g0Tg@:e ge*2 g1Xog@:e ge*@Jn*23bҢg\gPTg@:e ew" -* oB\g!NTg@:e ge* A`ܿ "BaL2gEJ?KUc1` KlJ J  B\gMPT@:e e*@K@ Zf K daӑg@:e ge"qkS2L2I`BgBK`bt3mj`caKk  j[*\g0H m:e@ Ҟe *ljeca\gp nO@8e eoBlnAC*D2iH2 g{U\gp\bg K@;e geM*\gP\ӑg@:e ge<* g@;e ge/*\gP\ӑg@:e ge*`J@<nZXgi\g@p\Cd Jg@:e ge\g@@:e e\g@@:e e(<J\gp𼚺M@=e eL\g@@:e e iҢg\ggPP@:e ge*Ƣ(&@%"D2iH2Ib>a"DMJmJ\g0D@:e ge*Jid2iH2IE.F2aK gg\gP@:e ge? *b2J2klL3 CLKt3K?PU\gPTU`G 6`c``c@:eEJk N2 DFkeaGaB^J^JT2JigȚjT2Ji?@\gP\@:e ge *\gP\ 23ӑg@:e ge56?` 60`ca@:e EeJk N2DT2Ji?P<ag\gp\d J@:e ge"}`c)*#\ggPX@:e ed+ҁ1, /-҂j.0jl"[L(k 3[j,2ZogoB 2 |g1X@:e ge*|g<jcL=@)<APTLԤgB@:e e;*k|gjX og@:e e|gB@@:e e (0 (.* jl0"\gP\g@:e ge""e p\(JAg"e p\(JAg)cJ\gnXog@:e ge"e p\(JAg "e p\(JAg+F+#+@&+Y++jB @2i.dej@ ad$gFg&$a`a~3 *Z\gYPH nog@:ege"j0 lj ^Z" ҂g\gn\m@:e e%+ggj0T kg:e@egD g:e@gge*\gYZ0Dg\g YD(Ogg@:e  e@*ZY4j4`\gg@gg@:ege1""\g@@:ee " *J\gg@=ee\ggQ8Zno@9ePg |d\gn\m@:eeWkOlkm@@j@X@B "ml " ҢgpP@:e e"7T 96@:e ge8"  @9e j1X k96o@:e ge* Ңg6PT@:e e*j6T@:e ge" <8;7:6Bjp\J@:eg e"@@:eveF+@+j @2idfg `e/sgaJ Ng&gHP` '\g pLѰg@:ee*1* jyd`I/sa   \gpL@:ee* \gp\ kJ @:ee*Pgg \gp\kJg@:e"j @2id`e J2a*\g0HAm N7ܫ@:ege8"L)\g@=e `v\g0P L@:ege"\gnLm@:eXٞet \gp@@:ege"jlU"\gAPTlQMML@:ee*nAMNEm@:ege*v@ JaLj"AD@:e C2jUj  ҁAnE@:ege*4$"`@DC$`*mAD@:eAe\gMMPTl@:ee* j`@EC\gnPT@:eeB l \*\g@gg@:ee*` \ggPLg@:ee* J Қ*@ b@jl`*\]r`a `*Ӝ^``jl *xl` *mY%m %@*j*jL@+FZajg[;e`Ca` ]`m%-jam٦I&@ج^aaF/o ''l (GHX`G /ygOzhn/jEx Jfj"*AD@:eDke #jG |dnJ"\gg@=eHeZ ҂aFkdjDz+2T2 L2aS "@XZ*_aX j{"^Z*_"Eg\gP@:ee+C_`\ggP@:egsXgKdgMe#oDggJe UXggo@:eBCXgie*Dzl *JgCg`n -*\g0D@:e gHjLe#DC` "jlb*\g0HAN@:ee"jv j d , l ,ErXgZXg Ԉ l$,d ` # ia B@8ege * ex I HC@a hcWa`DTR a\g0T@:ee*DkKXl" l*jl "\ggL@:ege"b gmB\gD@:eeB\g PLБg@:eeng\go@:e@gHeg PLg@:e egTmg@:ege * ei J ҁg n?e@g e?en@g0 e?en@g eg@?e Je gcaBkL#kmBa4bl"\gnppD M@:eDٞe"djYd "\g`򜫰D@:eHblB$  +++ ++!<++F+@G+P+++D+C++"+j @2ideg\ggPXm@:eFde'd@?eDdj_ @2iddeDgJ\ggPT@n@:e(@e:eyLbg@5䠠5@2ꧠ7 776à7H AKakYg6416414e@640@4 .g15-78gc=g5`7e1f5颚`75b05 g.0@`1 ~3.qgKPsڀJa&' !$%"#     \gXJ`B`0"1b63m6`7@Jb53m5`44b3m`3x3-77ggggmgmgu ӹxg p7b3mp6 b3m j0`3mj1 `3- @06 1 @0-gm   , gm ygbgm䣝 ̚gcxgg}`4b03me`1b63m4`3x34b34mxgndg6.0 1- 1m .gq g 6 54 4 0 5 1 5- @04 1 m@0-g   , cxg ygdgm䥝Ԛgcxgg}`4b03me`10b63m`34x34b34mxgndg6. 1- 1m .gq g 6544 051 5- @04 1 m@0-g    , cxg ygfgm䧝ܚgcxgg}`4b03me`1b63m4`3x34b34mxgndg6.0 1- 1m .gq g 6544 051 5- @04 1 m@0-g   , cxgg `Ěcyggimumgcg`4b03me`1b63m4`3x34b34mxgndg6.0 1- 1m .g q g 6544 051 5- @04 1 m@0-g   ,cxg ԙg㊜ h̚cyggkmumgcg`4b03me`1b63m4`3x34b34mxgndg6.0 1- 1m .gq gԱ 6 54 4 0 5 1 5- @04 1 m@0-g   ,cxgԙg㌜ pԚcyggmmumgcg`4b03me`1b63m4`3x34b34mxgndg6.0 1- 1m .gq gԱ 645 4 041 4- @05 1 m@0-g   ,cxgԙg㎜ xܚcyggomumgcg`4b03me`1b63m4`3x34b34mxgndg6.0 1- 1m .gq gԱ 645 4 041 4- @05 1 m@0-g   ,cxg yg@K;eJa̓&'  HK$% "# ! ᚵgJJLa`vdej @2id D'*Gg$*tlEg#omg@:e"gJe*g0ĞmNg@?ejKQgvdj Died %TkkE#on@:eEdjed%LDkaK@*s atnE#on@:eEdjej @2idtg|Lҗj@og:e@&gJe"EN#n" jgK`0Ğ.Nmg@;ejKjKvdTnCMg@:ee&@d`xB0` `#@!dFgC`jK J je jj @2idtg|Lҗj@og:e@&gJe9"E%% ` en3"|gj0ěK`噎Nmg@;ejK\gm0ĚNN@g@:e ETgoAg@:eJe*jKwdTnCMg@:eZXgJ&fkjojaB5@2U@iK@e j @2id$eB l >"C%g;*glT@:egxeN-(%H@a0pD L@:e1Pe™006ONM@8exdj} @2i deBl1"g%g1P@}OBD60DNJg0H@:ee™0H6NO@:ee"g@8evdj @2ideGDJEg\g㜰Dœ@:eDed jej @2idxejl"j|d+hkAكy!~[k@klr aa[CcJxgMj+;\a jje Kj: @2ieg˜xjKgaL2Q AJ rKa0D.Jj @2ie dgp\#oJ:e@$g Ҟe"@T@:eHe@:e0Ę.Nmg@:e wdj @2ide\g"op\J@:eDdjZ @2ideGg"JhJ `"jKjK wdxjl{*Uga`a\g0Ěm Ng@?e \g0Ě nNmg@9eD3Mh3e`I`JVCaTlE5Mn#o)Mg@:eei PSJPad2ijH2IJx`|a@BI/B) )$\g@=e*؞e "\g0ĚmNg@?ejA"rxg#JAjzej @2ide\g#np\m/ J@:eDdej @2ide\gp\#n/ J@:eDdej @2ide\gp\J@:eDdj @2ide\g"np\m/ J@:eDdejz @2ide\gmp\J@:eDdj: @2ide\g#np\m/ J@:eDdej @2ide\g"np\m/ J@:eDdej @2ide\gmp\J@:eDdj @2i dgH @:egU[*e\ggHn:e@ddejz @2i dgH @:egU[*e\ggLn:e@ddej: @2i dgH @:egU[*e\gHg:e@ddej @2i dgH @:egU[*e\gLg:e@ddej @2i dgH @:egU[*e\ggLn:e@ddejz @2i dgH @:egU[*e\ggHn:e@ddej @2i dgH @:egU[*e\ggLn:e@dde55 dDgha1d`Lb1`6-`1b3- |j @2id&gTnCg@:e Ҟe[*!%U`IC`#`IC\gPTg@:eeB"\gPg@:e:\gՐ\g@:e je`jK\g T@:ee\gH@:ee|gm0ěcN g@9ejKjK xdj @2ide\g$gPTg:e@nTxjle"\gPm@:egg8e@oydejZ @2ixde# )A@@:e\C`CIC`` \gg0D rJ@:eeS* icBac `cKU` C `C` C\gPTg@:ee "\gP@:ee *jwd \g0DrJ@:ee"\g0ĚNmg@8ejKXkdjK!gej @2ideEg+JH2\g$gDm@:ee*jKi+QgwdgSHIX jl("A)LC`IYI#``H@C\gnPTg@:e jLe#\gmPg@:ei\g@no@:eJe *K +i+\gg@=e\g@no@:eJe"xjl "\gmPg@:eeA)L6`HACa\gnPTg@:ee\g0dCg.JC`@La`BLa.t`aDD\gaذLg@:eN[8geI`H@Cem&dtj@o@:eEdjY @2idae$g#awd,+JH2I@*H\g ӰTҕ`, g:e+M@5 m*Hej @2i degҨjҰT$g g@:eJ*0ĘNNmg@8ejKJ "jag@8ewdejY @2ide\gmH&gn:e@ge$*\g\g @:e Ҟe\gL "\g0ĚmnNg@?e mng@:ejK aigB)Kc"aJtj@og@:eJe5*\g0ĚN@mg@:eeJUoB[*+JH2c``\g Tgg@:eJe,*\g0ĚN@mg@:eG]n*\g0D Jg@:eJe*\g0ĚNaJIAٺ &"MN##Ktj@og@:eJe%*\g0Ě N@mg@:e g@:eJe-*\g 0ĚONmg@9eF.n*\g0D Jg@:eJe*\g0Ě/NA iAgE\gmTg@:eJe *\g 0ĚoNgX?LA:"@@AADB*p\ JBBlH0L@:eRe`j?\lra@0ș<:ePNm@gTe@:eke`?p\J@A=+k= *xjDJlkmXXkL s#kkl kmX0D= Jg@:eV*TkkEn#omg@:eJe*T@:e @e 8 $xjl"@=ejeA؀$@=eje@؂AD"P@@:ee "0șmNg@?ee g@9e `h0șNmg@?ee0H@?<@:eBJe*@ T@:eHe@:e0ș<ҰNm g@:eekT nE#omg@:eJe*@ T@:eHe@:e0ș<Nm>kl 7"T nE"omg@:ee(*?jJM@?no@:e Je *@ T@:eHe@:e0ș<Nmj G@)JgPn@:ereapT0𤙇@ n.M)L@:ee*tn $NN#?jJl*T@:eke0D= Jg@:eJe"xjl@@p44`3@𓠍@𒠀4}[xgt3*JLx@@:eJe"V"0ș0NjjMP@xبm)L@:ee  X@ L*D<@:e@؞e"0C MPgT X\ @@=e eB"kT nE"omg@:eJe1*@ T@:eHe@:e0ș<pN |J]ja |J^j a |J_ja \j9` |J\ *0Xg@:eJe *TkkEn#omg@:eJe* 8`lPg~d0DgpJ@:ee 0ș <@N:em@gTe@:ekee m&&mj3 @2idej\gp@@:eFd ܠej @2ideX*jKkjkҐT  kog@:ee)*BkklBذ\ nm@:e04 e g@9edl췛۹bllbxdej @2ideD$gj %\g@@:ege*3m("\ggX@:ege"Pg~d \gnPHom@:ege*\g Qnog@8ee҂g\gn\m@:eDx@jle*E  ҂g\gPT@:ee"qq \g 0Tg@:ege"\g PT @:ege*\g \ m@:e e\gř\m@:e Ye=|gl0D1m9J pDnog@:egen*l(|g@ g@:ege`*g0Tnog@:e0Xg@:eSeaaC,6\aS\`+RYajg`RˏjK@XpPog@:eE=ye1Dg@:ege*gP g@:ege*D `kwbjKlkmB "\g @@:ee "\g @@:eF+ j1 @2idWҚe`jud脜ECaa@9e9e@H؊I@9evJCg1`3B2mwVCg1`3B2mxWCg1`3B2myXCg1`3B2mmYCg1`3B2m|1MCg1`3B2m}\Cg1B2`3m]udj. @2iegd쟤gl@?eDdej @2iedgp 8e@%g 8e@@ 8e@B 8e@A 8e@C Dj8eI@耚 @DgJ ravdj @2idaeCgg1`3B2p mÁ8e@%g 8e@A 8e@B CudejN @2ide$gg``C`C\ggPTg@:ee "\ggg@?e He IC `@kkJlICa@*vd\ggg@?e@kkJlA@JleEj @2ide%gg'`jKlknZXg\ggT@:e HkB4B2lle `Cg1`3B2ma1 @Cg1`3B2mA\gpL:e@A@:eB@:eC@:eD@:elECg1`3B2mmLCg1`3B2mM@:eZ@:eG@:eH@:e[eq*\ggT@:e ҮHLeh+le* JLCgknZXg" V*(jI@:em@Jdra@:eY@:e\DRD"ru`Ra`" b2`3m1@+ S " @XJcajl*CgJJZ{`jj  = * "*`\g@@Aegg XxY :eiXgPHygm@:eeje++w P+j+ @2ide>` ? ] Ja6[g`Jagjl?* mw"\g@@:eҞe* q CXgicc5xydgycggi]a * `\g@@:eҞeX*g jlc*Ac c6x晉 ye秙gԩgI x y \gPH$g m@:ee*j}d #gL.M.BJ a\g 0O@?eQg$gg`jm@`jKl @ؐgOjgL-lba%`gL.M``m@`jKl@0gej @2idbҚe%gA|#z"bgB*@Zpamꢚhabڠh n A=ea`"n nBؠ۬mߠn۬`yg#|g0d"k#`j`*k@gl-m@`jKl@\gg0䚱gO@?eeBa"m0%#m+%`jKl@@kkLPggaڗ`ٕgCgh kl=e"k ` bn,BؠA؞@h#k#k``jKl@\gg0O@?ee@mkl@@m@@gM\g`0䚐gO@?e`V+vd@kgl-m@`jKlOg@رg@?ee%`jl"A"kl.%#k``jKl@\gg0䚀O@?ee@mkl@@m@@gM\g`0䚐gObgj@ۥe@"bgB*Cge@"bgA*CgeDgl`N#a#Cgb+蠚bg]Ega# j jeDgl`N#b#Cga+蠚bg]Ega# j je@Zakklbjab#j@a#j@@@AAB Bݡejj @2iud{+e `*kTlrXg%*j˜`\g 0D$ Jg@:ee"Tkm|gT0d@ K eI+ m@:eTkklkmT BC DJDD؀J`CÙ`C`C\gPT@:eekrTklxgmT J Jc xgIcitmbgkklTg\g0H@:ee!" :e@m jKCEng@:ee_"\g@@:eIÙ `Ca\gPT@:e`C++j& @2ide\g0DJgo@:eEdej @2i de@bgJa`Ja\g%g00DMMg@:ee**K\g@n @:e ,SFgaj\gg00DM@:ee0*#\gg00DM@:ee*bJlBa@WJZ7` 0@@:ee-*jl r&a\] 0P  Ӱgl@:eLelg@:e Ce ` 0P Ӱgl@:eejlw" jmG BTQL@:ege* mBTiL@:e egA"XLPL@:ee #"TaP@@:ee H"0M@=e e@=ee@ @:ee $B"@L@:ee@@:e jTLm L@:ege " BPLQL@:e BeiL `@d++| ^ F+eej @2ie dg@$g@:e g0Xem@:eaB#kF6lkL#kmkl"jMp@0@H ґg@8ewd jj @2i de0$%gj5L,g"jMj,"jMpD n@:eReg`@8e@vdP0@H g@8e:+j @2id`e$gJ+agg.+'bjl)"#$PX@:ee  o j 0D!Jng@8e* +ydje+&+G++j @2id`ejKlrg`r`r`jdd\g\@:em *G" CkR2lnA$%x :$%x 7$%x 5$%x 2$%x /$%x .$%x -$%x +$%x ($%x !$%x $%x $%x $%x $%x $%x $%x  $%x  $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x ~$%x v$%x t$%x r$%x m$%x d$%x c$%x _$%x ^$%x \$%x [$%x O$%x M$%x G$%x F$%x E$%x @$%x :$%x 9$%x 0$' '%16llu Bytes used by bitarray #%lu for %s#%lu%u:%d%u %16llu extents (%llu bytes) %16llu bits minimum size %16llu bits maximum size %16llu bits average size %16llu bits set in bitmap (out of %llu) %16.4lf memory / bitmap bit memory ratio (bitarray = 1) Illegal block range: %llu (%u) ext2fs_block_alloc_stats_rangecheck_desc mapIllegal inode number: %luext2fs_inode_alloc_stats2Illegal block number: %luext2fs_block_alloc_statsInode I/O ManagerEXT2FS Library version 1.47.3Wrong magic number for ext2_filsys structureWrong magic number for badblocks_list structureWrong magic number for badblocks_iterate structureWrong magic number for inode_scan structureWrong magic number for io_channel structureWrong magic number for unix io_channel structureWrong magic number for io_manager structureWrong magic number for block_bitmap structureWrong magic number for inode_bitmap structureWrong magic number for generic_bitmap structureWrong magic number for test io_channel structureWrong magic number for directory block list structureWrong magic number for icount structureWrong magic number for Powerquest io_channel structureWrong magic number for ext2 file structureWrong magic number for Ext2 Image HeaderWrong magic number for inode io_channel structureWrong magic number for ext4 extent handleBad magic number in super-blockFilesystem revision too highAttempt to write to filesystem opened read-onlyCan't read group descriptorsCan't write group descriptorsCorrupt group descriptor: bad block for block bitmapCorrupt group descriptor: bad block for inode bitmapCorrupt group descriptor: bad block for inode tableCan't write an inode bitmapCan't read an inode bitmapCan't write a block bitmapCan't read a block bitmapCan't write an inode tableCan't read an inode tableCan't read next inodeFilesystem has unexpected block sizeEXT2 directory corruptedAttempt to read block from filesystem resulted in short readAttempt to write block to filesystem resulted in short writeNo free space in the directoryInode bitmap not loadedBlock bitmap not loadedIllegal inode numberIllegal block numberInternal error in ext2fs_expand_dirNot enough space to build proposed filesystemIllegal block number passed to ext2fs_mark_block_bitmapIllegal block number passed to ext2fs_unmark_block_bitmapIllegal block number passed to ext2fs_test_block_bitmapIllegal inode number passed to ext2fs_mark_inode_bitmapIllegal inode number passed to ext2fs_unmark_inode_bitmapIllegal inode number passed to ext2fs_test_inode_bitmapAttempt to fudge end of block bitmap past the real endAttempt to fudge end of inode bitmap past the real endIllegal indirect block foundIllegal doubly indirect block foundIllegal triply indirect block foundBlock bitmaps are not the sameInode bitmaps are not the sameIllegal or malformed device nameA block group is missing an inode tableThe ext2 superblock is corruptIllegal generic bit number passed to ext2fs_mark_generic_bitmapIllegal generic bit number passed to ext2fs_unmark_generic_bitmapIllegal generic bit number passed to ext2fs_test_generic_bitmapToo many symbolic links encountered.The callback function will not handle this caseThe inode is from a bad block in the inode tableFilesystem has unsupported feature(s)Filesystem has unsupported read-only feature(s)IO Channel failed to seek on read or writeMemory allocation failedInvalid argument passed to ext2 libraryCould not allocate block in ext2 filesystemCould not allocate inode in ext2 filesystemExt2 inode is not a directoryToo many references in tableFile not found by ext2_lookupFile open read-onlyExt2 directory block not foundExt2 directory already existsUnimplemented ext2 library functionUser cancel requestedExt2 file too bigSupplied journal device not a block deviceJournal superblock not foundJournal must be at least 1024 blocksUnsupported journal versionError loading external journalJournal not foundDirectory hash unsupportedIllegal extended attribute block numberCannot create filesystem with requested number of inodesE2image snapshot not in useToo many reserved group descriptor blocksResize inode is corruptTried to set block bmap with missing indirect blockTDB: SuccessTDB: Corrupt databaseTDB: IO ErrorTDB: Locking errorTDB: Out of memoryTDB: Record existsTDB: Lock exists on other keysTDB: Invalid parameterTDB: Record does not existTDB: Write not permittedExt2fs directory block list is emptyAttempt to modify a block mapping via a read-only block iteratorWrong magic number for ext4 extent saved pathWrong magic number for 64-bit generic bitmapWrong magic number for 64-bit block bitmapWrong magic number for 64-bit inode bitmapWrong magic number --- RESERVED_13Wrong magic number --- RESERVED_14Wrong magic number --- RESERVED_15Wrong magic number --- RESERVED_16Wrong magic number --- RESERVED_17Wrong magic number --- RESERVED_18Wrong magic number --- RESERVED_19Corrupt extent headerCorrupt extent indexCorrupt extentNo free space in extent mapInode does not use extentsNo 'next' extentNo 'previous' extentNo 'up' extentNo 'down' extentNo current nodeExt2fs operation not supportedNo room to insert extent in nodeSplitting would result in empty nodeExtent not foundOperation not supported for inodes containing extentsExtent length is invalidI/O Channel does not support 64-bit block numbersCan't check if filesystem is mounted due to missing mtab fileFilesystem too large to use legacy bitmapsMMP: invalid magic numberMMP: device currently activeMMP: e2fsck being runMMP: block number beyond filesystem rangeMMP: undergoing an unknown operationMMP: filesystem still in useMMP: open with O_DIRECT failedBlock group descriptor size incorrectInode checksum does not match inodeInode bitmap checksum does not match bitmapExtent block checksum does not match extent blockDirectory block does not have space for checksumDirectory block checksum does not match directory blockExtended attribute block checksum does not match blockSuperblock checksum does not match superblockUnknown checksum algorithmMMP block checksum does not matchExt2 file already existsBlock bitmap checksum does not match bitmapCannot iterate data blocks of an inode containing inline dataExtended attribute has an invalid name lengthExtended attribute has an invalid value lengthExtended attribute has an incorrect hashExtended attribute block has a bad headerExtended attribute key not foundInsufficient space to store extended attribute dataFilesystem is missing ext_attr or inline_data featureInode doesn't have inline dataNo block for an inode with inline dataNo free space in inline dataWrong magic number for extended attribute structureInode seems to contain garbageExtended attribute has an invalid value offsetJournal flags inconsistentUndo file corruptWrong undo file for this filesystemFile system is corruptedBad CRC detected in file systemThe journal superblock is corruptInode is corruptedInode containing extended attribute value is corruptedGroup descriptors not loadedThe internal ext2_filsys data structure appears to be corruptedFound cyclic loop in extent treeOperation not supported on an external journal/devices/devfs/dev#%llu for %s#%llusystem.posix_acl_defaultsystem.posix_acl_accessgettimeofdaycopy of system.datatest_bitmap(%lu)get_bitmap_startget_bitmap_endclear_generic_bitmapmark_bitmap(%lu)E2FSPROGS_BITMAP_STATS [+] %s bitmap (type %d) ================================================= gnu.system.richaclsecurity.trusted.system.user.called %s with 64-bit bitmap for %scalled %s with 64-bit bitmapEXT2FS_NO_MTAB_OK/ro/.ismount-test-fileext4ext3ext2bad icount%s: count > size %s: list[%d].ino=%u, list[%d].ino=%u ..EXT2FS_PRETEND_RO_MOUNTEXT2FS_PRETEND_ROOTFSEXT2FS_PRETEND_RW_MOUNT/proc/swapsFilename /proc/mounts/etc/mtab....<%u>/<%u><%u>???icount_inc%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%s/%s-icount-XXXXXXSOURCE_DATE_EPOCHE2FSPROGS_FAKE_TIMEblock bitmap for inode bitmap for converted cluster bitmap/.journaltdb_transaction_lock: failed to get transaction lock tdb_rec_read bad magic 0x%x at offset=%d tdb_rec_free_read non-free magic 0x%x at offset=%d - fixing tdb_rec_free_read bad magic 0x%x at offset=%d %*llu/%*llu%.*stdb_brlock failed (fd=%d) at offset %d rw_type=%d lck_type=%d len=%d tdb_lock: invalid list %d for ltype=%d tdb_lock: lck->count == 0 for list %dtdb_lockall failed (%s) tdb_unlockall failed (%s) tdb_write failed at %d len=%d (%s) tdb_mmap failed for size %d (%s) tdb_oob len %d beyond internal malloc size %d tdb_oob len %d beyond eof at %d expand_file to %d failed (%s) expand_file write of %d failed (%s) tdb_alloc_read malloc failed len=%d (%s) transaction_write: failed at off=%d len=%d tdb_transaction: fsync failed tdb_transaction: msync failed - %s Invalid error codetdb_lock failed on list %d ltype=%d (%s) tdb_unlock: list %d invalid (%d) tdb_unlock: count is 0 tdb_unlock: An error occurred unlocking! tdb_read failed at %d len=%d ret=%d (%s) map_size=%d transaction_read: failed at off=%d len=%d TDB file remove_from_freelist: not on list at off=%d tdb_free: update_tailer failed! tdb_free: right read failed at %u tdb_free: right free failed at %u tdb_free: left offset read failed at %u tdb_free: left read failed at %u (%u) tdb_free: left free failed at %u tdb_free: update_tailer failed at %u tdb_free record write failed at offset=%d tdb_next_lock: loop detected. tdb_next_lock: On error unlock failed! tdb_traverse: key.dptr == NULL and unlock_record failed! tdb_traverse: unlock_record failed! tdb_transaction_start: cannot start a transaction on a read-only or internal db tdb_transaction_start: nesting %d tdb_transaction_start: cannot start a transaction with locks held tdb_transaction_start: cannot start a transaction within a traverse tdb_transaction_start: failed to get hash locks tdb_transaction_start: failed to read hash heads tdb_transaction_start: failed to prime hash table tdb_transaction_cancel: no transaction tdb_transaction_recover: failed to read recovery head tdb_transaction_recover: failed to read recovery record tdb_transaction_recover: attempt to recover read only database tdb_transaction_recover: failed to allocate recovery data tdb_transaction_recover: failed to read recovery data tdb_transaction_recover: failed to recover %d bytes at offset %d tdb_transaction_recover: failed to sync recovery tdb_transaction_recover: failed to remove recovery head tdb_transaction_recover: failed to remove recovery magic tdb_transaction_recover: failed to reduce to recovery size tdb_transaction_recover: failed to sync2 recovery tdb_transaction_recover: recovered %d byte database tdb_transaction_commit: no transaction tdb_transaction_commit: transaction error pending tdb_transaction_commit: locks pending on commit tdb_brlock_upgrade failed at offset %d tdb_transaction_start: failed to upgrade hash locks tdb_transaction_commit: failed to get global lock tdb_recovery_allocate: failed to read recovery head tdb_recovery_allocate: failed to read recovery record tdb_recovery_allocate: failed to free previous recovery area tdb_recovery_allocate: failed to create recovery area tdb_recovery_allocate: failed to write recovery head tdb_transaction_setup_recovery: transaction data over new region boundary tdb_transaction_setup_recovery: failed to write recovery data tdb_transaction_setup_recovery: failed to write recovery magic tdb_transaction_commit: failed to setup recovery data tdb_transaction_commit: expansion failed tdb_transaction_commit: write failed during commit tdb_transaction_commit: write failed tdb_transaction_commit: failed to remove recovery magic tdb_firstkey: error occurred while tdb_unlocking! tdb_nextkey: lock_record failed (%s)! tdb_nextkey: WARNING tdb_unlock failed! freelist:freelist top=[0x%08x] bad magic 0x%08x in free list entry offset=[0x%08x], rec.rec_len = [0x%08x (%d)] (end = 0x%08x) total rec_len = [0x%08x (%d)] tdb_delete: WARNING tdb_unlock failed! lock failed in tdb_expand tdb_open_ex: can't open tdb %s write-only tdb_open_ex: tdb_new_database failed!tdb_open_ex: could not open file %s: %s tdb_open_ex: failed to get global lock on %s: %s tdb_open_ex: failed to truncate %s: %s tdb_open_ex: spinlocks no longer supported tdb_open_ex: failed to take ACTIVE_LOCK on %s: %s tdb_open_ex: failed to close tdb->fd on error! tdb_open_ex: %s (%d,%d) is already open in this process flvaltdb_reopen: reopen not allowed with locks held tdb_reopen: reopen not allowed inside a transaction tdb_reopen: munmap failed (%s) tdb_reopen: WARNING closing tdb->fd failed! tdb_reopen: open failed (%s) tdb_reopen: failed to obtain active lock tdb_reopen: fstat failed (%s) tdb_reopen: file dev/inode has changed! E2FSPROGS_SKIP_PROGRESS%llucache=offcache=onqcow2.c*l2_tablebufSuccessCorrupt databaseIO ErrorLocking errorOut of memoryRecord existsLock exists on other keysInvalid parameterRecord does not existwrite not permittedtdb_data_size1.47.38-Jul-2025hash=%d ERROR: failed to read record at %u rec: hash=%d offset=0x%08x next=0x%08x rec_len=%d key_len=%d data_len=%d full_hash=0x%x magic=0x%x ERROR: failed to read tailer at %u ERROR: tailer does not match record! tailer=%u totalsize=%u %s/%sE2UNDO02while force-closing undo fileundo block mapUNDO_IO_SIMULATE_UNFINISHEDcacheonoffcache_blocksUNIX_IO_FORCE_BOUNCEUNIX_IO_NOZEROOUTAndroid sparse I/O ManagerAndroid sparse fd I/O ManagerUnix I/O ManagerUnix fd I/O ManagerUndo I/O Manager ;n C&vkkMGP&"/+Ka5 d1͆< 8OLpHEAR_[԰VRVuj6n+c gZy@}]p{zt^f͘#W`9'<݋Rd+[XF﷩`6h}/-03l ]2mp'ݰVqKI6Lδ "u=:(Fy>C͚}-4pw0Gm=K9V'#C.=* rOx ͻK} x|VqiuԍkoRlbf^FZ^[W}S`fM0cIZ-D @Ɨd 'NK`#%▒+/l6/A ]h@D+f{*uP6&;>k;qv2PUMƼ_}>1ֆոy4:Zi mY`ۀdO7z2~ɋs\wKO VKF68BG+\{Xf=U@QC]S%;!&),(^G6MB2P?v,;Zk&ˑ HVнMR#/VKm`lp+ =eh 'ޥdo#j͡`볽>~ɴ}:̣y{6`Ɵ}q[uF2 -tq0]YK.TPɶ@NEJOG +C{}!C`rFOv[h lGJa0e-$KZV^pm0=5^ [7Q3R>?:Ѐ$Ѝ V:-)Tũ&yh;+֭PlM/kv|`v#d'sĉ yྀ:gК՞}b> q 2+ߢ6hfmu{ڵ6]@ܠr_E$!=uֿ7~zHCRXQ*]lbu'o=(QHZϰbUul{f$'iAH:FN= $84g֦; 6&Q)RHieSulH\utx {*T=֕O=ҝ$ 05l3:Bu֌M@$=Ogh/HphQ-_lQuAFlL_C33bM{9v6/kp͎*\3k.ؐQdQ_6iP#3**Hf؉%_ Fu{*ޞ{LbTx> waZje${غ3V*$89K_7FF뮉8|M{bgBqyF_v_4! b~F{+)C[$أlb^*=3QؘPD"~FgKǨ18gZg>CěZ6z/Mc{$l? 尒C@ĂW2/݄6Xb"w -=ʌgj~_ ]!pC/Z~/p6/bpım 5GQ(g~l03Z?mCEZMͱJӖ~u`gq*~ZT%CW 866/#ĨJi,}V ֊YHʴuc8*۱!}TT& rʮI6Zpi;iU /޿TH ~Mӛ/siȡppnDϲ6MaTQYlʭI!+83FM<3ni1pC.C!M[tTb=TԦi!8|_ʞs, !Ռ~^8!!=SʇF28HdGgypZioقļ `u54X_6a7Q2F3jC10۳M&X'G%.$! %F "L#(Z<)/+e*3!/8."3,׺-Q{=v+!wGuxtBIqIp?[rs fUxEy6{_zq~T[c|=}mkjyE7hi9l[m+orn%edd!fԆg xb?cޓaf`oM> LN.OWDJ\ FPyPQlS ^R݌WLVgTgBU>^qh_]Df\YtXZz[zZVC? 4]腨]'K?"~1)9#@̪`-܋'wm~y9fk`eCOpA{]S]C`֛n*&!a|Ӑ8rHنX^7VBD_,M$A"2b[;P|Г%9h򠠰^'٫) @;c5u:ϖc$~} :н:WSc޾Y̺X$K1¹}E'^oNaE@s,}m(`wn|Lֲdk %Eә*dYrN9hfa-+yKzc͋aW7Iғ/pnr fcu|KF6FVn( JqC*"-knDL"stloI' kRC}(_ H1T DZal4{4&j'A/FpZkD*:C%Kc %iuNA oۗ;֤L}[dGbx'x(N}~ fwgb*rޒapެIilv- ll5c iKUscI/)f=zƑsq~f Ydv_ a??{y#sC[|Q 8g1-\j tbMpըtumo:ı^hhvL{b[S5,xɂ07역^0PiyQ ?ՒQ}5Tu :gVOgv~l!J{2$BET"|+>@i^s0.wH7& Mm{ɔkwS#5BRr2h,yG.NQ)\\<22 yVY@7c~y fV08|TٓS|=e抝Aqq!`kY駼== ]eds[j?noxtje\ ttʐv8q^Oħ/v~3zS :̏`{I g iL+A`a(K , iXŦ&+1bx*+ubJ0o-ɺh.[4C N2YC:{T$^So(SDǿI2᪋&sD<:#^OdӔDݫ&>o3P$O)(JG#X.c9B4gׇ.VH/L RjH^ť\7A~&F TmVN׭ZvF?!@Le|޸f%[rlVANhL)DF Kbz\Q`dt-In.} pkpg]jj~4@d}'ǔ lvUl`xmuzGb3~$B7)% ^BSboDIu+ab칰I{.JeiحsjCg#NYN}T) lcSyxmu:bGwso e hke[r鑏k{@q2';MA6c!W,(χaCH/YIKdQūi& +EF FЅ˭ B:%&R +*u<]1 xru ?b$oeeM~M@S5WbHZfم}PuK deL<4'E=Ԩ$ tU\-ǚkgO7{azW[L# 'K3;w޻ _P\]$8J#Gb&eyhTvLO^r4;6!l,f|N6:Ӿ7 #-[k3CK;|Qg\kJKQF+d i&{~=Ss{%>l*d|IzRRҌʛ$\粌jĽB:4L͉ ֡r٩񤂡)yQbղ":9Bxi*cARN9U{y=`tEMcVnhL @A!8V-:[U u('*ex=P0uN)anf$C3X6>/q4 B&Oٚ^XQvU)wAۆz9m`V'._wޯֶΙF>Og,f77vvmǰ@[ $+\H0t0qXj G\ԂLxdш4hMjegp5}_oREHr Oi% 7D]_u49(._3#'OWh"39v2mes9{V" JOܾ'o AJ%Yj14:\+/Sx .VamʸXdh23#]o~8'6d+]Ե {Ŕߑ &)EqAڭDC, 38|)籂yR-6H:<-?zW@ԇr%=f4TKf1c uNҟm:8_0w!p\ cUe05*g$f/p `1;l Y^ˆu $p,(k'D9BA)R솰WIW?{:,Rn=!,-ebt~>G)VVLS[;⃴ŵ^镃GE-gu(p("@aRCˢqU ɋ[>ZiKltx#ibO ^&5mib|߼PPgJt[{Zh4 yh?ɨBq gٚcG4ߟQ_N1 }~blLу(;S:VuuM>dWFp`?q@BF(SI#-tE׍ڕX'ǮhĪϓnjz]Q=Lalj6{TϼHYљmS"i_*@}Q0bXsf])5O,cD󷲽K#&UZND!wvfq|>+5]HXP0ANrcEEMTNgӼ&v;#tKw oYz~ MF\Ǎ0<k7i`z5ѺݫzkCX RlI[ʷCe^jFn1U Ԍ>-cd8n`ʳkok 5R(اy{_A:•ǞT?pp+| yTz"?ajHȠQq4_pR!ю3뵳756E[`WyU3"C징0mF;Hf8^򭌈 -T1AnS撜k:Xp_+(y.2cKl8:g?@ %R|9T/[ RJjAY1Q͆$&p}ؑ3ʒbLL6iGu ,]Ecrhy/ 'tX틨 |<MgJŇFOVw _$}-gs5bxnϲ!ـv&qA-pH+/C$&zADl,OH/Iy*B"iD'j8V1p{.3~8%[=]{WN 2RVS9c\8EP1/trϩwEt[4L~n_0&Z};eʸu5HnQ ٪a_jMӐZ٥eoV`1 &:#k<g`dkp;P5&dXي۲x8(k;CML('x$<^o^lD5☷e4pPsӯ% 6ĠhW{Tl׉]vHx&KMNގ )*}3'šL6i5wdUX_K%4Am •1Ō~I0ʈF9E#y]YBZ-)~:}QHa[ja}bˏun{AKm@H+Rᆠ tTgWysEp95*l8 oQS!h%QYN$')uBMd;=w8):qf e]6baa`r}\~7TtgG HtZ$ Y8O\,E,F? Tq$b@iD9W0R A* 5|z6ݛ<*)h/x;{pKcȦglEd/W_3̦K6 PQpCRF"eNRMсvi(jnڞɝ;vzuc 3Xr~@>.S=Euf!"f*8Zٜ+V>= mN&ǥ13V"0۱2|,,/BG ~TI?oZΎj|oӨb!\2_vI"Cr@d Yg:a1JZJ{.xl^0+[ [`?$O7is"҈!zgs\=HO>#uonvU>j4i{Ɲ՞ '7y܋MGNj-#FLR_QS}w0E'4aN(]2QiEmz[VQ!kd:< y?ig,oY" ]Oq*b V8E92ѢNs6S[ c|u{)lXKlKނ1"0DG* ͸=T#xfAٷqPN@Sm" gt_s(fC)#:;ZLIyГ(r ~7s^R؝nا??6ؖAzb˝qR5FE%V`d,+?T n7pk5YVX.f=]JldNăz\!iL  4x='%q>٧{Dέܴ4tSC~*P:'No)bS@Gt/gYLi|[,-qⵅ4?M"H1'vle FKz Xbaʆ`R$%IR˫ 3A9f6uu Aؑ0RX](;shx ז;Cj.JZɭ=kYPJ.W~Y`mk1:0#H) b'xP`H%C\4B >r-W#tDqp1cz荻 p/Ȝ@jHB?!+&;5,[~Jhiұ{zVO\<v #d30!]^JVYmm~E2gbυW'Jw6|; U(Teu49fNR9|A*>@]oo-_ρh_{Gh\fwO#5T&w&͎2GK0,޴қ}cuM&~.D 8Wc}pO ײLU-;>ٱu,(_EimA$~A RoOs.ޞd6;idt>Q8l>wߚZL}pՇ/?|K=KROCH1ѲB<ݢU-+ulsXB&'<DjiD+g;j _p 0}ٯWT|ܗz;3aG3孞4ԉF{"8ypW@[%* V(xCAi7?(LNx2Gـeǧ$b @K-$Yv䕳4b,uZ[o~ax H.uċSǷ-o^ =]IY)7XD vf:7ÖÖQ*egH 5'^f{!&`)NiMڍREpv1Q{^ᮀls%a!jGV9JT4ƭ]]#0mP2.bs"8nˏj! MUc\"Cw'=f.N%H0 aY'ATZ*Iv7XY-鈑b- ^X괺ʫӮ[e<4*nu 4rff) ]hKeeP$Wcj)"Z %$LMM(3Q@zһ>2R s]riD&cУU1U^!p˴1nϐ"f]чmkkN|9!q`VBLe闥-7lSw8_t![RR|;, =Em;OH?6t|QyHմ&Kto.?BռAp G^i(G3:|hK2W50F`88yQ /Ȯ\D"Vqzx #˒w7zC`G; mTOݴ@+{yjֹD4+E݁#g9"b1"{KgrEʸcD^+g@#IfRf#Pq2,D=d!4V8F΀Fv*OO!- d cxeZG[}(dIGej %3` 7Bhx%Bq`A%mwa!$TTCCFCZ&e$a8A>7&,c\EcE>&ķ|A'Pl@bwiO'']bn"@ ~__vf|քnЬ Mo-禲<]8? &Js.˄DBbD[ͥg )9uV[<'i ϼwNp5lK|ơhU¡z'YƸe(NJ2W 5y,:N@ǓQPHـ*hsa3#QB猷c36܎Dŋ}!z?ɠRc叾@0)tRMqK٪ayX#*ߒ1`xĻҁf[;IIpjĢM\Őe8ݒ/*6 ʼn.T݅ wX5:TGF#A~eRsӝk7% jll1ƤOӰz]~CuoץG,%V>$<^ؖ`B_ҿ%|`m`tun%LMB'b]'dܮ@r@k5'/b D&c;gAY:uHA@qVc"&S#.(fҡDj LUD!f:#7g K"4ghEFEz~"Ygn3G֙ xWee% a!GވP10F sd!S{a!JdBFB(o8X"p3HETagDv g=dvEeT!"%3yjUma"3'cgoϰvW;EoT'BjEJTrg:v^ "d3Wڹ#jkS Kdÿϋ޳ƾja2v>o.ߨNvԊ( pd4jtLl<QiM!oa QћjQ7@sGZbײF 6d'?a6'gs#b*Qb{o@Z} sdb%Qȉ@͵6Xa'`j(9}@oE6 '5\Q@asb,U\ odIaяhԞĻ0 dj t1y,A*ۣʛraC6o{߼3n fڭ^jO. dS\բnV e&k@ūaԓ9n}`Ks%;г#ۑk{? e9gq˺I$F`TlnހZ ` uMS(9=O^mOn|ݚkm6|´On^*(P9hr e(tn9€ ,hm|"0`Oj^RI O?e^mO|w Uk( 9Y^a`)Bnޔɶcۅ;k |eD '4!֍yn➑`6=ɿFeЧ~ն+ cDe[kXу [B eJzy2Qh Mk<-40 '[HN9WR7&?c&EMȪptiDq z=,ڱì>%UorvB b;xL·[04(1:lS_}gFMCn(27㎵.Ztܚ3@{YKk8!˄\|7͓aqxAHs>A ӂuD/~wgG(fM&d|PLz95ډ˱ yU`>z0JbY 3ԩmX}KA̤p@/J 6!9"Ge+^ĄvF0R)9?vB꙳ַ8 |(Ab qu{KAɯ|> dHΧ!}8wdSG43+'2L蟰n\}E{MZ2S4?g-TC{ZcK:[BvpBj@, +596]D]v"rF3K*?.EeY|1|ZLm 50mz9cֹ)zBJ 3dPu= $#6ё7Rr~KN7j%E^<.,hYXuAuS-N.&ä+ (8J΃a;MS[nX6]L^$w?9Qf/Jv=+ue^prsj$–w|Ͻ[=uXU-]^lFjH43 ~vs&Ru~'p s?gΓnyUɋ qC ʼlZԒH-.+?(WAJQm" ˚4zz+^"r«WcT;QRg)4֙\q?z0yhf|AJ)L6^ 8 C+a UM G,Yxu^! "eΜ'$DŽG/WꗟA m 2N4 Zy \Ua ıE!"'|$a~۩R' 9 cW~xT QR2ڜEj-Fz0+jyXs|3n<"mdWh%{kM%ˎP8}Co@7EkFv6vo.CR5i6­3 0у1K֤hDt '%OPY|@R:I5ȁ630pHmPdӽ=p\)VB>˵#K[wnT'[m<.hk>!fNjICt@r,EFmOco5: ُF%P_|7_9*:Bϕ?<My 1d hTD(߁{p6b1aiodfCg{]"5W#{ObL:I(J@3ڣӄbk Ob*cardǺ:g`w[.,8DOYyL1!IJp.]\F)ܖD9:?[<3ƍ`VHdO=}'}̷QmM)V0@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@ext2fs_clear_generic_bitmapext2fs_get_generic_bitmap_endext2fs_get_generic_bitmap_startext2fs_unmark_generic_bitmapext2fs_mark_generic_bitmapext2fs_test_generic_bitmap              f cLN φe- Ը'≣5,"φm`he)edφddd <ຣφ φφφE;Eᇭ!φ偪㿩➩፩豈更φc㢫p鹿論 ׫縷電oφ1TNLKφIFhCφ黔cԻφ φφ φφt]Ҡ!φN-丽丸φp/咢哶4 𡚨𡛪 𡍪嬈嬾],寳𡬘8弳尢jφ派海 𣽞𣾎(災灷煅𤉣熜䎫φ*bH5直𥃳磌䃣䄯穀 𥥼𥪧 𥪧窮φQ  𣍟䏕荓菊C2 𦾱𧃒[蚈蜎蜨蝫螆䵗WYTtOMφeMԸ' ߍ9qφidybaqaφ6ada  =φ ࡥφφφ䞶 !φ䃦B!豈更φ%鹿論㌨kZ縷電uφ1mF'෿φ媻䣺㔹ƸφlcW^φ mφ\φ! φ\φҠ!φ丽丸φ咢哶4zi 𡚨𡛪 𡍪嬈嬾寳𡬘弳尢jφI'派海 𣽞𣾎災灷煅𤉣熜䎫φ直𥃳-磌䃣I䄯穀 𥥼𥪧 𥪧窮_φn] 𣍟䏕{WF荓菊 𦾱𧃒蚈蜎蜨蝫螆䵗fcLNφe-*5∜.+φf_a^(^]φ]d] φ1GF2*EφC=@㟶ѵવφwcbiφ xφgφ, φgφҠ!φ丽丸φ咢哶4t 𡚨𡛪ߑ 𡍪嬈嬾寳𡬘弳尢jφT2!派海 𣽞𣾎災灷煅𤉣熜䎫φ直𥃳8&磌䃣T䄯穀 𥥼𥪧 𥪧窮jφyh 𣍟䏕bQ荓菊 𦾱𧃒蚈蜎蜨蝫螆䵗WSN4I`GφeDG*˙ជjφWc^8\k[0[φZdZ @φ1uφ9φ庲cφ φφo φφE.Ҡ!φa丽丸φA咢哶4 𡚨𡛪ܑ 𡍪嬈嬾.寳𡬘 弳尢jφ^ud派海 𣽞𣾎災灷煅𤉣熜䎫φ3直𥃳{i磌䃣䄯穀 𥥼𥪧 𥪧窮φ" 𣍟䏕荓菊 𦾱𧃒,蚈蜎蜨蝫螆䵗װV^. abc defg hijk lmno0 pqrs tuvw xyzo 9"$φUcCR μφD? àáâãäåæç èéêëìíîï;ðñòóôõöøùúûüýþssφԀ@ āāăăąąćć ĉĉċċččďď; đēēĕĕėė ęęěěĝĝğğ{; ġġģģĥĥħ ĩĩīīĭĭįį7 i̇ijĵĵķķ ĺĺļļľľŀφr7 łńńņņňňʼnŋōōŏŏ;őőœŕŕŗŗ řřśśŝŝşş{; ššţţťťŧ ũũūūŭŭůů@ űűųųŵŵŷŷ ÿźźżżžžseφմZ/ ɓƃ ƅɔƈ ɖɗƌQǝə2ɛƒɠ ɣɩɨ ƙɯɲɵ]4ơơƣ ƥʀƨ ʃ ƭʈư3ưʊʋƴ ƶʒ ƹ ƽφDRQdžlj ljnj ǎǎǐF ǐǒǒǔǔǖ ǖǘ( ǘǚ ǚǜ ǜ ǟǟԇA& ǡǡ ǣǣ ǥǧǧ ǩǩǫǫ ǭǭ ǯǯ8ǰdzdzǵǵƕƿ$ǹǹ ǻǻ ǽǽ ǿǿ1DφԀ@ ȁȁȃȃȅȅȇȇ ȉȉȋȋȍȍȏȏ@ ȑȑȓȓȕȕȗȗ șșțț ȝȟȟy1 ƞȣ ȥȧȧ$ȩȩ ȫȫ ȭȭȯȯ'!C ȱȱȳȳQⱥȼ ƚⱦφ_[/ ɂ ƀ ʉ ʌ ɇ   ɉ  ɋ  ɍ  ɏ ы φCdBφ*CC^C̀́eC ̈́ι aC,  ͱ  ͳ ʹ ͷ aCQ ;ϳ1φ_!R ΅ ά· έή ί  ό ύώ<  ΐαβγδεζηθικλμνξοC5πρστυφχ+Cψω ϊϋφՔ<Qσa:C όύ ώ ϗ,FCβθ ϔφπ ϙϛ ϝϟX, ϡϣ ϥϧ ϩϫ ϭϯ+κρθεϸ ϲϻ ͻͼͽF='fφ~@" ѐёђѓєѕіїјљњћ ќѝ ўџ8абвгдежзийклмноп%B8рстуфхцчшщъыьэюяφdAX, ѡѣ ѥѧ ѩѫ ѭѯ3 ѱѳ ѵ ѷѷ ѹѻ ѽѿAφՎ6AAҁQҋ ҍҏ, ґғ ҕҗ ҙқ ҝҟX, ҡң ҥҧ ҩҫ ҭү, ұҳ ҵҷ ҹһ ҽҿφZ6 ӏӂ ӂӄ ӆӈ ӊӌi@ӎA$ ӑӑ ӓӓ ӕ ӗӗ ә ӛӛ ӝӝ ӟӟԂA ӡ ӣӣ ӥӥ ӧӧ ө ӫӫ ӭӭ ӯӯA$ ӱӱ ӳӳ ӵӵӷ ӹӹ ӻ  ӽ  ӿ &xφհX, ԁԃ ԅԇ ԉԋ ԍԏ,  ԑ  ԓ  ԕ  ԗ   ԙ  ԛ  ԝ  ԟ X,  ԡ  ԣ  ԥ  ԧ  ԩԫ ԭԯ5 աբգդեզէըթժիլխծկφ?p8հձղճմյնշոչպջռսվտ>րցւփքօֆ/?φ>>v>RQեւ>%{φKSFCCBφBdB φVvS RφeR φ ScR Ԁ@ ⴀⴁⴂⴃⴄⴅⴆⴇ ⴈⴉⴊⴋⴌⴍⴎⴏ@ ⴐⴑⴒⴓⴔⴕⴖⴗ ⴘⴙⴚⴛⴜⴝⴞⴟφBRP< ⴠⴡⴢⴣⴤⴥ ⴧR  ⴭRRφ bRSφ ScS φd"TφUTb/T ᏰᏱᏲᏳᏴᏵVVUUφ UcU+Z LYφe%Y YφE1вдосQтъѣ ꙋ@ აბგდევზთ იკლმნოპჟԀ@ რსტუფქღყ შჩცძწჭხჯ@ ჰჱჲჳჴჵჶჷჸჹჺ ჽჾჿHφԄ@ ḁḁḃḃḅḅḇḇ$ ḉḉḋḋḍḍḏḏH ḑḑḓḓ ḕḕ ḗḗ ḙḙḛḛ ḝḝḟḟԄ@ ḡḡḣḣḥḥḧḧ ḩḩḫḫḭḭ ḯḯ@ ḱḱḳḳḵḵḷḷ$ ḹḹḻḻḽḽḿḿφԈ@ ṁṁṃṃṅṅṇṇ ṉṉṋṋ ṍṍ ṏṏH( ṑṑ ṓṓṕṕṗṗ ṙṙṛṛ ṝṝṟṟԌH ṡṡṣṣ ṥṥ ṧṧ$ ṩṩṫṫṭṭṯṯ@ ṱṱṳṳṵṵṷṷ( ṹṹ ṻṻṽṽṿṿφԀ@ ẁẁẃẃẅẅẇẇ ẉẉẋẋẍẍẏẏ3 ẑẑẓẓYẕẕ ẘẙaʾṡQ  ss ԘH ạạảả ấấ ầầ( ẩẩ ẫẫ ậậ ắắP( ằằ ẳẳ ẵẵ ặặ ẹẹẻẻẽẽ ếếφ1ԐP( ềề ểể ễễ ệệ ỉỉịịọọỏỏP( ốố ồồ ổổ ỗỗ( ộộ ớớ ờờ ởởԘH( ỡỡ ợợụụủủ( ứứ ừừ ửử ữữD$ ựựỳỳỵỵỷỷỹỹ ỻ  ỽ  ỿ φlYX ἀἁ( ἀἁ ἂἃ ἄἅ ἆἇJY3Y ἐἑ( ἐἑ ἒἓ ἔἕltY]Y ἠἡ( ἠἡ ἢἣ ἤἥ ἦἧYY ἰἱ( ἰἱ ἲἳ ἴἵ ἶἷφլZYY ὀὁ( ὀὁ ὂὃ ὄὅZZ ὐὑ ὑὓὕὗZRZ;Z ὠὡ( ὠὡ ὢὣ ὤὥ ὦὧφd0 ἀιἁι ἂιἃι ἄιἅι ἆιἇι0 ἀιἁι ἂιἃι ἄιἅι ἆιἇιd0 ἠιἡι ἢιἣι ἤιἥι ἦιἧι0 ἠιἡι ἢιἣι ἤιἥι ἦιἧιd0 ὠιὡι ὢιὣι ὤιὥι ὦιὧι0 ὠιὡι ὢιὣι ὤιὥι ὦιὧιI& ᾰᾱ ὰιαι άι ᾶᾶι$ ᾰᾱ ὰάZ αιφս~D! ῁ ὴιηι ήι ῆῆι$ ὲέ ὴή[ ηι῍([[ ῐῑL[ ῐῑ ὶίQo[X[ ῠῡ$ ῠῡ ὺύ[ ῥ῭;Q ὼιωι ώι ῶῶι$ ὸό ὼώ[ ωι´ hφ#%^*_\[φ[[  FφU)RQωQkå%]Qⅎφ B]c-]@ ⅰⅱⅲⅳⅴⅵⅶⅷ ⅸⅹⅺⅻⅼⅽⅾⅿ4]φ]\\\Qↄ#a` `φe~`bφUTRQⓐⓑ ⓒⓓⓔⓕⓖⓗⓘⓙφW`@ ⓚⓛⓜⓝⓞⓟⓠⓡ ⓢⓣⓤⓥⓦⓧⓨⓩ 3b,b ec.φԀ@ ⰰⰱⰲⰳⰴⰵⰶⰷ ⰸⰹⰺⰻⰼⰽⰾⰿ@ ⱀⱁⱂⱃⱄⱅⱆⱇ ⱈⱉⱊⱋⱌⱍⱎⱏ|@ ⱐⱑⱒⱓⱔⱕⱖⱗ ⱘⱙⱚⱛⱜⱝⱞφdac2  ⱡ  ɫ ᵽ  ɽ  ⱨ  ⱪ ⱬ  ɑ ɱ ɐ'  ɒ  ⱳ  ⱶ R Q  ȿ ɀφ`0 ⲁⲃ ⲅⲇ ⲉⲋ ⲍⲏ0 ⲑⲓ ⲕⲗ ⲙⲛ ⲝⲟ`0 ⲡⲣ ⲥⲧ ⲩⲫ ⲭⲯ0 ⲱⲳ ⲵⲷ ⲹⲻ ⲽⲿφ`0 ⳁⳃ ⳅⳇ ⳉⳋ ⳍⳏ0 ⳑⳓ ⳕⳗ ⳙⳛ ⳝⳟ; ⳡⳣQ ⳬ;_ ⳮ@_Q  ⳳ  gφelφ gg& φeg φ`0  ꙁ  ꙃ  ꙅ  ꙇ   ꙉ  ꙋ  ꙍ  ꙏ 0  ꙑ  ꙓ  ꙕ  ꙗ   ꙙ  ꙛ  ꙝ  ꙟ ]g0  ꙡ  ꙣ  ꙥ  ꙧ   ꙩ  ꙫ g ꙭ 5gφ`0  ꚁ  ꚃ  ꚅ  ꚇ   ꚉ  ꚋ  ꚍ  ꚏ 0  ꚑ  ꚓ  ꚕ  ꚗ f ꚙꚛ йφdfX(Q  ꜣ  ꜥ  ꜧ   ꜩ  ꜫ  ꜭ  ꜯ (Q  ꜳ  ꜵ  ꜷ   ꜹ  ꜻ  ꜽ  ꜿ φ`0  ꝁ  ꝃ  ꝅ  ꝇ   ꝉ  ꝋ  ꝍ  ꝏ 0  ꝑ  ꝓ  ꝕ  ꝗ   ꝙ  ꝛ  ꝝ  ꝟ `0  ꝡ  ꝣ  ꝥ  ꝧ   ꝩ  ꝫ  ꝭ  ꝯ S   ꝺ ꝼ  ᵹ ꝿ qφզN0  ꞁ  ꞃ  ꞅ  ꞇ Q  ꞌd ɥ(  ꞑ  ꞓ Qꞗ ꞙꞛ ꞝꞟc0  ꞡ  ꞣ  ꞥ  ꞧ   ꞩ  ɦɜɡɬɪ5ʞʇʝꭓ ꞵꞷ ꞹꞻ ꞽꞿφc/+Qꟃꞔʂᶎf[d dcφc bcZe'eφe e ѫφfeee φU b'f@ ᎠᎡᎢᎣᎤᎥᎦᎧ ᎨᎩᎪᎫᎬᎭᎮᎯeφԀ@ ᎰᎱᎲᎳᎴᎵᎶᎷ ᎸᎹᎺᎻᎼᎽᎾᎿ@ ᏀᏁᏂᏃᏄᏅᏆᏇ ᏈᏉᏊᏋᏌᏍᏎᏏԀ@ ᏐᏑᏒᏓᏔᏕᏖᏗ ᏘᏙᏚᏛᏜᏝᏞᏟ@ ᏠᏡᏢᏣᏤᏥᏦᏧ ᏨᏩᏪᏫᏬᏭᏮᏯ cφφφԮ Td'p&nφ?mllxlgl切度ttsφ"s;7fffiflffifflststrQմն մեմի վնմխ @t0utφtdtucuφ |< ａｂｃｄｅｆｇ ｈｉｊｋｌｍｎｏ@ ｐｑｒｓｔｕｖｗｘｙｚ⇳`ݮφ偛b φvuuuφWucBu+xwwwφ!ԐH$ 𐐨𐐩 𐐪𐐫 𐐬𐐭 𐐮𐐯$ 𐐰𐐱 𐐲𐐳 𐐴𐐵 𐐶𐐷H$ 𐐸𐐹 𐐺𐐻 𐐼𐐽 𐐾𐐿$ 𐑀𐑁 𐑂𐑃 𐑄𐑅 𐑆𐑇LH$ 𐑈𐑉 𐑊𐑋 𐑌𐑍 𐑎𐑏Рφd0vc=vH$ 𐓘𐓙 𐓚𐓛 𐓜𐓝 𐓞𐓟$ 𐓠𐓡 𐓢𐓣 𐓤𐓥 𐓦𐓧φuԐH$ 𐓨𐓩 𐓪𐓫 𐓬𐓭 𐓮𐓯$ 𐓰𐓱 𐓲𐓳 𐓴𐓵 𐓶𐓷($ 𐓸𐓹 𐓺𐓻vjv vuφu ubuxx Lx xφ!ԐH$ 𐳀𐳁 𐳂𐳃 𐳄𐳅 𐳆𐳇$ 𐳈𐳉 𐳊𐳋 𐳌𐳍 𐳎𐳏H$ 𐳐𐳑 𐳒𐳓 𐳔𐳕 𐳖𐳗$ 𐳘𐳙 𐳚𐳛 𐳜𐳝 𐳞𐳟ԐH$ 𐳠𐳡 𐳢𐳣 𐳤𐳥 𐳦𐳧$ 𐳨𐳩 𐳪𐳫 𐳬𐳭 𐳮𐳯# 𐳰𐳱 𐳲φ{yxww ~D~} }φe}}φUԐH$ 𑣀𑣁 𑣂𑣃 𑣄𑣅 𑣆𑣇$ 𑣈𑣉 𑣊𑣋 𑣌𑣍 𑣎𑣏H$ 𑣐𑣑 𑣒𑣓 𑣔𑣕 𑣖𑣗$ 𑣘𑣙 𑣚𑣛 𑣜𑣝 𑣞𑣟φ Ҁۂφ  ;φ!ԐH$ 𖹠𖹡 𖹢𖹣 𖹤𖹥 𖹦𖹧$ 𖹨𖹩 𖹪𖹫 𖹬𖹭 𖹮𖹯H$ 𖹰𖹱 𖹲𖹳 𖹴𖹵 𖹶𖹷$ 𖹸𖹹 𖹺𖹻 𖹼𖹽 𖹾𖹿%φ݁䚁 Qφφ"Ј㓈81*φ⇓bч6/ Ḉφ!ԐH$ 𞤢𞤣 𞤤𞤥 𞤦𞤧 𞤨𞤩$ 𞤪𞤫 𞤬𞤭 𞤮𞤯 𞤰𞤱H$ 𞤲𞤳 𞤴𞤵 𞤶𞤷 𞤸𞤹$ 𞤺𞤻 𞤼𞤽 𞤾𞤿 𞥀𞥁 𞥂𞥃WA zφUSR φ|< ÀÁÂÃÄÅÇ ÈÉÊËÌÍÎÏ8 ÑÒÓÔÕÖ ÙÚÛÜÝ|< àáâãäåç èéêëìíîï8 ñòóôõö ùúûüýÿφԀ@ ĀāĂ㥹Ćć ĈĉĊċČčĎď4QĒēĔĕĖė ĘęĚěĜĝĞğt4 ĠġĢģĤĥ ĨĩĪīĬĭĮį0 İĴĵĶķ ĹĺĻļĽľφ`0QŃńŅņŇ ňŌōŎŏ4ŐőŔŕŖŗ ŘřŚśŜŝŞşt4 ŠšŢţŤť ŨũŪūŬŭŮů@ ŰűŲųŴŵŶŷ ŸŹźŻżŽžJφU,ƠơRQƯ ưφմ$SR ǍǎǏF ǐǑǒǓǔǕ ǖǗ( ǘǙ ǚǛ ǜ ǞǟԀ:& Ǡǡ ǢǣQǦǧ ǨǩǪǫ Ǭǭ Ǯǯ$ ǰǴǵ$Ǹǹ Ǻǻ Ǽǽ ǾǿφԀ@ ȀȁȂȃȄȅȆȇ ȈȉȊȋȌȍȎȏ@ ȐȑȒȓȔȕȖȗ ȘșȚțQȞȟh QȦȧ$Ȩȩ Ȫȫ ȬȭȮȯ0$ ȰȱȲȳQφ  "φUS φTSRQSQ5rφ$TRܒ Q,Qʒ  ܑφG.̀́̓  ̈́ QQ QR ʹ Q Q ;φz_!R ΅ Ά· ΈΉ Ί  Ό ΎΏ ΐJ QQ ΪΫ άέ ήί ΰφ{9SQ ϊϋ όύ ώ &Qϓ  ϔ Q RQGЋφlS0 ЀЁЃQЇR ЌЍ ЎS ЙTS йφWT0 ѐёѓQїR ќѝ ўTRQ Ѷѷ.φ($ QQ φվJ* Ӂ ӂ :$ Ӑӑ ӒӓQ ӖӗQ Ӛӛ Ӝӝ Ӟӟt:Q Ӣӣ Ӥӥ ӦӧQ Ӫӫ Ӭӭ Ӯӯ:$ Ӱӱ Ӳӳ Ӵӵ Ӹӹ t6φT  R   φ$TRQ  кφL$S  Q Q, Q Q      φ($ S QQR+ШφU(R  Q   R     =9  آأ ؤإ ئS Q φ\ S Q  !"  SR #"φUTSQφ[.  ۀ ۂRQQۓR8 QSQvφ(SRQ $SR  Qφ<8 QSR φUT φU S Q   Q  Q  WE?>,!φaєZφ T R  Q  $R    S R Q  φ T S  Q S QJφU    R   QRφT Q0 QQ        Q    Q  :wφ   Sऩ&ऱ ऴ φՌSR   , क़ख़ ग़ज़ ड़ढ़ फ़य़T      ІφD, RS φ{BRো ৌ RQR ড়ঢ়য় RS Q QHOФφL4 QQS .ਲ਼ ਸ਼φՀ4 QQ   %ਖ਼ ਗ਼ਜ਼ ਫ਼ RR Ђφ@, R QS  φ<(RQ Q      $ІφD, RS  φsER  ୈୋ ୌ RR ଡ଼ଢ଼   бφc( Q  ஔ, Q QRQφaE Q ொோ ௌ   QRQ Q Qvφ<( R S R φS/R ై RT[ Q  RQ vφ<( R S RφՂ^* ೀೇ( ೈ ೊೋ RRQ   nφ<( R S  S Q   φeER  ൊോ ൌ  RQRQ  R    Zφ4RQT QRφw(RQ Q QRQ ේ ොෝ ෞ R1X:φ TS Qg Qφ SkSОφT<  0 S Qv φ4 RRzS +>φTSTRܒ φs6Qགྷ ཌྷ&Q དྷQབྷR ཛྷ'Sཀྵ  5ཱཱིུ ྲྀ ླྀφe'ཱྀ  QྒྷQ ྜྷ=&Q ྡྷQྦྷR ྫྷ ྐྵφL$RQR     φy{eφU3 Q Q ဦ   Q Q   φTS .φ(S R  S   φ$ RQ R TRQ >φTS Q   φU Q φUTS !lφRQφH$RQ RQ bφ($RQ SRQ RQφ8$ RQRQSRQќ>φ8SRQ RQφ4RQS Q   SRφTSφUTRR0*$φ  l$φUTRQ φTSRφUT  рFφ(SRR TR φTSR φUT Rφ$T Q RSSXҏS5φ/S QQSφUTS "φUS φU T R  рBφTSR SSφ SRRφUS φ(SS Q р.φ(TRQ  φT S R Q    R  R   ^φ S  S  S R  R QЪφnSR Q  ᬆ  ᬈ  ᬊ  ᬌ  ᬎ Q  ᬒ T R   Q  ᬻ ᬽ φ=91% ᭀ ᭁ ᭃ  S Q    R  .φU S Q   S  φU R Q      L*φU T R Q   Q φS   :φS TS Qφ,  Q    ܒ (        Q     QφU Sφ@, Q Q    ܓ  R Q  RQ  HφԄ@ ḀḁḂḃḄḅḆḇ$ ḈḉḊḋḌḍḎḏH ḐḑḒḓ Ḕḕ Ḗḗ ḘḙḚḛ ḜḝḞḟԄ@ ḠḡḢḣḤḥḦḧ ḨḩḪḫḬḭ Ḯḯ@ ḰḱḲḳḴḵḶḷ$ ḸḹḺḻḼḽḾḿφԈ@ ṀṁṂṃṄṅṆṇ ṈṉṊṋ Ṍṍ ṎṏH( Ṑṑ ṒṓṔṕṖṗ ṘṙṚṛ ṜṝṞṟԌH ṠṡṢṣ Ṥṥ Ṧṧ$ ṨṩṪṫṬṭṮṯ@ ṰṱṲṳṴṵṶṷ( Ṹṹ ṺṻṼṽṾṿφԀ@ ẀẁẂẃẄẅẆẇ ẈẉẊẋẌẍẎẏ@ ẐẑẒẓẔẕẖẗẘẙẛ ԘH ẠạẢả Ấấ Ầầ( Ẩẩ Ẫẫ Ậậ ẮắP( Ằằ Ẳẳ Ẵẵ Ặặ ẸẹẺẻẼẽ Ếếφ1ԐP( Ềề Ểể Ễễ Ệệ ỈỉỊịỌọỎỏP( Ốố Ồồ Ổổ Ỗỗ( Ộộ Ớớ Ờờ ỞởԘH( Ỡỡ ỢợỤụỦủ( Ứứ Ừừ Ửử ỮữD$ ỰựỲỳỴỵỶỷỸỹ φ-ԨT( ἀἁ ἂἃ ἄἅ ἆἇ( ἈἉ ἊἋ ἌἍ ἎἏB( ἐἑ ἒἓ ἔἕ( ἘἙ ἚἛ ἜἝԨT( ἠἡ ἢἣ ἤἥ ἦἧ( ἨἩ ἪἫ ἬἭ ἮἯT( ἰἱ ἲἳ ἴἵ ἶἷ( ἸἹ ἺἻ ἼἽ ἾἿφԄB( ὀὁ ὂὃ ὄὅ( ὈὉ ὊὋ ὌὍT( ὐὑ ὒὓ ὔὕ ὖὗ ὙὛὝὟԨT( ὠὡ ὢὣ ὤὥ ὦὧ( ὨὩ ὪὫ ὬὭ ὮὯH$ ὰά ὲέ ὴή ὶί$ ὸό ὺύ ὼώφd0 ᾀᾁ ᾂᾃ ᾄᾅ ᾆᾇ0 ᾈᾉ ᾊᾋ ᾌᾍ ᾎᾏd0 ᾐᾑ ᾒᾓ ᾔᾕ ᾖᾗ0 ᾘᾙ ᾚᾛ ᾜᾝ ᾞᾟd0 ᾠᾡ ᾢᾣ ᾤᾥ ᾦᾧ0 ᾨᾩ ᾪᾫ ᾬᾭ ᾮᾯI& ᾰᾱ ᾲᾳ ᾴ ᾶᾷ$ ᾸᾹ ᾺΆ  ᾼιφԏD! ῁ ῂῃ ῄ ῆῇ$ ῈΈ ῊΉ ῌ῍ ῎῏@( ῐῑ ῒΐQ ῖῗ$ ῘῙ ῚΊ῝ ῞῟ԓN( ῠῡ ῢΰ ῤῥ ῦῧ$ ῨῩ ῪΎ Ῥ῭ ΅`;Q ῲῳ ῴ ῶῷ$ ῸΌ ῺΏ ῼ´~ φOφ.*   QS QφHRQR QRQ#R    ~φ4SRQR R  S Q  Qφ(T  Q0  ܓ  сOφU)RQΩQKÅSφ,SR   Q  hφH( Q  SQ ↚↛SRQ ↮φ.*SR⇍ ⇎⇏S Q8?hφ>:R ∄∉ ∌$ R ∤ ∦φHD.≁ ≄≇≉@ ≠ ≢R≭≮≯0 ≰≱ ≴≵ ≸≹ІφPL0 ⊀⊁ ⊄⊅ ⊈⊉0SR ⊬⊭ ⊮⊯φU\,( ⋠⋡ ⋢⋣Q ⋪⋫ ⋬⋭ d>φ  S 〈〉φUTS QφTS Qφ,SRQ  S    QQӦt@"φURφS QφUS QSRQφT RφUTH&φ T R φUT R^φ,S R   Q R  φ R Q   Q  ѨBφ($   S  φ@SR   Q Q  RQ    R>φTR T  RQ φ,(RQ Q    S 9 0φTSR ⫝̸р:φ(SR Q   φ0S R  R   T R2φT RTSφ(S  Q SSRQҬhφUSRQφTSRQS R    R  φUS Q Q   l*φU RQ R φU R RQ  RQ ZφTRQ RQRQRQRQφ@ RQRQRQRQ Ҝh2φTSR  T    φ0, QQφTS QφUTφT RTSφ>φUS QS QQφժ2 R が ぎ< ぐ げ ご ざ じ ず ぜ ぞS< だ ぢづでどJ% ばぱび ぴ ぶぷべ ぺ ぼぽφBTR ゔQ ゞ2 R ガ ギ< グ ゲ ゴ ザ ジ ズ ゼ ゾφS< ダ ヂヅデドJ% バパビ ピ ブプベ ペ ボポT"R ヴヷ% ヸヹ ヺQ ヾeFφRSR  φUR 2φSRQTS Q  φ  Ҥ\"φTSRφ   TSRQφUT φ STSRQ0φUTRQ QφTSRTSRQH@φ,φUT Rφφqьφφ"φU RS φ( R   RS Qφtn>φSR Rφ$    ҄LφU S  φU   R Q   R  φT S RQ φU T  @:φ$TRQ Q     ^φ(S R     S Q  Q φQTRQ Q  eҘH6φRQ  SS  φU T   φ,R  R S  T  R `"φU S Q   φ$T  Q  RQ T S R  φU T  Q   φ4   R Q  S   TSRQPφU T R Q  φ S R  S  T S  :φU T       φ,  S Q T R Q  ьrφL0  Q   Q    Q  R Q  R Q  φU RφU S R  S  φv φφφU  φ$ R Q  Q T S  φφφԀ@ 豈更車賈滑串句龜 龜契金喇奈懶癩羅@ 蘿螺裸邏樂洛烙珞 落酪駱亂卵欄爛蘭Ԁ@ 鸞嵐濫藍襤拉臘蠟 廊朗浪狼郎來冷勞@ 擄櫓爐盧老蘆虜路 露魯鷺碌祿綠菉錄φԀ@ 鹿論壟弄籠聾牢磊 賂雷壘屢樓淚漏累@ 縷陋勒肋凜凌稜綾 菱陵讀拏樂諾丹寧Ԁ@ 怒率異北磻便復不 泌數索參塞省葉說@ 殺辰沈拾若掠略亮 兩凉梁糧良諒量勵φԀ@ 呂女廬旅濾礪閭驪 麗黎力曆歷轢年憐@ 戀撚漣煉璉秊練聯 輦蓮連鍊列劣咽烈Ԁ@ 裂說廉念捻殮簾獵 令囹寧嶺怜玲瑩羚@ 聆鈴零靈領例禮醴 隸惡了僚寮尿料樂φԀ@ 燎療蓼遼龍暈阮劉 杻柳流溜琉留硫紐@ 類六戮陸倫崙淪輪 律慄栗率隆利吏履Ԁ@ 易李梨泥理痢罹裏 裡里離匿溺吝燐璘@ 藺隣鱗麟林淋臨立 笠粒狀炙識什茶刺φt@ 切度拓糖宅洞暴輻 行降見廓兀嗀4 塚晴 凞猪益 礼神祥福靖精羽d0 蘒諸 逸都Q飯飼館鶴 郞 隷@ 侮僧免勉勤卑喝嘆 器塀墨層屮悔慨憎φԀ@ 懲敏既暑梅海渚漢 煮爫琢碑社祉祈祐@ 祖祝禍禎穀突節練 縉繁署者臭艹艹著u@ 褐視謁謹賓贈辶逸 難響頻 恵 𤋮 舘@ 並况全侀充冀勇勺 喝啕喙嗢塚墳奄奔φԀ@ 婢嬨廒廙彩徭惘慎 愈憎慠懲戴揄搜摒@ 敖晴朗望杖歹殺流 滛滋漢瀞煮瞧爵犯Ԁ@ 猪瑱甆画瘝瘟益盛 直睊着磌窱節类絛@ 練缾者荒華蝹襁覆 視調諸請謁諾諭謹φԁ@ 變贈輸遲醙鉶陼難 靖韛響頋頻鬒龜𢡊E" 𢡄𣏕㮝䀘䀹𥉉 𥳐𧻓齃龎φBRQ QR יִײַBSQ שׁשׂ שּׁשּׂ אַאָC$ אּבּ גּדּ הּוּ זּ$ טּיּ ךּכּ  לּ מּφ> נּסּףּ  פּ צּקּ$ רּשּ תּוֹ בֿכֿ פֿφUT  φ$   QZφφT φ TSRѥ7φTSRQ  Rφ8$R  QRQ QφUTSRPφ φTSRQ /φU SRQφ8   RQRQS F>;9φ@&`φSL=ҔpJφSRRQS QQφ SRSRφUTS Q@:φ  QQTRQFφ, S QS   φ T S R  ^φT S R  φT    Sp6φTSRQRφS QT R QφTSRQφ  RӺҀ4φU RφSR*φTSRSφTTS4φUφURQ@φUTRQφT REpRφ  R TRQ φT R Q  2φTSRQRQφUT Q Q@:φT S  Q T S  Q φU T S R φT ѤvφH(RRR T RQ φ(S S  φφU$R QRQT&φU T R   φT R  T  Q  Bφ(T  S Ӗh$ φS  φUT QφUT Q("φU S*$φUT S R Q  XφUφ@$ R Qܑ φUTRQφL φ,R Q  R   T SRQ iφ2T S Q  𑂚  𑂜 S Q  𑂫 S    φ   R S  S  і\φ Q  &S R Q  𑄮 𑄯 Q   φR QT QQ φ@,   S Q  RHBφT QTR RQRφ<(RQ QSRQSφUS S'ЊφD, RS   QφjBR𑍋 𑍌  QR RRR0ҷHφ< Q QS QEφUTSQ𑒻 𑒼 𑒾φ$ Q S@φUT RQ 𑖺𑖻Q φ, SRҠ\φUTSRQ φ$RSSR*φU T R Q   φS  @:φ TS QS Q YӲ\("φUTS  φφUT QRQφUSφTS  Ҡ<φUTR φRQ Fφ, RS   QφUTS Ұl>φS TRQRQ φ RSR>φT S RQѠRφ$ RQ QTRQ QQφ( Q S RQ Rφ<SRQ QQ S*φUTS φUT RQφT  $ φU S R Q  φTS hF@ φU  Q  RQR φ φL @:4.φU S R Q  S LDφ<*$φRQφφ  ҄PφU T S  φTSRQSφSRRlφUTRQφ$ RS Q QSRφ0 φTS QL φ,(R   QQ T S R Q  φSRQ φU φюІφHφUSR 6*φUT QφφφբԜt& φ  HφTSRQφT Q "φUTSy4φUS QSR?φ,S SQ φφ3&φUT R*φU RQ  φ*TSRQ 𝅗𝅥𝅘𝅥uaD"𝅘𝅥𝅮𝅘𝅥𝅯𝅘𝅥𝅰𝅘𝅥𝅱𝅘𝅥𝅲 QQЗφ($ QSSQ𝆹𝅥 𝆺𝅥𝆹𝅥𝅮𝆺𝅥𝅮𝆹𝅥𝅯φ1!𝆺𝅥𝅯SRS D(φφUT@φTRQT   _Ҵ$φTRjφTSR4 Q S Qφ  ѤjφH(RQ QRRTS QQφ4 R &φU RφS RF:φ SS Q φf`Zφ,RQS( Q QT6φUSRRQRφS6φU SSQԂ|>φ,RRQ8φ, QSӂH$φUT φUTR4.φ TSRAnφR  0       Q    φt4 Q Q            0     Q   Q     Vφ S Q  S  (   Q  S  φUT  φ(ҠφU S   FφT  S R Q    R Q  φ(    T RZφ S Q   S R Q    R   φL, Q  Q   Q  R Q  R Q  S  S     Nφ4S     Q  SRφU R ~x>φ  T  Q  φ$S    RX:φU   RR Q  φU T S R  φT   φ4(R   Q  QT   l<φU T S R Q  φ    φU T S   TφU T S R  φ  Q  S QφURφUTS Q Ѩ~φL        Q   R  R  R  φ$    φ0 R  SRRQ φU T  φ$TR  S@\4φ SφS"φ SR^φ0SRS QRQφ(SRSRQ SQ Qbφ$R , Q QSφ0, QRQp@φTSR Q*φ$ Q RφUTSRφφDφ<*φTRQ  φ<   $φU T R    2,& φT S R  H@φ&φU φDφ6φU φhQφԂA!丽丸乁𠄢你侮侻倂 偺備僧像㒞𠘺免兔B!兤具 𠔜㒹內再 𠕋冗 冤仌冬况 𩇟凵刃㓟Ԁ@ 刻剆割剷㔕勇勉勤 勺包匆北卉卑博即9卽卿卿 𠨬灰及叟! 𠭣叫叱吆咞吸呈周φԀ@ 咢哶唐啓啣善善喙 喫喳嗂圖嘆圗噑噴@ 切壮城埴堍型堲報!墬𡓤売壷夆多夢奢{B" 𡚨𡛪姬娛娧姘婦㛮㛼嬈嬾 𡧈寃寘寧A!寳𡬘寿将当尢㞁屠!屮峀岍𡷤嵃𡷦嵮嵫φԂ@ 嵼巡巢㠯巽帨帽幩!㡢𢆃㡼庰庳庶廊𪎒;"廾𢌱 𢌱舁Q弢㣇𣊸! 𦇚形彫㣣徚忍志忹ԁA 悁㤺㤜悔 𢛔惇慈慌 慎慌慺憎憲憤憯懞@ 懲懶成戛扝抱拔捐! 𢬌挽拼捨掃揤 𢯱搢φԁ@ 揅掩㨮摩摾撝摷㩬!敏敬 𣀊旣書晉㬙暑@ 㬈㫤冒冕最暜肭䏙 朗望朡杞杓𣏃㭉柺ԂA!枅桒梅𣑭梎栟椔㮝 楂榣槪檨 𣚣櫛㰘次B! 𣢧歔㱎歲殟殺殻𣪍# 𡴋𣫺汎𣲼沿泍汧洖 φԂA 派海流浩浸涅 𣴞洴 港湮㴳滋滇𣻑淹潮B" 𣽞𣾎濆瀹瀞瀛㶖灊!災灷炭𠔥煅𤉣熜𤎫{C!爨爵牐𤘈犀犕 𤜵𤠔 獺王㺬玥Q㺸瑇瑜B 瑱璅瓊㼛甤𤰶甾𤲒"異𢆟瘐𤾡 𤾸𥁄㿼䀈φ}<#直𥃳 𥃲𥄙 𥄳眞真 睊䀹瞋䁆䂖𥐝硎碌C!磌䃣 𥘦祖 𥚚𥛅福秫 䄯穀穊穏 𥥼𥪧 𥪧竮ԃB!䈂𥮫篆築䈧𥲀糒䊠!糨糣紀𥾆絣䌁緇縂D"繅䌴 𦈨𦉇䍙𦋙罺𦌾!羕翺者𦓚 𦔣聠 𦖨聰φԅB! 𣍟䏕育脃䐋脾媵𦞧# 𦞵𣎓 𣎜舁舄辞䑫芑A 芋芝劳花芳芽苦𦬼 若茝荣莭茣莽菧著ԅC 荓菊菌菜 𦰶𦵫 𦳕䔫!蓱蓳蔖𧏊蕤𦼬䕝䕡B" 𦾱𧃒䕫虐虜虧虩蚩 蚈蜎蛢蝹蜨蝫螆䗗φԃA 蟡蠁䗹衠衣𧙧裗裞!䘵裺㒻𧢮 𧥦䚾䛇誠A!諭變豕𧲨貫賁贛起" 𧼯𠠄跋趼跰𠣞軔輸ԄC" 𨗒𨗭邔郱鄑𨜮鄛鈸 鋗鋘鉼鏹鐕𨯺開䦕C!閷𨵷䧦雃嶲霣 𩅅𩈚!䩮䩶韠𩐊䪲𩒖頋 φԂA!頩𩖶飢䬳餩馧駂駾!䯎𩬰鬒鱀鳽䳎䳭鵧D# 𪃎䳸 𪄅𪈎 𪊑麻䵖黹 黾鼅鼏鼖鼻𪘀φUTSRφφφφφφUTSRφ`φφφφφφUTSRφφφφφφUTSR`φφφφφφUTSRφφφφφφUTSRφ`φφφφφφUTSRφφφφφφUTSR`φφφφφφUTSRφφφφφφUTSRφ`φφφφφφUTSRφφφφφφUTSRӁyqiφ`YR3,%φ φUφφφφφφφφUTSRφφφ"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlqcow2_read_l2_tableqcow2_copy_data0+PSpSSST0T\TTTTULUUUUVDVpVVVVW@W`WWWW$X@X\XxXXXXX Y(YhYYYYYZ(ZLZ|ZZZ([`[[[ \D\d\\\\\]8]X]]]^D^t^^^_,_H_p____`(`<`\`|`````a@a\a|aaaab,bXbpbbbbbbcc8cPclcccc$dTdddddeM[c 9 xT  ". ppp ppp!pwoo8.oo ,Fi~waxbz&joShl743KOt_ENBUe")m Mp(6yI\];{Cc}5^vY  0kq=/nfT2 @ZrHuG[| $sDQX` + A.18*, -WdLJPV?g!9 %R:><#'  9 O i< , վ( L '  .j r ij  s Q ݍ( S 0   I* P   ~ Y$ @ J 7 r i: 5* 1 # B 5!  Qb P = 41 n - `  c. 9 $ D q aE A t  * -4 Q #Y  y: mB d~ Ml a D!8 @` ў i y. >V f q #1 ]@ U Y>^ uf n |  `]  Z 0IX h e %j y0  \  NN S  q 5X a 9K & ! ݌ AH L a  8i( 1j xv > ? Y  3    =D  bN L UJ Dz -i YN  $ H ^e< R  P R A( N, ` _a0 D ` 9> 1 }& ttd TDD 4 $|hZ ) k tdJ T D4$ l T  p & ] 6ta dT D4}$ nU0  tJd< T-D4F$YG   =tdT# Dt4S$% Jxdx< tu d3T>D4 $1.6."&  ?tdTW D4n$  GxH8c e s tdT"DQ49$2 '."C q] 8 stdTlD 4 $w@   - _fini__cxa_finalize__deregister_frame_info__register_frame_infoucv_string_new_lengthstrchrstderrfputsabortreallocvasprintffreaduc_lexer_initucv_getuc_lexer_freeucv_putsnprintfucv_type_ucv_string_getstrcmp__stack_chk_guard__stack_chk_failisxdigitucv_string_newuc_lexer_next_tokenisalnumucv_string_lengthstrncmpucv_int64_getuc_vm_stack_pushuc_vm_stack_peekucv_prototype_getucv_prototype_setuc_vm_raise_exceptionucv_object_newuc_vm_scope_getuc_vm_scope_setuc_vm_calluc_vm_stack_popucv_object_add__errno_locationuc_system_signal_namessigactionstrncasecmpstrcasecmpucv_array_getsigemptysetucv_array_setucv_to_stringucv_is_truish_ucv_stringbuf_appendstrlenucv_boolean_newucv_object_getucv_gcuc_vm_gc_startuc_vm_gc_stopucv_uint64_newucv_stringbuf_newucv_to_stringbuf_formattedprintbuf_memsetucv_stringbuf_finishucv_array_length__clock_gettime64ucv_array_newucv_int64_newucv_to_numbermemcpy__mktime64__timegm_time64__localtime64__time64__gmtime64ucv_array_pushucv_uint64_getucv_double_getucv_compareuc_program_function_sourcerealpathdirnamefnmatchucv_regexp_newfwrite__divdi3__moddi3__select_time64strdupcallocregexecinet_ntopinet_ptonucv_typenamememcmpucv_object_lengthstrtollucv_double_newprintbuf_newucv_array_unshiftucv_array_deleteucv_array_shiftucv_array_popucv_array_sort_rucv_object_sort_rgetenvsigaddsetsigprocmaskforkexecvpexit__sigtimedwait_time64killwaitpidstrerrorlh_table_newlh_table_freelh_table_lookup_entry_w_hashlh_table_insert_w_hashucv_is_equalmemmemucv_to_jsonstring_formattedsprintbufprintbuf_freeucv_property_getjson_tokener_newjson_tokener_parse_exjson_tokener_get_errorjson_tokener_get_parse_endjson_tokener_freejson_object_putjson_tokener_error_descucv_from_jsonuc_source_context_formatftellfseekfgetsbasenameuc_compileuc_program_entryucv_closure_newuc_source_new_file__stat_time64strrchropen_memstreamfcloseuc_source_new_bufferdlerrordlopen__dlsym_time64uc_stdlib_loaduc_stdlib_functionsucv_cfunction_newuc_stdlib_functionfprintffputc__eqdf2ucv_upvalref_newprintbuf_reset__ashldi3__ashrdi3__lshrdi3uc_chunk_debug_get_variableuc_vm_freeuc_program_function_srcposuc_source_get_lineucv_string_allocpow__adddf3__subdf3__muldf3__divdf3fmod__floatundidf__udivdi3__umoddi3ucv_array_new_lengthuc_vm_exception_handler_getuc_vm_exception_handler_setuc_vm_trace_getuc_vm_trace_setuc_vm_inituc_default_parse_configstdoutpipe2uc_vm_registry_existsuc_vm_registry_getuc_vm_registry_setuc_vm_exception_objectucv_key_getucv_key_setucv_boolean_getucv_resource_newucv_resource_dataucv_key_deleteuc_vm_signal_dispatchuc_vm_executeuc_vm_invokeuc_vm_registry_deleteucv_object_deleteuc_vm_signal_raiseuc_vm_signal_notifyfduc_chunk_debug_get_srcposstrtoullstrtoduc_double_pack__ltdf2frexp__fixunsdfsi__floatunsidfldexp__nedf2uc_double_unpackuc_program_newuc_program_loadfopenstrcpyfmemopenfgetclh_table_lengthqsort_rregfreeprintbuf_memappend__floatdidf__gedf2__fixunsdfdi__fixdfditruncucv_array_sortqsortmemmovelh_kchar_table_newucv_object_sortlh_table_deletelh_table_lookup_exucv_resource_type_lookupucv_resource_type_adducv_resource_new_exucv_resource_dataptrucv_resource_value_getucv_resource_value_setregcompregerrorucv_to_jsonjson_object_new_array_extjson_object_array_put_idxjson_object_new_booleanjson_object_new_uint64json_object_new_int64json_object_new_doublejson_object_new_string_lenjson_object_new_objectjson_object_object_adduc_search_path_init__tls_get_addr__floatsidfjson_object_get_typejson_object_get_stringjson_object_get_string_lenjson_object_get_booleanjson_object_get_doublejson_object_get_int64json_object_get_uint64json_object_get_objectjson_object_array_lengthjson_object_array_get_idxfeofuc_program_write__environlibjson-c.so.5libgcc_s.so.1libc.solibucode.so.20230711JSONC_0.15JSONC_PRIVATEJSONC_0.14GCC_4.2.0GCC_3.0GLIBC_2.0>@x M``' P&y ii (4@LXdp|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@,DP\ht (4@HT`dlp|,8(4P\h   $ 0 < H ` h t                             !!! !!@'&H'' 'X<JFX< JMX<JRX<JUX\JVX\ JWX\JXX\J]X|J^X| J_X|J`X|JaXJbX JcXJdXJeXJfXJiXJkXJg*`Ks Ja(1@A}geL*XJd2iH2Q8ؘpdINmg@8eQg0xdejl @2ied`uQ `nq5`rqam@:e kvqam@:e k\gΘ0D@Jm5L@:ek\gΘ0D@Jm5L@:ek\gΘ0D@Jm5L@:e km@:e km@:e k\gPD<L@:eEBdkdEnB1ejK @2id`uҚeg<`/uXgZXgPJBgEJ \g0DbgK@;eeQs"g\g#aX\J AA!*j@\g)PD<L@:ege\gdn0DgJg@:e_jXJ[q8`\q`$qa_ra\g{m0Dgg J@:ee"j@\g 0DoJ_ng@:ecKcyd\gΘ0D@Jm5L@:e$k`NJNZG@5J ҂g\gΘ0DmJ@:e[k`NeJNQrBa\g^m0Dgg J @:e "Θ@m5L@:e^k`NJN ]mg@:e"@Θm5L@:e]k`NJN\qa\gg0D|M(J@:e*g@:e"gJe*g@:e"geAΘ m@:e N]qJeN`[qa\gg0D' J@:ehBK[ `jFkl"Θ m@:e g`NJN@:eg@:e"gJe"\qa\gg0DM(J@:e_*Θ m@:e NJN N) ]mg@:e"Θ mt\g 0Dg(J@:e"J a\g0D Jog@:e\gΘ0D@Jm5L@:e ejJ @2idejg @raBobnDr8g !r@`r@`r`Z`r `r aj@%jKBon&\gg0DJ @:e"gJrea q `HAJZajJAA*j@V g@:e"gera qa g@:e"ge{qua g@:e%re"g`{r`#rUaj@#jK\g-m0Dgg J@:ee#"\gX| J j@j@\g-m0$gg I@9ee*+mg@9eeP*A"@N*\g 0DJ4ng@:e"gBEeJI_!CJC@cr`LkklLQgzd\gΘ0D@Jm5L@:e{k`NeJNp\gΘ0D@Jm5L@:e NgJN @:e"geYj\gX|J\gg0DJ @:eaBe+j@\g)PDL@:egegdnB-r(a\g#m0$gg I@9e* g}mg@9ee"jJ\g0DoJcng@:e"gBEIj@z#ra\g}m0Dgg J@:ee"j@{jKBonM\gg0DJ@:e"gXj"e0D JAgaQ`!Q:`AA`" j-JZa_qa\gΘ0D@Jm5L@:e neACN\gg0D' J@:ege"g\gD@:ee*_q@ a g@:eeHAJ@Z`D3 m`ie!/}}/'+w}}}}}}}}}}so)}}}}}}}}}}}}}}}}}}}}}}}}}}}}}/}qXg -"~Q$`{qXg a"|qXg *\g|m0$gg I@9e =mg9e8"bee/"[jD EMC<~qXg_*,kdb '@ I"\g}m0Dgg J@:ee"BkEd enB6jDjEBEoBfG9l bee"jD ENClE؄OCFg'@ I! #"\g{m0$gg I@9e Ҟe"jD EBE %mg@9ee"BkEd enB,5jDjEBEoB$\g=m0Dgg J@:eb'@ee I"jDj)lE؄OC0j1j\g?m0$gg I@9e "9e=m@gb'@ee I"\jDjEMCFgع]lENC.mg@9ee"[mg@9e  e"VjD (mg@9ebee"Wj.Xl[Bon\gg0DJ@:ee"g\g>m0$gg I@9e =mg9e "bee"jDj$l0bee"!j1 l5\g=m0$gg I@9e "=mg@9ebee"jl >mg@9ebee"Kj l\g*p\@:ee_ p @?eS@ 0P@:e eg@@:ee_iH2aI〚0P@:ePeg@?eeJjj @2iedgn0$ I@9e32n9e@ g0Pemn@:e0X e@:er e4aPT@:e"gTe@:e@e"jydY`P(3i@"3Z\`PLmg@:ee* r`Jj H@J Z>` J H2iD2JI-p `0pajjMjjjJ2D2J]H@J Za jM  jһJH@J Zaj @jMyP`XP`Fp`GPD`%p`Ep ``  J *Jj H!X`2I@AuC5MaXJ h$Gp@`Jpa@kL\gX~J#Akkl K @h AjKLXJ h%j Djl "#j Ej jl " HJi0k| J jl " HJi-k| J jl " HJi k| J jl " HJi+k| J  jl" mWQؙpHN@:e Ie @jL# mWQؙpH N@:e Ie  m WؙqpH _N@:epe ` X `p`pa %J @:egHe@:eg Pe@:e0 e=e @gTe@:e@"re a0DJ@:ege gAjKLX J h&AjKLXJAjKLXJAjKLXJAjKLXJ hjKLX~J hJҌXJXJXhJ jX JX\JXJj pJ `@pa  %@:eg e"r` n Z`jJ P @:ege "gX@:e0򸙞eg@=eepL @:e e?e@ge J %@:eg0DJ@:e Te:e@g@"reaH@:eg Pe@:e0 e =e@g e gX@:ee %J @:egHe@:eg Te@:e0 e=e @g Xe@:ee  %@:eg0DJ@:eegX@:eep %@:eg0Xe@:ee"r#a0\@:eegX@:ee J bnM@?eeL@:ege"gX@:e0򸙞eg@=eeؙN nnؙN )rdj @2iedgDJ@:e TOg?e@"g Hem@:e򼘞eґg@=e8ee@mvdej @2iedgҰP@:e TO ?eg@"gge@8eudej @2iedg0Dn J@:e g0Xe@:eZe `Z `r+`ؘ}N raT ]M@:e ҂g0DKJ@:ee*ؘ]Npm@?eje ҇ pP@:e Ҟe*H@8eg 0\@:e"gPHe@:e eBP@g@:e X e@:ee*0\ @:e PP e@:e"gePH@:eCe aX @:ereg`apؘNm@?eei @=ee )@ r`JZapؘNm@?ee @=eei @8eQgzdIpP@:e Ҟe"j 0P @:ePge@?e0P e@:eP?ee@gDelm@:ePeg@?epXemn@:ee*p\@:ege* "pؘ?eN@m e@=e0𴘞e0X@:ereaPH@:ee" * *0X@:erek`DJ@:e"g ҰTeo:e@gP@e @:e X e@:ee *PP @:eacXge Ґ򼘑g@=ee0@=eX e@:eZe?a0@=eX e@:ereaP@ nM@:e Ҟe0\@:e"gPHe@:e egP@g@:e X e@:ee*PP @:e"gPHe@:eCXge қ"@@:ep(eؘNgm@9eeX @:e"gej~ @2iedg0Dn J@:eg 0Xe@:ereaP@:e"g0\e @:eҞe\g PH@:eJ2eD5U\gn@og@:ekeB@*a#O r`BM]a=ri`BM]`Eggs(`s1`s`5kBM]`JBM ]`J+r`/r"a?j>jR3@HM`@5 k`J2m@@H 5k@H@ks `\gg@=ej=taAC ,@ @*\gٰXg@:ewd t`L\`JsJabg$ t`HDJZ`Kej @2ie dgPX@Q0@X Y@:eJe` " nm\@:ej je mĚ0\Mg@:eek"pLg@:e XMe aY" m$P@:e"gepLg@:e Ze|gxK pheYaؘ J]N_g m@:e eP"OX  M@:eeX o W"jI j @ r`M*Y"n=M@?ee n\@:ejeQ# @8e8Iؘ gNO "ؘNX=M@:eeؘNjY" Kn *n=M@?ee @ rgcxg $ r` r an=M@?e e" J I{nM@?e e" Jngn]M@?e  ZeM@:ee 0H2A=ei@퀚Ai`vdj @2iedgPT%g@:ej@ِTkea@:e@"re a @8e@avdeeej @2iedgDg8 Jl:e@&gg A'1a@:e xpDeg@:ee*P𘘠P\L@:ee@8e 0@m/8e@ X`vd Ij @2iedgPT >M@:eaBe+P𘘠P\L@:ee@8eedej* $@mV3+kLK[` km@Ġjz @2iedgHg:e@&gHg$e@:eyI9e Qg@ #g @:egmUegCgxg!w<#1`"_`w0a@?ee0=e@"g0 e@8eQgyd+raHg@:egegD@:eeLgLgN + + "`"Z `r Lam+raH?n @:egegLL L Lnej @2ide$\g\@:egDd DgeDg$DJej @2iedgDJ@:e Pa@e %g FKO2xT>M@:eTe Ù^M@:eDJ:e@ 𸘞egT ~M@:e e"A D ĚTM@:eje  DCazd Eobg mH2I PD@:eg @:e𸘰Te gM@:ee)P\ L@:ee0@=e eJH" @:e𸘞egT M@:ee!Abg(2I㠚 @:eg𸘰T eMg@:eeea@@aځ ej @2idҚe AGFY@A`gX@JIv3`V`DF "3&P𸘀TM@:ee@8ev#`vaAb@2ic@2i@2d Ab@2ic@2i d@2iROAO@HQgudAb@2i@HOjz @2ide\gD8J@:eA"DSDdej: @2ide\gDg Jm:e$g@LҞe\gg0X@:e re a\gh0P.#@:egeAa@`@p#ggp L0 @=e e  AJ`[XN^M@:ee n^M@?eej @2idej(*%g&%@ kL"#klJZ`gmP@?eHeg@:e eؘpgNm@8ejudjjY @2ideEgJZg'gaEgJZ`\g5DgJg@:egPgzd5-rXgb*\gg0X@:ereNa\g*0X+ѐg@:erea\g+0X@:ereag*0\@:e"g0\e+@:ePH*e@:e PH+e@:e i JZet`,#` ICa=` IC9`\gg0X@:ere`ggH@:e Heg@:e e" *g0@=e0e@=ePe@:ef Z`g\gg0Tg@:e QeC`ICa`#*׳`W`kKCgSXgwW\gLggj./gm$(Ȳ*`Q `j g+gOQghQg\gD+gg./gm,gggXg,-gm-,gqg,-./g ,"gg./3XgWan(#`,gqgSggWgQxg #%$Xg,,-g,pgg./g(ggxyggXYgbg #qgS`|gegXggg@:ege|ggD@:ee,-dg+gg./gm(ggggp@g@:egeLgbg #qgS`|g,-dg+gg./gm(ggggLk g+@$KCxgolmnL &g`6F2f3$1ggm.Ov`v`va@ȣ M @:ee@W}`ؙN~M @:ee Z`Z`JZ ` jD$L+$l *D l@:ee JEZ `D3 m`ie_% S 1 5m OOOUUUUUUOOmm]s/ؙN@Wa+n~M{1-nW`-n`𸙞Mk+n@ȫMNқMG r`ra@HFZ`xH2# KiT M@:ee6e#Fgd2iL2I$DpT@:eeg6"gDJ@:eegT M@:ee0𴙐g@=ee a rXgZ grXgZXgMgҚ wPD@:eeؙ>N $rgRbgXgZl agwPD@:eg*eb#Fgd2iL2I$DRLpT@:ege#"DJg@:eeg@KFZ`xH2# KiT M@:eeؙ>N>Oؙ>N= @:e Ҟe r `r"`r`D: J@:egpT@:eeg@Lm@:ee@D: J@:egpT@:egj0Xe@:ere`Pm@?ee0"eD!JAgPH@:eZea0\@:eleg65B@@:e0e=e@ge Pg@?ee0@=eeؙ_Nmp@8eemP@?ee knZgX@:ee^ 0PYg D: J@:egpT@:eje 0X@:ere?ag 0\@:eg\eg@:e  @e(*p@g@:ege*D8J@:eUe"0\ @:epeؙNgm@8ee0@=e ep\@:e p\e@:egg0Xe@:eZe"`Z"apX g@:eePg@?ee0 @=ee"eDJAg r >OpHؙNm@:eep\@:e P\em@:egg0Xe@:eZe`ZapX g@:ePeg@?ee  r >OpؙNm@8eeOD8J@:eArEh3ie@0h#@=eeCAaH2I〚D8J@:eCriaH2IeD8J@:egD: J@:egp\@:e knZ0H e:e@gPe Ңg@?e Ke_"B"raazM@=ej"eDJAg`@@2₣@2c@2i h3  eR'`CDM9 J@:ee@ Ei‚0P@:e@J@ eJ Dbg caAEh3i@jgp@@:eehgP\@:e ҞeahRC`p\@:eHeP\M@:egL e@:eHep\@:e P\em@:e 0X e@:ereA`L @:egegؙpH:eN@m0 e@=egeD g@:eg0Pe@:egL e@:eHe\ @:eCeahpL@:eehgP\@:e ҞeahRC `p\@:e0𴙞eg@=eHeP\M@:e ReBP\@:eg@e @:eHep\@:e P\em@:e 0X e@:ere_`r_a0X @:erea D @ 0P@:e eg@ @:eeD𸙙Jg>M@:e ҐD ge@:eg0Pe@:e eg@ @:e0e@=eHe\ @:eCeahL @:egeؙ>Nmp\@:e I D: J@:egpT@:eҞe0X@:ere JAg ҄p\@:e p\e@:e p\e@:e g0Xe@:eJZeC`D J@:eeJ"pX @:egg g@D[ J@:eg@e @:ePeg@?ee0𴙐g@=e0 e@=e e ">OpؙNm@8eehOD8J@:eaRgeH2Ip\e@:e H6"Ø g@D[ J@:ePge@?e0 e@=eHe"0𴙃@=eP\em@:eg0Pe@:eehAbgAH2IP\m@:eg0Pe@:eggSD8J@:egRbgeLp\ @:e c iH2aIg@D[ J@:ePge@?e0 e@=e ep\@:e p\e@:eggD [ J @:ee0 =e@g0 e@=ee "eDJAgp\@:eg0Xe@:erea0\@:egDm@:ege"0@=eОe0X@:eret`Z` *lm!rT``PT@:egTe @:e@"kn e6s *aD%0P@:eePg@?ee"eD> JAgaD(" +""@:eek gkT@:e 6tea P@:eeH@:eg 6remagp\@:e p\e@:eggD J @:eep\@:eg He@:eggDyJ@:eSeg `ODo@:eegm.gegLop\@:e p\e@:eg D xJn@:e0 e=e@g0 e@=e "knZXgrge"eDJAgp\@:e p\e@:eggXe o@:e0𴙞e=e @g0 e@=e e"eDJAgp\@:e p\e@:eh 0X e@:ere`rA` "\ @:e Ҟeh `D g@:egDxJn@:ee"j @0@=e0 e@=ee "eDJAgH0X@:erea0\@:eg\ e:e@ep\@:eggPe@:erXge@:ePeg@?eeg"eD> JAgD8J@:eg @:ereKm䁚`pؙ~Nm@?ee"eDJAg@Q``"eDJAgD8J@:eg @:e p\e@:e ReJ @m ACa C`P @:ee? *@ i@$D8J@:e m@:egRe P\@:eg J e@uaca@Mc`0X@:e l00jLe_ (@b2 p\@:e0𴙞eg@=e He`Pm@?e @ei @"eDJAgp\@:e p\e@:e g0Xe@:ere`rMa v* DBE"H ml@:e Ҟe*P𘙠P\L@:e0e@9e 0k@lKkm C@XHdJACgefPH@:eb ddBcܞeCV*a@@aP?e@mPem@?e AreaPm@?ee0 @=e e"eD> JAg0X @:e re a AbgXdJK*  (ؙNpm@?ee ҨPD@:ePeg@?e AreaC0P@:ePeg@?eeP @?e0 e@=eCCe"eDJAg a*\ @:ee "Lml@:e Ҟeh\ @:eCe_` AraLgm@:ePeg@?eeD g@:eg0Pe@:ePge@?eP e@?e0 e@=e He"eDJAg0X @:e re aP m@:eg e ҝؙN<g@P\@:ege"eDJAgp\@:e0𴙞eg@=ek@Qel"@RsC~a@P1"hM0Kj #a@=eMen JaPTM@:ee"eDJAgAHAN@=ee"eDJAg@yOB@?ep\e@:ege"eD> JAg2 Pg1g P\@:e g0Xe@:e rea L&*P2al0P@:eg0P e@:egDr| J Ӱg@:ee"eDJAgE"D8J@:eeP\ M@:egeDzJ@:ePeg@?eEe *"eDJAgp\@:eg0Xe@:ere;`Z `"L@:ee JZ`Pno@:eeggpL@:eegHmg@:e0򸙞eg@=ee"eDJAg0\@:egPHe@:eegHmg@:ee"eDJAgp\@:e p\e@:egg0Xe@:ere$aDJg@:ee^"T g@:egXe@:ee"eDJAg ^ O"eD^JAgO"eD^JAgD8J@:egD: J @:e RB3b3se ҀapL@:e@J~`31 @Cg i1 Ibg c` jaM@=ee"eDJAg@J}5u~5u@ 5:e@ugpT@:eg0Xe@:ere%a H2 Ji@"0\@:e Jei‚0P@:eeg@@:ee0@=e J1 ҏh3 a ]geZ 1iCa H2jI〚$ 0P@:ee"eDJAgP@l@:e @A eEik@h"eDJAgD8J@:e: Mg@=egRUD9 J@:e Dɘ J@!Lm@:e `IeJI؃gD8J@:egR ]gR1@J}5u~5u@D5: J:e @ugpT:e@ Ңg0Xn@:e0e @=e e":*pL@:e 0X e@:erea D( M@=ee"eDJAg@ 0P@:e eg@ @:ee B2B2 @J}5u~5u@ 5:e@ug @:eg0\e@:eg\ e:e@ @e*0\@:epeؙNgm@8ee"eDJAg0@=e H2AeEliP@@:e@AeEi@jH0P@:eC J1 ei 1n*"eDJAgpؙ Nm@8ee"eDJAgFgd2iL2IJ@"DzJ@:e0𴙂ge@=eEC|`Eu"D8J@:e l"j$ @:eg a@sek\`p2 Cp6aACaKp\@:e0𴙞eg@=ee Ci Cci`caX@:eP?ee@g0𴙃jeB@=e0jeC@=ejD Ceib@Capؙ~Nm@?ee+j"eDJAgAi @ې\@:ee*"eDJAgAe eej @2ie da\ggDg@:ee u`EN^`LA kmor`pR `8R`0Ra"jbraHjxrajH-$\g P @:e@` s`CN^`J@+"\gUD` @:exgw\gL) ej @2ide\ggDm# J@:eDdej @2ide\ggDm# J@:eDdej @2ide$ggj'K j#\gѐP@:ee* 꽵"\gP@:eZXg jh caj?a?! ꯵"\gP@:eZXg j#ҡ+ #k*#m 64 54 Í45 íB4í5 í@j)n*\gl\ Њ @:eRiaiQg j#ҝ\g \  @:eRe`tNj \gPL#@:e"ge\gѐPoo:e@gee*#\g0Dml@:e"ge\gӐH @:ege\ggH@:ege g\g !PD !@:eZegW0$g9e@gVegT gg@9egeg蜂g@?eB3e?#H2?"Jr# aj~\g@@:eg# KSe"g# a\gT@:e"k`jtdR`\g0@ N@:e"gegja*\gpX@:ee_"\gPD@:e"g Jeg#=kee?ApA?j0 @2ide0>?j@AB Cj @2ied L@:e󐘞e@ngDgJ@:e+Ce`jCa|gH؛EO_Ng@?ee@66L m@2mM\ggDiJ@:eeJ a\g0@=egEgaxdB(2Im@g[\g1IO@?eej @2ie dgDgJn:eeH@$g g@8eudejj @2ide\ggD՜ JҐg@:ee\g_m$g&I@9e"Hg՚@:eme\g-nDggJ@:ee^mg@9ee"\ggFM@=eDgJ J@:eCmg@:ee"GCk %#$Je"JJ\g!!H2meّg@8ege\gDbgGK;e@ 3mg@8e5mg@8ege\gD_M J@:eҞe\ggD J @:e jHX6r'`br%`Emg@:ee ""|g0@=eHe|g؛EO_Ng@?ej6mg@8ee\gDJ`" g@:e gǚ@:eje Abj `\g nDmbggK;e @gme\gDgJ@:eme\gDgbgK;e@ gǛ@;e "n;em@gge\gDJ@:e @*BmBg@:e gǚ@:ee Jc Hac`H0@ *\g˜DmJg@:e gǚ@:e eg0@=e𤘑g M@=ee " gGB@:ee n"eD JAgmg@8e mGe\goDE J@:e2IaK` LgabDmg@:eeF" g@:e g@:emg@8ee\gDoE Jm@:eOFh5@KEFAGEJM g@;ee@\g 䚑gOǛ@?e "\ggDm J@:e|gH؛EONg@?e nmg@:e@J@ \gnDmgJg@:e@Je@ gBg@:ee!Amg@:ee"G5mGg A JJJ\gH@8eeHX6r`bra6mg@8ege\gDbg K;e@e\ggD Jg@:e ce`oBɚ\gmD!LE J@:egb ` a cIJIJBmJJّg@8e2mg@:eeP"?mg@8eHeg\gnDJ@:ege\ge M@=e3m@8e5mg@8eeHX6r`br1a6mg@8eg@:ee ǚ\gg䚦O"eDJAg\ggDm J@:ee[\g;nDmgJg@:e\ggDm J@:ee>mg@:ee"\gm䚑gO@?e"eDJAgHmg@:ee"\gghM@=e"eDJAgImg@:ee*Gmg@:eeC"GK"\gmؚ䚟NgEO"eDJAg\ggDh J@:eRre\ggHaHng@8eH=ng@8e"eDJAgL@=e4mg@:ee"gH䘑g՚ O@?eD?nmggJ@:e"eDJAgmg@:ee)"gG\gGM@=e7m;e@gme\gg䚆O@?eGCe^`\g?nDmg5mg@:ee%"JJJRj HX6r`brag6m䘑gO@?e𤘑g M,\ggDm J@:ee\ggDh J@:e "eDJAgej' @2ideHgJmX$gD&J @:e"m䘑gO@?e7mOg@?e! Umg@:e"m amg@:e`"GK"J"HؘEONg@?eH`p#k`phXbr@ardA5m g@:e"D?mJ:eg@ H0Pe@:egD% Jg@:eJe*HV 0\@:egDؘEJ Ng@:eD𸘅 JMg@:ee)*0P@:e O ?e@g0e@=e0 e@=e 6mg@:e5" 7mg@:e{𤘑gFM@=e ?mg@:ee"H Pmg@:ee* Emg@:e *HؘEONg@?ej mg@:e_* Jmg@:e9"m䘑gO@?ee aj}aPDL@:eg DnJg@:e0 Ҟe@=e JG"Hؘ䘶 NgEO@?e Umg@:e"m >mg@:e "mOg@?ee Emg@:e "𤘑gGM@=eeHؘEO? Ng@?eeABmgO bP2I䘠O g@?e J aca `mg@:ee"@l@:e J"HؘEONg@?ee0 @=e 5mg@:edKӀ" &O?e@gf OMg@?ePm:e@gHB0\eML@:e Ҟen"HB\@:ep@ e/m@:e Ҟe`" De J@:e ҞeH@Cjj`a @"gX.m@:ege"\𸘠M@:ee*PD @:eje Ұ\ @:eCe@a `*0@=e0 e@=e7mg@:eeS 'mg@:e:"Df J:eMg@ ?m:e@gHngDJ@:e𤘑ge M@=eXel@:egL e@:e Mg@:e8 ?mg@:e?"H䘑gO@?eL em@:e mg@:edf K " 5mg@:e" &Og@?e Mg 'mg@:e." 𸘑gM@:eg:e@?mHngDJ@:e𤘑ge M@=eXel@:egL e@:eHؘEONg@?e*mBBbgH2I@҂gp@@:e Ҟe6" kpL@:e J DJM@:eiqaDe J@:e0e @=eeJAbgc` "`.sa/k`Jj DbgH2I〚\@:ee"JD @:egHe@:ee "DEngJmg@:eDnJmg@:eeOmg@?eeJ J DEngJmg@:e Cm{D6J6mg@:eDeJmg@:ee\ @:eCe_`D @:eg0Pe@:e Ҟe *PD<L@:e ҞeH @:ee* mg@:ee0 @=eJeҾIGj ja 0P Hbg H2I@ҁ\@:eea*0P@:e  he"jjYBaBIEGD Jn>*P@:e jKIgDəJg@:ee*0@=e ؘgH?NDEJ@:ee0@=ee  J\@:e ne*IJ*HؘEONg@?eejҰ\ @:eCeajCaؘEONmg@?ee\ @:eCe`D @:egҐHe@:ee.*T @:eHVeJ* A\gDEJ"0\@:eؘNg@:eeJҳ@-0D@:eg\e@:ehe #JP@:ebge HO i\@:e nhgiiHgDgJ:e@DJNmg:e@>nmg@:enmg@:e;nmg@:ee;D @:egHe@:eem" IbgC` hC aHؘEO_ Ng@?eHCngDgJ@:e {mHgMDJ@:e mҪOg@?eje HbgcaJ JbgH2I〚$0P@:egeO?em@g0e@=eeJPD<LJؘNg@:eeLBaؘEO_ Ng@?eeDgJCng@:eCmki @2@2igMDgJ@:eeZҐT@:epXe@:eDؘEJ Ng@:ee9ؘ DNEJg@:e"eD-JAgDgJ J@:e"eD JAgt7s`r`JZ` fjl *𤘑gFM@=e"eD JAgj @2iedH@H`H`H`H~HH H He`AA `eAAݠ j @2iegdm2O@?eDdj @2i$diҚeg)`jl*jMjl r`` Z)`r`Z `r?`rv`\gg0@=evd raDDDDCa \g2O@?eej r` r ` ra jL#\gXJ@:eҞe}*C*D@DD\g X2J@:eeCCa\g0@=ejeEC *@"A"\g@=ee((2Q @:eIe`r`jҙr`ra0Hg@:eP\eg@:e0eg@8eDg@:eZgjeN@8e\g@:eegg@8e@g@:egJeg*?n*PXg@:e egg@8epL@:eDge@:e"2!@ X J:e@#Ҟeg@ @:ee*0@=e@@:eҞej0Xg@:eCeawdp@g@:egX J@:e gLe@:ee*0 @=eeJej @2ide.jvdg$g0X @:erJaXJ@:e"g7A#xgUce$an*\`\ @:ek+gke+a\ @:eI#"gxgIeRaH g@:ee"0@8eXgJg@:e"ge*0\@:ege@ @:e0򸘞eґg@=eegeDg-F3iC`32mm3m4l ej{ @2iedgH@:ee*P𘘠P\L@:ee@8eddej @2iedgXgJ@:ee8en@medj @2ide\ggXxJ@:eie@Ca@:ee\gHm@:ewdb,2IIa\geO@?e@gҞe\gHn m@:eeej[ @2iedgPT @:eaBe+P𘘠P\L@:ee@8eedej @2ie da @-L@:e@jL#@:e@9ej ic` P2 J9ei@通 Ji9e@遚 Ji9e@邚J i9e@郚 J P2 L9eib@ Li9e@遚 @9eL i9e@郚 JebcujZ @2ie0dgPXؘ@ _XyJgN @:ee"n"XX JM@:eej 0 @=eje  ؘ N@:ee" âv`XX Jo M@:eeX@:e jl" nOXJ @:ee"i n O@:ee"X8Jgl:e@ g 89I O@9ee* 0@=ee| n @O@:ee"?"gl@:e `O@9ee*0@=ee0T @:e"g ؘXAJNM@:ee7*0𴘑g@=ee0P @:e"ge*P T@:epXe@:eg𸘰Te Mg@:eXJ@:egen 0g@?e BXLJ@:e 0G JeG@=eJe?*! ؘB NXJ@:ee" ؘ N@:ee"jXJ@:eg0TeLn@:e"g 0g@?e BXLJ@:e eGJG۬ ؘD N g pH@m@:e  @:ee@ "jl"pHؘ N@m@:e  @:ee "X8Jl@:e"gepHؘ N@m@:eX 9J g@:ee"gؘpH N@m:e@X Jn @:ee" n@:ee" n@:ee " n@:ee~"  H`h3iP @:e"gkglF4lJ4^2lKlCeD*X}JؘpHg@N@m@:e/egؘpH`Nm@:eXJ AM@:ee/*񬘇A=e@-L0򸘈e@=e0򸘊e@=e0򸘌e@=ejeGHIJKLgjX}J"g2jl}* jlA"/gؘpHNm@:e An%M@:e"X8Jl@:eLٞejk/cpHԠaؘmN@:e A-M@:ee"@jL#/g ؘpHNm@:e  A=M@:ee "0@=eeJC_a_`n"@>=''&=''^=''|=''?'':''||''&&''|''^''&''===''!==''==''!=''<''<=''>''>=''<<''>>''+''-''*''/''%''**''!''~''++''--''.''['']''('')'Text';'Label'...''=>'NumberDoubleStringRegexp'?.[''?.(''?.''**=''&&=''||=''??=''??''${'TemplateEnd of fileError[[:digit:]][^[:digit:]][[:alnum:]_][^[:space:]][[:space:]][^[:alnum:]_]Invalid escape sequenceUnterminated string^bBdDsSwW<>.[$()|*+?{\^ Unterminated commentUnexpected characterInvalid number literalTemplate blocks may not be nestedUnterminated template blockendfunctioncontinueendwhiledefaultdeletereturnendforswitchimportexportendifwhilebreakcatchconstfalsetrueelifelsethisnullcaseforletifinPassed value is neither a prototype, resource or objectSIGignoreAssertion failedDied$collectstartstop0123456789abcdef secminhourmdaymonyearisdstTerminatedwdayydayGiven flags argument is not a stringUnrecognized flag character '%c' intboolInvalid level specified%s value is immutable%.*swaitpidforksigprocmasksigtimedwaitInvalid timeout specified/bin/sh-cPassed command array is emptyPassed command is neither string nor array%s(): %slldllollullxllXG%(null)#0- +%u.%uTrailing garbage after JSON datareadInput object does not implement read() methodPassed value is neither a string nor an objectUnexpected end of string in JSON dataFailed to parse JSON string: %s[?]......%s:%u%12s:%u%17s %s `%s  ` ^-- Near here Near here -^ function anonymous functionfilename[stdin]In %s(), file %s, In %s(), In linebyteline %lld, byte %lld: called from %s%s (%s:%lld:%lld) [C]) In %s, | %s | %.*s | lstrip_blockstrim_blocksstrict_declarationsraw_modemodule_search_pathforce_dynlink_listUnable to compile source string: %sUnable to compile source file '%s': %sUnable to open source file %s: %sPassed filename is not a stringPassed scope value is not an object%.*s/%s./%sInclude file not foundUnable to initialize output memory: %s[loadstring argument]Unable to allocate source buffer: %sREQUIRE_SEARCH_PATHGlobal require search path not setmodules/Unable to dlopen file '%s': %suc_module_entryModule '%s' provides no 'uc_module_entry' function.ucNo module named '%s' could be foundchrdieexistsexitfiltergetenvhexindexjoinkeyslcltrimmapordpopprintpushreverserindexrtrimshiftsortspliceslicesplitsubstrtimetrimtypeuchrunshiftvaluessprintfprintfrequireiptoarrarrtoipmatchreplacejsonincludewarnsystemtraceprotosleepassertrenderregexpwildcardsourcepathmaxb64decb64encuniqlocaltimegmtimetimelocaltimegmclockhexdechexencgcloadstringloadfilecallsignal%s: %s context {+%zu} <%p> %s {*%zu} <%p> %s messageException {!%zu} <%p> %s [!%zu] %s %zu [*] CALLFRAME[%zx] |- stackframe %zu/%zu |- ctx %s `- %zu upvalues [%zu] <%p> %s {unresolved} {closed} %s {open[%zu]} %s Unhandled operand format: %d [+%zd] %s [-%zd] %s [arrow function][anonymous function]At instruction %zuAt start of programundefined arithmetic operation %dToo much recursion(%s) is not iterableleft-hand side is not a functionNaNInfinityglobalvm.exception.prototostringstacktrace(unknown)(?)not an array or objectnot an object%08zx %s {%s%hhd} {%c0x%hx} {%c0x%x} {%hhu} {0x%hx} {0x%x} (unknown operand format: %d) ; %s ; %s (%s) ; (%s)access to undeclared variable %sleft-hand side expression is %sValue (%s) is not iterableattempt to set property on %s valuejump target out of rangeInvalid object iteratorInvalid array iterator! GC reclaimed %zu object(s) Module does not export %sunknown opcode %dSyntax errorRuntime errorType errorReference errorExitNOOPLOADLOAD8LOAD16LOAD32LTHISLREXPLNULLLTRUELFALSELLOCLUPVLVARLVALPVALCLFNARFNSLOCSUPVSVARSVALULOCUUPVUVARUVALNARRPARRMARRNOBJSOBJMOBJBORBXORBANDEQSNESEQNELTLEGTGEINLSHIFTRSHIFTADDSUBMULDIVMODEXPNOTCOMPLPLUSMINUSJMPJMPZJMPNTCOPYPOPCUPVRETURNCALLPRINTNEXTKNEXTKVDELETEIMPORTEXPORTDYNLOADDouble value not representable Syntax error: ...%sline %zu, byte %zu: Can't access lexical declaration '%s' before initializationToo many local variablesVariable '%s' redeclared(callee)Too many upvaluesUnexpected token Expecting '%s'Import name '%s' is already declared as local variableImport name '%s' is already usedUnexpected token Expecting %sDuplicate export '%s' for module '%s'Duplicate default export for module '%s'asUnexpected token Expecting Label, String or 'default'Unexpected token Expecting 'as', ',' or '}'Jump address too farExpecting expressionExpecting ';' or binary operatorexpecting a property access expressionExpecting variable nameExpecting initializer expressionInvalid increment/decrement of constant '%s'Invalid left-hand side expression for increment/decrementInvalid increment/decrement operandbreak must be inside loop or switchcontinue must be inside loopInvalid assignment to constant '%s'Invalid left-hand side expression for assignmentToo many function call argumentsExpecting labelInvalid identifieruse strictExpecting 'endif'Expecting 'elif', 'else' or 'endif'Expecting 'endwhile'(for in key)(for in value)Expecting 'endfor'Expecting label after 'local'(switch value)more than one switch default caseExpecting 'case' or 'default'return must be inside function bodyExports may only appear at top level of a moduleAttempt to export undeclared or non-local variable '%s'Unexpected token Expecting 'let', 'const', 'function', 'default' or '{'(module default export)Duplicate default export statementImports may only appear at top levelfromUnexpected token Expecting '{' or '*'%.*s%.*s%sCircular dependencyUnable to compile module '%s': %sToo many module exportsToo many importsModule %s does not export '%s'Module %s has no default exportUnable to open module '%s': %sUnable to resolve path for module '%s'Duplicate argument names are not allowed in this contextExpecting '=>' after parameter listmainmoduleExpecting function nameExpecting LabelExpecting '{' or ':' after function parametersProgram file contains no entry function Unrecognized source type rb#!Failed to rewind source buffer: %s integerbooleandoublearraycfunctionclosureupvalueresourcesourceunknowni/%s/%s%s%s\"\\\b\f\n\r\t\u%04x =>""%llu%lld"NaN"1e309-1e309-Infinity%.14g.0[,{([arg%zu])%s { ... }%s%sfunction%s%s(...) { [native code] }%s%s<%s %p>%s%s%s%s%s%s%s/usr/lib/ucode/*.so/usr/share/ucode/*.uc./*.so./*.ucPremature EOF%s while reading %s at offset %ld, got %zu of %zu bytes padding%s index size%s index entry %zu of %zu%s data size%s data%s vector size%s vector datafile magicInvalid file magic program flagsBytecode version mismatch, got 0x%02x, expected 0x%02x amount of source entriessourceinfo filename lengthsourceinfo filenamesourceinfo code buffer lengthsourceinfo code buffer dataUnable to open source file %s: %s sourceinfo lineinfo[no source]constantsfunction countfunction #%zu flagsfunction #%zu name lengthfunction #%zu namefunction #%zu (%s) arg count and offsetfunction #%zu (%s) body%s byte code%s exception ranges count%s exception range %zu of %zu offset%s variable scopes count%s variable scope %zu of %zu offset%s variable names%s source offsetsHUPINTQUITILLTRAPABRTFPEKILLBUSSEGVSYSPIPEALRMTERMUSR1USR2CHLDPWRURGPOLLSTOPTSTPCONTTTINTTOUVTALRMPROFXCPUXFSZABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/-./01+,! 24:9@ I;>E T(G0=8C@`HaP8X:`HhBpUxML9SRDA\<J"]9acmatAQ)agsQc4ц mr kE~ ( 08@HPXp`ehp-pxy݊1biap UMIɫY~I9[` |({4z`iw@AwDLfT}\phopYm|1majhemd%[]$0@HPX`hpx (08@DLTX\`dhlptx $?1EGF???? ? ? ? ? ? ? ? ? ? ? >? >? ? ? ? ?>>>>>>)SAaMxNPYxSSSSSSSS}:aMN)SE-P\`dl tx a ,04<@HPT\`hlt|H'݃=ݍAB-i]Yў15qAeQ1uQ վ} aY iE݌i]11Iaa !MyUѴmeqMYi9i=5  5!&Q& A9K>B1]>Y>iAōэ]tdTD4$tdTD4$l  tdTD4$tdTD4$tdTD4$tdTD4$tdTD4$tdTD4$tdTD4$H'07070101AE217E000041ED0000000000000000000000036A426C2800000000000000FE0000000000000000000000000000000E00000000usr/lib/ucode07070101AE2181000081ED0000000000000000000000016A426C28000081BE000000FE0000000000000000000000000000001600000000usr/lib/ucode/ubus.soELF4t4 (p{{~؎؎(000((QtdRtd~؎؎(( w t Hp؎܎XT   `ppp p plppooooalV>@LY%bM] 3*2$GA`U ;Z6 af, F87 #K=)0!5I[hi+H9POE<&1"-'(DjWNBJ.:/T4?\XSCRQ^c_dekgt X5f" at Hp gj" (ppspLooCooVoToooxohoXoHo8o(oooknnnn0nn/n{n~xnhnXnHnY8nM(n%nnmmm}mDm`mmmxm%hmXmHm8mp(mpmfmlllylMl1lllCxlXhl^XlHl"8l(l,l~lk&kkkZkk kkxkhkoXkHkI8kH(k"kk6jj j."Vj jAjDj3j5xjhjXjHjA8j<(j_fini__cxa_finalize__deregister_frame_info__register_frame_infoucv_typeuc_vm_stack_peekuloop_timeout_cancelcloseubus_complete_deferred_requestucv_string_newucv_array_pushucv_resource_type_lookupucv_resource_new_exuc_vm_registry_getuc_vm_exception_objectucv_getuc_vm_stack_pushuc_vm_calluc_vm_stack_popucv_putuloop_cancelleducv_resource_value_getucv_int64_newucv_property_getucv_int64_get__errno_locationuc_vm_registry_setucv_boolean_newucv_uint64_newucv_array_lengthucv_array_get_ucv_string_getfnmatchblob_buf_freeuloop_fd_deleteubus_shutdownvasprintfstderrfputsabortucv_object_getucv_is_truishucv_stringbuf_newstrlen_ucv_stringbuf_appenducv_stringbuf_finishubus_strerrorsprintbufucv_object_newucv_object_adducv_cfunction_newucv_resource_type_adducv_resource_value_setuloop_fd_addubus_channel_connectubus_remove_objectubus_abort_requestblobmsg_add_fielducv_boolean_getucv_uint64_getucv_double_getucv_string_lengthblobmsg_open_nestedblob_nest_endmemcpyucv_prototype_getucv_prototype_setucv_resource_datauloop_timeout_setucv_gcblob_buf_initubus_send_replyubus_invoke_async_fdubus_complete_request_asyncmemsetstrcmpubus_complete_requestucv_array_newblobmsg_check_attrucv_double_newucv_string_new_lengthubus_lookup_idubus_subscribeubus_unsubscribeubus_channel_createubus_notify_asynculoop_timeout_remaining64blobmsg_check_attr_lenubus_connect_ctxubus_flush_requestsubus_send_eventubus_register_subscriberubus_register_event_handlerucv_resource_dataptrucv_object_lengthucv_typenamestrdupcallocsnprintfubus_add_objectubus_lookupuc_module_inituc_module_entrylibubus.so.20251202libblobmsg_json.so.20260213libgcc_s.so.1libc.soGLIBC_2.0ii ؎܎  $(,048<@DHLPTX\`dhlptx|ďȏ̏Џԏ؏܏' '<`'!'@@ D4@4 {$$ '<'!@ đ$ {$A`@2mb`3`3M`3@2mB2k leA`@2mb`3`3M4g`24m`3ml3ml Jej? @2ide\g0@b J@:ekkJDd le$a`3뢤DD55mc`3m#e`3m4b31lK ijej @2ide$ghNB.`2 L2j Dl3i=e@퀚eJMqEB\g0a@=eMie\gH0@=eevdej^ @2ide\gT@:eJZDd Xgj @2idҚe `\gMT@:eDdjej @2ide\g@L0L@:eDdj @2idgejKT @2ideg$g%pP@:ege "p ґg@8egvd Egej @2iedg0LnM:e@$g҂g0@ J@:ee7"Dg@:ep@e@:ege?e@ge?e@gPLemng@:ee*Xg@:eeg@8evdpj@ej> @2iedgPL$g@:e "0gH@8ejudjej @2i degҀX4ҰPm@:e҂g0@ J@:eeV"p@@:eg?ee@gp@e@:ee?eg@g \e5@:ee?eg@g\e5@:eeg?e@g0@nJmg@:ee "Xg@:eeg@8evdj @2ide`DU*\gZ$g0@ J@:eeE"p@@:ege@?ep@e@:e?ee@g \e5@:eeg@?e0@Jnm@:ee "X@:eeg@8evdej> @2iedg%gҰPm@:eTp@e@:ege@?eTp@e@:eeg@?e0@Jnm@:ee "X@:eeg@8evdej @2iedg0𠘰@ nM:e@&g҂g0@ J@:eeS"!j@p@ @:e ge@?ep@e@:e eg@?ePL emn@:ee"jKvdX @:egpDe@:ee=e@"ge@8e@**QaQgpD @:e"gej @2iedg0@nJ@:e"g e*L0 nM@:epeg@8eud)p@g@:e0𠘐 e?enM@g0el@8e0@g J@:ee*ej @2i degV5ҰPm@:e҂g0@ J@:eeD"p@@:eg?ee@gp@e@:ee?eg@gpHem@:eeg?e@g0@nJmg@:ee "Xg@:eeg@8evdj> @2ie dggҰPm@:egPPe@:eҞeiJaj&pTg@:eg Te@:ere`IP\ @:eg@e:e@ne*jwdj @2iedeB5`6%gnb4ee9gg9e`4b3$gg;e9B2Mg,g j  mP\@:e"gXe@:eJegmlPXn@:e eiPP@:eCea P@8evpTg@:e0 Ogl@?eIePXn@:e0O?e@"ggeej; @2ied$%x =$%x <$%x ;$%x :$%x 9$%x 8$%x 7$%x 6$%x 5$%x 4$%x 3$%x 2$%x 1$%x 0$%x /$%x .$%x -$%x ,$%x +$%x *$%x )$%x ($%x '$%x %$%x $$%x #$%x "$%x !$%x  $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x  $%x  $%x  $%x  $%x  $%x $%x $%x $' 'ubus.ex_handlerfilenoOut of memory an integer valuea boolean valuea string valuea double valuean arrayan objecta regular expressiona functionthe expected typeArgument %s is requiredArgument %s is not %sOut of memory: %susergroupobjectaclidnamepathmethodtimeoutdisconnect_cbcbInvalid file descriptor argumentubus.channelUnable to create ubus channelubus.requestubus.deferredsinglemultipleignoreInvalid return mode argumentargstypedatainfoubus.subscriberInvalid subscriber contextFailed to remove subscriber objectubus.listenerFailed to remove listener objectubus.notifyubus.objectInvalid object contextFailed to remove objectInvalid deferred contextunsubscribesubscribeobject nameFailed to resolve object name '%s'Failed to %s object '%s'Invalid call contextrcodeReply has already been sentreplyInvalid file descriptorstatus_cbdata_cbInvalid timeout value: %sFailed to send notificationcallubus.connectionUnable to connect to ubus socketInvalid connection contextConnection is closedfd_cbFailed to invoke function '%s' on channelFailed to invoke function '%s' on object '%s'returnFailed to send request '%s' on channelArgument object is not string or integerFailed to invoke function '%s' on system object %devent idevent dataUnable to send eventnotify callbacksubscription patternsremove callbackEither notify or remove callback requiredFailed to register subscriber objectevent type patternevent callbackFailed to register listener objectSubscriber belongs to different connectionUnable to remove subscriberObject belongs to different connectionUnable to remove objectListener belongs to different connectionUnable to remove listenerUnhandled resource typesubscribe callbackobject methodsEither methods or subscribe callback requiredMethod '%s' field 'call' is not a function valueMethod '%s' field 'args' is not an object valueMethod '%s' field 'args' argument '%s' hint has unsupported type %sucode-ubus-%sUnable to add ubus objectsocketSTATUS_OKSTATUS_INVALID_COMMANDSTATUS_INVALID_ARGUMENTSTATUS_METHOD_NOT_FOUNDSTATUS_NOT_FOUNDSTATUS_NO_DATASTATUS_PERMISSION_DENIEDSTATUS_TIMEOUTSTATUS_NOT_SUPPORTEDSTATUS_UNKNOWN_ERRORSTATUS_CONNECTION_FAILEDSTATUS_NO_MEMORYSTATUS_PARSE_ERRORSTATUS_SYSTEM_ERRORSTATUS_CONTINUESYSTEM_OBJECT_ACLremovecompletedaborterrordeferget_fdset_fdnew_channelsubscribednotifyawaitrequestdisconnectlistpublishlistenersubscribereventconnectopen_channelguardsEtsEPzAPz!BXzBdzJtFlzEtzaA|zAzIzqHzCzeKPzBzNXzCdzJz1VtzaSlza#zRzUdtIWtzTz^Pzi]z\z9Zz9Ylza#zRlza#z5e{'{Q5f(pppooooooooxohoXoHo8o(ooonnnnnnnnxnhnXnHn8n(nnnmmmmmmmmxmhmXmHm8m(mmmllllllllxlhlXlHl8l(lllkkkkkkkkxkhkXkHk8k(kkkjjjjjjjjxjhjXjHj8j(j07070101AE23BA000081ED0000000000000000000000016A426C28000140AB000000FE0000000000000000000000000000001600000000usr/lib/ucode/html.soELF4t4 (pȅ000QtdRtd  J a H,  @Bppp p p&ppoooo& # " $  !%J J a  _" ``$````D`p```_P`u@`0`E `K`U`_"__:__o___p_`_"P_@_."U0_]A]" _fini__cxa_finalize__deregister_frame_info__register_frame_infomemset__ashldi3__lshrdi3_ucv_stringbuf_appenduc_vm_stack_peekucv_type_ucv_string_getucv_string_lengthucv_stringbuf_newucv_stringbuf_finishucv_is_truishstrncmpmemchrstrtoulucv_getuc_vm_stack_pushucv_int64_newucv_string_new_lengthuc_vm_calluc_vm_stack_popucv_put__stack_chk_guard__stack_chk_failstrncasecmpmemmemmemcpyucv_boolean_newuc_module_initucv_cfunction_newucv_object_adduc_module_entrylibgcc_s.so.1libc.soGCC_3.0GLIBC_2.0P&y ii   $(,0@P`pл 0@P`pм 0@P`pн 0@P`pо 0@P`pп 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p   0 @ P ` p            0 @ P ` p            0 @ P ` p            0 @ P ` p            0 @ P ` p          0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p   0 @ P ` p         !! !0!@!P!`!p!!!!!!!!!"" "0"@"P"`"p"""""""""## #0#@#P#`#p#########$$ $0$@$P$`$p$$$$$$$$$%% %0%@%P%`%p%%%%%%%%%&& &0&@&P&`&p&&&&&&&&&'' '0'@'P'`'p'''''''''(( (0(@(P(`(p((((((((()) )0)@)P)`)p)))))))))** *0*@*P*`*p*********++ +0+@+P+`+p+++++++++,, ,0,@,P,`,p,,,,,,,,,-- -0-@-P-`-p---------.. .0.@.P.`.p.........// /0/@/P/`/p/////////00 000@0P0`0p00000000011 101@1P1`1p11111111122 202@2P2`2p22222222233 303@3P3`3p33333333344 404@4P4`4p44444444455 505@5P5`5p55555555566 606@6P6`6p66666666677 707@7P7`7p77777777788 808@8P8`8p88888888899 909@9P9`9p999999999:: :0:@:P:`:p:::::::::;; ;0;@;P;`;p;;;;;;;;;<< <0<@<P<`<p<<<<<<<<<== =0=@=P=`=p=========>> >0>@>P>`>p>>>>>>>>>?? ?0?@?P?`?p?????????@' 'ra0nlM Pg@?e cea H0nLM@?ee0nLM0nlM0nlMjej @2ideA jjgikz+X7J03I@ ҂gp@@:eRe(`AAb`P0?eM@nPe@?ee("0Pnl M@8e* i@"OA"CR`#0HL@8eg@8ewdj @2idegC`&m\ggpPg@:eҞe\gP*gg@?ewdg@?eBeg@ lbgK[gNagY!a;ra\g0Aj H8e@oAeQ"\gA0 j Io@9ee#rBaA @eXgxr\gXaI%ng@:ege `@;ra\g0O@?e eB~ ng@:ege [g\gP@?e eg\gPg@?eej- @2iedgn0 I@9en9e@ PH e@:ere/aPD@:e"g0Xe @:eP@ e@:eT e@:eg0@JJ:e@g0eg@8exdjj @2iedm\ggpP@:e"ge" `_ r`JZ`I J |gA@0` DK "\g L@@:e*  o@:ee"j DA(  oM@ @:ee*g0 dL #\go0  mL@:ee"j[!r6aA@ \gn0p@@ M@:e @e*C@\g0DIoNg@:eg}" W oM @:ee_"Hj|g 00@,N"gI 9e o@gE eL` ogg@;ee?"\g0𠚐LMg@:ee"\g0𠚐LMg@:ee*j@ABC\g@g@:ee\g0@,Jj 7 og@:eAe\go0 P o g @:ee"\g 0@ JomtL@:ee\gn0𠚐LM@@:ee*G@J\g0DIo Ng@:eg" W oMB oҷ\g pPg>m@:eg o Wg @:ee"H g"r`'r@ag\g pP;A@:e"ge"  oMg@:ee_"A\g o0j LN g@:eEg@>rea `U`@/r ` og" ?`  og@:ee?*"@_ "  7\gg0@J4}dj @2iedg0@nJ@:eg PHe@:ere*aPD@:e"g0Xe @:eP@ e@:eg0@0Jg N@:e0eg@8ewdjj, @2iedgn0 I@9e 9en@"gPHe@:ere`jvdPHg@:eJZe`Pg@:eP ge@?e0Xe@:e"gP@e@:eg0@0 Jgj N@:e"gpD e@:e𬘞eg@=epeg@8ejL @2ideDggg-*A"`I_ r`JZ `Eg` s`K[a[g^ `0oJH@8edd jJoFi@ r`JZ`graA Za0PnM@8ej @2iedgX%gJjF  D@:e egp\g@:eJeJJ*PTlm@:e0𠘞egp\gM@:ePTelm@:e0𠘞egp\gM@:ePTelm@:e0𠘞egp\gM@:ePTelm@:e0𠘞egp\gM@:ePTelm@:e0𠘞egp\gM@:ePTelm@:e0𠘞egp\gM@:ePTelm@:e0𠘞egp\gM@:ePTelm@:e0𠘞egp\gM@:ePTelm@:e0peg8eM@gwdej @2iegd@?eDde%x #$%x !$%x  $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x  $%x  $%x  $%x  $%x  $%x $%x $%x $%x $' '<&'"><&>/'"> '"> "&'<>�&<--scriptstyle-->[CDATA[]]> TEXTRAWOPENATTRCLOSECOMMENTCDATAPROCINSTEOFtokenizestriptagsentitydecodeentityencodeAEligAMPAacuteAbreveAcircAcyAfrAgraveAlphaAmacrAndAogonAopfApplyFunctionAringAscrAssignAtildeAumlBackslashBarvBarwedBcyBecauseBernoullisBetaBfrBopfBscrBumpeqCHcyCOPYCacuteCapCapitalDifferentialDCayleysCcaronCcedilCcircCconintCdotCedillaCenterDotCfrChiCircleDotCircleMinusCirclePlusCircleTimesClockwiseContourIntegralCloseCurlyDoubleQuoteCloseCurlyQuoteColonColoneCongruentConintCopfCoproductCounterClockwiseContourIntegralCrossCscrCupCupCapDDDDotrahdDJcyDScyDZcyDaggerDarrDashvDcaronDcyDelDeltaDfrDiacriticalAcuteDiacriticalDotDiacriticalDoubleAcuteDiacriticalGraveDiacriticalTildeDiamondDifferentialDDopfDotDotDotDotEqualDoubleContourIntegralDoubleDotDoubleDownArrowDoubleLeftArrowDoubleLeftRightArrowDoubleLeftTeeDoubleLongLeftArrowDoubleLongLeftRightArrowDoubleLongRightArrowDoubleRightArrowDoubleRightTeeDoubleUpArrowDoubleUpDownArrowDoubleVerticalBarDownArrowBarDownArrowUpArrowDownBreveDownLeftRightVectorDownLeftTeeVectorDownLeftVectorDownLeftVectorBarDownRightTeeVectorDownRightVectorDownRightVectorBarDownTeeDownTeeArrowDownarrowDscrDstrokENGETHEacuteEcaronEcircEcyEdotEfrEgraveElementEmacrEmptySmallSquareEmptyVerySmallSquareEogonEopfEpsilonEqualTildeEquilibriumEscrEsimEtaEumlExistsExponentialEFcyFfrFilledSmallSquareFilledVerySmallSquareFopfForAllFouriertrfFscrGJcyGTGammaGammadGbreveGcedilGcircGcyGdotGfrGgGopfGreaterEqualGreaterEqualLessGreaterFullEqualGreaterGreaterGreaterLessGreaterSlantEqualGreaterTildeGscrGtHARDcyHacekHatHcircHfrHilbertSpaceHopfHorizontalLineHscrHstrokHumpDownHumpHumpEqualIEcyIJligIOcyIacuteIcircIcyIdotIfrIgraveImImacrImaginaryIImpliesIntIntersectionInvisibleCommaInvisibleTimesIogonIopfIotaIscrItildeIukcyIumlJcircJcyJfrJopfJscrJsercyJukcyKHcyKJcyKappaKcedilKcyKfrKopfKscrLJcyLTLacuteLambdaLangLaplacetrfLarrLcaronLcedilLcyLeftAngleBracketLeftArrowBarLeftArrowRightArrowLeftCeilingLeftDoubleBracketLeftDownTeeVectorLeftDownVectorLeftDownVectorBarLeftFloorLeftTeeLeftTeeArrowLeftTriangleLeftTriangleBarLeftTriangleEqualLeftUpDownVectorLeftUpTeeVectorLeftUpVectorLeftUpVectorBarLeftarrowLeftrightarrowLessEqualGreaterLessFullEqualLessGreaterLessLessLessSlantEqualLessTildeLfrLlLleftarrowLmidotLongLeftArrowLongLeftRightArrowLongRightArrowLongleftarrowLongleftrightarrowLongrightarrowLopfLowerLeftArrowLowerRightArrowLscrLshLstrokLtMapMcyMellintrfMfrMinusPlusMopfMscrMuNJcyNacuteNcaronNcedilNcyNegativeMediumSpaceNegativeThickSpaceNegativeThinSpaceNegativeVeryThinSpaceNestedGreaterGreaterNestedLessLessNewLineNfrNoBreakNonBreakingSpaceNopfNotNotCongruentNotCupCapNotDoubleVerticalBarNotElementNotEqualNotEqualTildeNotExistsNotGreaterNotGreaterEqualNotGreaterFullEqualNotGreaterGreaterNotGreaterLessNotGreaterSlantEqualNotGreaterTildeNotHumpDownHumpNotHumpEqualNotLeftTriangleNotLeftTriangleBarNotLeftTriangleEqualNotLessNotLessEqualNotLessGreaterNotLessLessNotLessSlantEqualNotLessTildeNotNestedGreaterGreaterNotNestedLessLessNotPrecedesNotPrecedesEqualNotPrecedesSlantEqualNotReverseElementNotRightTriangleNotRightTriangleBarNotRightTriangleEqualNotSquareSubsetNotSquareSubsetEqualNotSquareSupersetNotSquareSupersetEqualNotSubsetNotSubsetEqualNotSucceedsNotSucceedsEqualNotSucceedsSlantEqualNotSucceedsTildeNotSupersetNotSupersetEqualNotTildeNotTildeEqualNotTildeFullEqualNotTildeTildeNotVerticalBarNscrNtildeNuOEligOacuteOcircOcyOdblacOfrOgraveOmacrOmegaOmicronOopfOpenCurlyDoubleQuoteOpenCurlyQuoteOrOscrOslashOtildeOtimesOumlOverBarOverBraceOverBracketOverParenthesisPartialDPcyPfrPhiPiPlusMinusPoincareplanePopfPrPrecedesPrecedesEqualPrecedesSlantEqualPrecedesTildePrimeProductProportionProportionalPscrPsiQUOTQfrQopfQscrRBarrREGRacuteRangRarrRarrtlRcaronRcedilRcyReReverseElementReverseEquilibriumReverseUpEquilibriumRfrRhoRightAngleBracketRightArrowBarRightArrowLeftArrowRightCeilingRightDoubleBracketRightDownTeeVectorRightDownVectorRightDownVectorBarRightFloorRightTeeRightTeeArrowRightTriangleRightTriangleBarRightTriangleEqualRightUpDownVectorRightUpTeeVectorRightUpVectorRightUpVectorBarRightarrowRopfRoundImpliesRrightarrowRscrRshRuleDelayedSHCHcySHcySOFTcySacuteScScaronScedilScircScySfrShortDownArrowShortLeftArrowShortRightArrowShortUpArrowSigmaSmallCircleSopfSqrtSquareSquareIntersectionSquareSubsetSquareSubsetEqualSquareSupersetSquareSupersetEqualSquareUnionSscrStarSubSubsetSubsetEqualSucceedsSucceedsEqualSucceedsSlantEqualSucceedsTildeSuchThatSumSupSupersetSupersetEqualSupsetTHORNTRADETSHcyTScyTabTauTcaronTcedilTcyTfrThereforeThetaTildeEqualTildeFullEqualTildeTildeTopfTripleDotTscrTstrokUacuteUarrUarrocirUbrcyUbreveUcircUcyUdblacUfrUgraveUmacrUnderBarUnderBraceUnderBracketUnderParenthesisUnionUnionPlusUogonUopfUpArrowUpArrowBarUpArrowDownArrowUpDownArrowUpEquilibriumUpTeeUpTeeArrowUparrowUpdownarrowUpperLeftArrowUpperRightArrowUpsiUpsilonUringUscrUtildeUumlVDashVbarVcyVdashVdashlVeeVerbarVertVerticalBarVerticalLineVerticalSeparatorVerticalTildeVfrVopfVscrVvdashWcircWedgeWfrWopfWscrXfrXiXopfXscrYAcyYIcyYUcyYacuteYcircYcyYfrYopfYscrYumlZHcyZacuteZcaronZcyZdotZeroWidthSpaceZetaZfrZopfZscraacuteabreveacEacdacircacuteacyaeligafragravealefsymalephalphaamacramalgampandandandanddandslopeandvangangeangmsdangmsdaaangmsdabangmsdacangmsdadangmsdaeangmsdafangmsdagangmsdahangrtangrtvbangrtvbdangsphangstangzarraogonaopfapEapacirapeapidaposapproxeqaringascrastasympasympeqatildeaumlawconintawintbNotbackcongbackepsilonbackprimebacksimbacksimeqbarveebarwedbarwedgebbrkbbrktbrkbcongbcybdquobecausbecausebemptyvbepsibernoubetabethbetweenbfrbigcapbigcircbigcupbigodotbigoplusbigotimesbigsqcupbigstarbigtriangledownbigtriangleupbiguplusbigveebigwedgebkarowblacklozengeblacksquareblacktriangleblacktriangledownblacktriangleleftblacktrianglerightblankblk12blk14blk34blockbnebnequivbnotbopfbotbottombowtieboxDLboxDRboxDlboxDrboxHboxHDboxHUboxHdboxHuboxULboxURboxUlboxUrboxVboxVHboxVLboxVRboxVhboxVlboxVrboxboxboxdLboxdRboxdlboxdrboxhboxhDboxhUboxhdboxhuboxminusboxplusboxtimesboxuLboxuRboxulboxurboxvboxvHboxvLboxvRboxvhboxvlboxvrbprimebrevebrvbarbscrbsemibsimbsimebsolbsolbbsolhsubbullbulletbumpbumpEbumpebumpeqcacutecapcapandcapbrcupcapcapcapcupcapdotcapscaretcaronccapsccaronccedilccircccupsccupssmcdotcedilcemptyvcentcenterdotcfrchcycheckcheckmarkchicirEcirccirceqcirclearrowleftcirclearrowrightcircledRcircledScircledastcircledcirccircleddashcirecirfnintcirmidcirscirclubsclubsuitcoloncolonecoloneqcommacommatcompcompfncomplementcomplexescongdotconintcopfcoprodcopycopysrcrarrcrosscscrcsubcsubecsupcsupectdotcudarrlcudarrrcueprcuesccularrcularrpcupcupbrcapcupcapcupcupcupdotcuporcupscurarrcurarrmcurlyeqpreccurlyeqsucccurlyveecurlywedgecurrencurvearrowleftcurvearrowrightcuveecuwedcwconintcwintcylctydArrdHardaggerdalethdarrdashdashvdbkarowdblacdcarondcyddddaggerddarrddotseqdegdeltademptyvdfishtdfrdharldharrdiamdiamonddiamondsuitdiamsdiedigammadisindivdividedivideontimesdivonxdjcydlcorndlcropdollardopfdoteqdoteqdotdotminusdotplusdotsquaredoublebarwedgedownarrowdowndownarrowsdownharpoonleftdownharpoonrightdrbkarowdrcorndrcropdscrdscydsoldstrokdtdotdtridtrifduarrduhardwangledzcydzigrarreDDoteDoteacuteeasterecaronecirecircecolonecyedotefDotefregegraveegsegsdotelintersellelselsdotemacremptyemptysetemptyvemspemsp13emsp14engenspeogoneopfepareparsleplusepsiepsiveqcirceqcoloneqsimeqslantgtreqslantlessequalsequestequivequivDDeqvparslerarrescresdotesimetaetheumleuroexclexistexpectationexponentialefallingdotseqfcyfemaleffiligffligfflligffrfiligfjligflatflligfltnsfnoffopfforallforkforkvfpartintfrac12frac13frac14frac15frac16frac18frac23frac25frac34frac35frac38frac45frac56frac58frac78fraslfrownfscrgEgElgacutegammagammadgapgbrevegcircgcygelgeqgeqqgeqslantgesgesccgesdotgesdotogesdotolgeslgeslesgfrggggggimelgjcyglglEglagljgnEgnapgnapproxgnegneqgneqqgnsimgopfgravegscrgsimgsimegsimlgtccgtcirgtdotgtlPargtquestgtrapproxgtrarrgtrdotgtreqlessgtreqqlessgtrlessgtrsimgvertneqqgvnEhArrhairsphalfhamilthardcyharrharrcirharrwhbarhcircheartsheartsuithellipherconhfrhksearowhkswarowhoarrhomththookleftarrowhookrightarrowhopfhorbarhscrhslashhstrokhybullhypheniacuteicicircicyiecyiexcliffifrigraveiiiiiintiiintiinfiniiotaijligimacrimageimaglineimagpartimathimofimpedincareinfininfintieinodotintcalintegersintercalintlarhkintprodiocyiogoniopfiotaiprodiquestiscrisinisinEisindotisinsisinsvisinvititildeiukcyiumljcircjcyjfrjmathjopfjscrjsercyjukcykappakappavkcedilkcykfrkgreenkhcykjcykopfkscrlAarrlArrlAtaillBarrlElEglHarlacutelaemptyvlagranlambdalanglangdlanglelaplaquolarrlarrblarrbfslarrfslarrhklarrlplarrpllarrsimlarrtllatlataillatelateslbarrlbbrklbracelbracklbrkelbrksldlbrkslulcaronlcedillceillcublcyldcaldquoldquorldrdharldrusharldshleftarrowtailleftharpoondownleftharpoonupleftleftarrowsleftrightarrowsleftrightharpoonsleftrightsquigarrowleftthreetimeslegleqleqqleqslantleslescclesdotlesdotolesdotorlesglesgeslessapproxlessdotlesseqgtrlesseqqgtrlessgtrlesssimlfishtlfloorlfrlglgElhardlharulharullhblkljcyllarrllcornerllhardlltrilmidotlmoustlmoustachelnElnaplnapproxlnelneqlneqqlnsimloangloarrlobrklongleftarrowlongleftrightarrowlongmapstolongrightarrowlooparrowleftlooparrowrightloparlopflopluslotimeslowastlowbarlozlozengelozflparlparltlrarrlrcornerlrharlrhardlrmlrtrilsaquolscrlshlsimlsimelsimglsqblsquolsquorlstrokltccltcirltdotlthreeltimesltlarrltquestltrParltrieltriflurdsharluruharlvertneqqlvnEmDDotmacrmalemaltmaltesemapmapstodownmapstoleftmapstoupmarkermcommamcymdashmeasuredanglemfrmhomicromidmidastmidcirmiddotminusbminusdminusdumlcpmldrmnplusmodelsmopfmpmscrmstposmumultimapmumapnGgnGtnGtvnLeftarrownLeftrightarrownLlnLtnLtvnRightarrownVDashnVdashnablanacutenangnapnapEnapidnaposnaturnaturalnaturalsnbspnbumpnbumpencapncaronncedilncongncongdotncupncyndashneArrnearhknearrnearrownedotnequivnesearnesimnexistnexistsnfrngEngeqngeqqngeqslantngesngsimngtngtrnhArrnharrnhparninisnisdnivnjcynlArrnlEnlarrnldrnlenleftarrownleftrightarrownleqnleqqnleqslantnlesnlessnlsimnltnltrinltrienmidnopfnotnotinnotinEnotindotnotinvanotinvbnotinvcnotninotnivanotnivbnotnivcnparnparallelnparslnpartnpolintnprnprcuenprenprecnpreceqnrArrnrarrnrarrcnrarrwnrightarrownrtrinrtrienscnsccuenscenscrnshortmidnshortparallelnsimensimeqnsmidnsparnsqsubensqsupensubnsubEnsubensubsetnsubseteqnsubseteqqnsuccnsucceqnsupnsupEnsupensupsetnsupseteqnsupseteqqntglntildentlgntriangleleftntrianglelefteqntrianglerightntrianglerighteqnunumnumeronumspnvDashnvHarrnvapnvdashnvgenvgtnvinfinnvlArrnvlenvltnvltrienvrArrnvrtrienvsimnwArrnwarhknwarrnwarrownwnearoSoacuteoastocircocyodashodblacodivodotodsoldoeligofcirofrogonograveogtohbarohmointolarrolcirolcrossolineoltomacromegaomicronomidominusoopfoparoperpoplusorarrordorderorderofordfordmorigoforororslopeorvoscroslashosolotildeotimesotimesasoumlovbarparparaparallelparsimparslpcypercntperiodpermilperppertenkpfrphivphmmatphonepipitchforkpivplanckplanckhplankvplusacirplusbpluscirplusdoplusdupluseplusmnplussimplustwopmpointintpopfpoundprprEprapprcuepreprecprecapproxpreccurlyeqpreceqprecnapproxprecneqqprecnsimprecsimprimesprnEprnapprnsimprodprofalarproflineprofsurfpropproptoprsimprurelpscrpsipuncspqfrqintqopfqprimeqscrquaternionsquatintquestquesteqquotrAarrrArrrAtailrBarrrHarraceracuteradicraemptyvrangrangdrangerangleraquorarraprarrbrarrbfsrarrcrarrfsrarrhkrarrlprarrplrarrsimrarrtlrarrwratailratiorationalsrbarrrbbrkrbracerbrackrbrkerbrksldrbrkslurcaronrcedilrceilrcubrcyrdcardldharrdquordquorrdshrealrealinerealpartrealsrectregrfishtrfloorrfrrhardrharurharulrhorhovrightarrowtailrightharpoondownrightharpoonuprightleftarrowsrightleftharpoonsrightrightarrowsrightthreetimesringrisingdotseqrlarrrlharrlmrmoustrmoustachernmidroangroarrrobrkroparropfroplusrotimesrparrpargtrppolintrrarrrsaquorscrrshrsqbrsquorsquorrthreertimesrtrirtriertrifrtriltriruluharrxsacutesbquoscscEscapscaronsccuescescedilscircscnEscnapscnsimscpolintscsimscysdotsdotbsdoteseArrsearhksearrsearrowsectsemiseswarsetminussetmnsextsfrsfrownsharpshchcyshcyshortmidshortparallelshysigmasigmafsigmavsimdotsimesimgsimgEsimlsimlEsimnesimplussimrarrslarrsmallsetminussmashpsmeparslsmidsmilesmtsmtesmtessoftcysolbsolbarsopfspadesspadesuitsparsqcapsqcapssqcupsqcupssqsubsqsubesqsubsetsqsubseteqsqsupsqsupesqsupsetsqsupseteqsqusquaresquarfsqufsrarrsscrssetmnssmilesstarfstarstarfstraightepsilonstraightphistrnssubEsubdotsubesubedotsubmultsubnEsubnesubplussubrarrsubsetsubseteqsubseteqqsubsetneqsubsetneqqsubsimsubsubsubsupsuccsuccapproxsucccurlyeqsucceqsuccnapproxsuccneqqsuccnsimsuccsimsumsungsupsup1sup2sup3supEsupdotsupdsubsupesupedotsuphsolsuphsubsuplarrsupmultsupnEsupnesupplussupsetsupseteqsupseteqqsupsetneqsupsetneqqsupsimsupsubsupsupswArrswarhkswarrswarrowswnwarszligtargettautcarontcediltcytdottelrectfrthere4thereforethetathetasymthetavthickapproxthicksimthinspthkapthksimthorntildetimesbtimesbartimesdtoeatoptopbottopcirtopftopforktosatprimetradetriangletriangledowntrianglelefttrianglelefteqtriangleqtrianglerighttrianglerighteqtridottrietriminustriplustrisbtritimetrpeziumtscrtscytshcytstroktwixttwoheadleftarrowtwoheadrightarrowuArruHaruacuteuarrubrcyubreveucircucyudarrudblacudharufishtufrugraveuharluharruhblkulcornulcornerulcropultriumacrumluogonuopfuparrowupdownarrowupharpoonleftupharpoonrightuplusupsiupsihupsilonupuparrowsurcornurcornerurcropuringurtriuscrutdotutildeutriutrifuuarruumluwanglevArrvBarvBarvvDashvangrtvarepsilonvarkappavarnothingvarphivarpivarproptovarrvarrhovarsigmavarsubsetneqvarsubsetneqqvarsupsetneqvarsupsetneqqvarthetavartriangleleftvartrianglerightvcyvdashveeveebarveeeqvellipverbarvertvfrvltrivnsubvnsupvopfvpropvrtrivscrvsubnEvsubnevsupnEvsupnevzigzagwcircwedbarwedgewedgeqweierpwfrwopfwpwrwreathwscrxcapxcircxcupxdtrixfrxhArrxharrxixlArrxlarrxmapxnisxodotxopfxoplusxotimexrArrxrarrxscrxsqcupxuplusxutrixveexwedgeyacuteyacyycircycyyenyfryicyyopfyscryucyyumlzacutezcaronzcyzdotzeetrfzetazfrzhcyzigrarrzopfzscrzwjzwnjtKKa[b5[bT bP0b8b&hhhh"hhh h h"h>he"i"ig"(i*8iw"Di~*Xis"hipik"ti*|ii^i$i !i !i !i%i !i&iN"iO"ii2ijjjj0j! j(j!,j*4jH!@j!Hj,"c+"Lj"\jc ljb |j.j@jj!j(jjj4jj jAjjjj%j jj6kk kBkk $k<(k90k8k'@k!Lk!Tk=\k;dkhk'(m!|k!k!k#k'ka)k!kY)k #8m!fN)l" l!fZ)l",l) s# s#,s#"d{3>"h{?"l{t{|{0{a {{{5!{5!{{{?*{&{'"{U*{\*{X*{Z*{ "{)t "{!"{)|)|) |),|)8|)D|)P|)\|"d|"l|)x|""|||#||R|dH"|p*|o*|J"|K"|'H"|J"|||*|H"|M"||}3" }*}*}L"(}4}5 @}="H}"T}"\}#d}#p}#x}#}L"}1} }5"}5"})}},!}}6!}l"}}"}%}"}*}*~*~* ~&(~%8~%H~*T~"\~"h~ )p~)~%~%~%~%~%~#$~%~%~%~% = a" #S" "("0W%8T%@V%HS%PP%Xf%`i%hd%pg%x]%Z%\%Y%Q%l%c%`%k%b%_%)U%R%% %%e%h%,%4% ","4"@[%HX%P%X%`%hj%pa%x^%<%$%%5 O ="Ȁ"Ѐ\؀)'" " N"* O"O"$)"(D*0I*<K*DG*L@*T)"\A dlM*t | L*P* )ȁ ́Gԁ'܁'@%)W"!!(4$@"L"X"dW"l*x*)c&c&:T"T",@Ă"̂"Ԃ"! }E"m*."T" !!$',4*<*D*L*T"\8)d5)l"t"|!=)*"H*F*J*"E**"ă!̃<)ԃ"""" !!,"4"<2"H1"P-#X!`e)h p8!x! ")4F!! !w*Ȅ̄Ԅ)܄)!!!""f&f& ("04<"L"TR\#d #l$tU||P"Q"8"""#!̅!܅!!) # #$U,)4<"D%L%T!\o)d)l_t'w*Q"n*V"U"MĆLfG!̆R"Ԇ"؆*܆***#!** ""("0 8 @ HKL T\Vd"l)tq*|,}V"U"B"**=ć_"̇a"ԇx*܇)cS"q)/!P"B"  !("00!<G!LR"\D`@&hpx#jfm&%W"Ĉ"̈*Ԉ *S!U!Y![!T!V! (W!0\!8X!@Z!H]!P^!XD `"#hpg"t*x*3!e""e"g"~*ĉ~*ȉ*Љ*؉**"*$k""7!Sw"* *$*(i",*4*@*D*Li"T"\Xd`l !ts"|**>*z*")|**x)Ȋ"Њ"܊*w"s"i"i" ! $ !,J4!<H)D!L!T%\e&de&p& x"%%)&)!;"!!̋Yԋ ܋!'C   c 85$,!0&4<H!@ *H-"P)X)!`3h+p!x!!1"T"!")Č1+"̌"Ԍ$!"*<*Q/Z <*(08"@"H"P"X"`"hb l)tV|59'7[XTč̍7ԍ:؍(܍8E\\! !))$f"(*,b)4:<)H!PX'`)h'p*t|!!))!!9)s)!Ď*Ȏ)Ў*؎* )r'{[)))> <(#0{8;<6)D L Tg)\K)h!dd"\m!p!!!!lm!!!ԏ!""d"f"}*}** *(*0*<"D*L*X"`"l*xv"r"|) #)v"*!!j)%ĐYhj"̐!Ԑ#k)%@## h"**$*(*0h"8"@'H!P'X'h'|''!!)]ȑ-*Б4*ؑ"_%%)() !# !(m)0 4"<9 DL!Pr"X*`*h[p x B(<*y*"""v){*)T%Ȓ"В%ؒJ)f)h"h":"B& ' '(!!,!8!D!P%X)*`<d l!"|*'!#"**""8"***ȓ& Г"ؓ"^">"" "8" k"8k"$!0!@8"D j"H8j"P!\"d"l"tD| "I"8p*8K"I$I"n&n&!Ĕ8N"̔8O"ԔC*ܔHFG"8m*B*=  P`"!$)$!,!48P"<b"D()L8B"T"\"d+h8g"q"lq"t8g"|8~*8~*u"o"o"!!* ""ĕ"̕ "ЕZؕ!8f"!% p"!!p"8f"$8}*08}*8n"@t"Hn"L"T"\$"d_lp "x8"8" """ " """Ė&"̖&"ؖ *8"*""8*" 8*!!$83),8!4!@"H"P"T"\8*dl$"x&"<A"D"D"$"&""""8*ȗ"З "ؗ"8*"8*"8*" " ",8*8y"@Hx"P"`"p""#! ") M"Ę"̘ e"Ԙ >ܘ)) d" < ") " <"!$#),!4!<')D$HP"x"X`>d"lQt8*|")S),))."ș!Й)ؙ)> )M) "`)$),"8u("4!<]*@4!H4!PX`"hV*pW*x[*|4!""6*=#%"Ě̚%"ؚ**"?%.0 " 1 -T 3!(&04"@D!L!T!~+\#*h"p"*x"%*r*&*'**ațz"̛*Л*؛|"*z"*|"* **$"0~"8}2 8!@*H*P"X"`.#l#x#""~"" . *Ĝb̜W Ԝܜ !*?_""!!) )(d)01="8U@"H)T'\)d)l'tx!|u)! )3))!!E)t)ĝ!̝!ԝ)ܝ6"! )s'}])) )(Y0W8 #@}H@L7)Ti)\ d l!t!|!!!%}) #/!!Ȟl)ОԞm!ܞ!!!! !4!؏!H"X`S"p!x! ##*'!')cȟ.*П5*؟))*!:  !]  ("0"8%@"H%P)\h)d!h[p x{"|**a}"*_]**"Ġ*Р"ؠAܠ""f*!%)! !;$)),"8"@6'H0L"#To&\IdHl#"x%"H<"j*C"L}C"**ġ*̡*ԡF"ܡ$*r)!"3* )#" ##(*,*4*<L/D)L?#Td\`&d`&p%"x"""""""""Ȣ"Т"ܢ"%%%%! "##$",&4&<LX"`*h*p"x***"*y)""*ȣ"ԣ****{"* }"* *,*8"D"L"Pj&X"\dlt*|**"*'*{)**Ĥ"̤*Ԥ"ܤ"*"* ***$!,&)4!<!D*)LT#\|}#`ehcpBt |#14"4"H"ĥ<"Х إH"<"D"1* 0*-"()" 6#(*0e8*@))H4 P"!X%d%t%"\"%"%Ȧ\"Ц:*ܦ9*);*#F[g l"(!<!P!Xc)`h!p^xmC!qn)~)2!!ȧ%Ч#ا##%ksf!!$!4!D"LT\d!p#x##o%"i%%Ĩ!̨Ԩ)ܨ!**")"(08"D!LT`"p*"*""Щ2ԩ"ܩ(""Z""||3 " " "$g,"4"<D*L"T*\"d)lut_*|'"Y"!4h!@"@""%Ȫ"Ъ%ت5ܪ'''''"*i *(*0'8'@H*P*X%`"h"pxOwK6WjNzī~̫7Ы|ث(!76!k  @```````p```P`@`0` ```________p_`_P_@_0_A]@07070101AE23C7000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001300000000usr/lib/ucode/luci07070101AE23C8000081ED0000000000000000000000016A426C2800004136000000FE0000000000000000000000000000001B00000000usr/lib/ucode/luci/core.soELF4t4 (p888pPPP55h?hOhOhhhQtdRtdh?hOhO  1hOlO  Pp @ppp pp>p!pooP oo %>"17  .&':+=$3 4(%*/ ;,#6)-!8<5029    1 Q" bU1Fp1J`1wP1>@1^01 11T10+ }0k0o0U000n0p0e`0P0D@0g00t 0080v/0/!/#/"(////p/`/P/P@/0/+9  /+ /C/M.".".[.'.a" ?.._fini__cxa_finalize__deregister_frame_info__register_frame_infouc_vm_stack_peekucv_type_ucv_string_getstatvfsucv_object_newucv_uint64_newucv_object_add__stack_chk_guardsysinfoucv_array_new_lengthucv_array_pushucv_int64_new__stack_chk_failunameucv_string_newucv_int64_getkillucv_boolean_newsetgidgetgidsetuidgetuid__errno_locationcryptgetpwnamgetspnamucv_string_lengthucv_uint64_getucv_string_new_lengthucv_getuc_vm_stack_pushuc_vm_calluc_vm_stack_popucv_putuc_module_initucv_cfunction_newuc_module_entryntohlsnprintf__stat_time64openmallocfcntlmmapclosemunmapfreestrncmpopendirclosedirreaddirfnmatchpluralParseFreepluralParseAllocpluralParselibgcc_s.so.1libc.soGLIBC_2.0ii hOlOpOtOxO|OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO4Q' '< Ü'!'@Q@ @ D܀@܀ 5$$@Q '<œ'!$@$DQ$ 5$jx @2idҚe `\gMX@:eDdjej8 @2iedgXnJ:e@$ggҐ\e@:ere`iQgrdpX@:egHe@:eJe"Lg@:e"g@em@:e𸘞egLMg@:e@ em@:e𸘞egLMg@:e@ e@:e𸘞egLMg@:e@ e@:e𸘞egLMg@:e@e@:e𸘞egLMg@:e@e@:e𸘞egLMg@:e@e@:e𸘞egLMg@:e@e@:e𸘞egLMg@:e@em@:e𸘞egLMg@:e@em@:e𸘞egLMg@:e@em@:e eMgg@8eej @2ie dg0L@ WP@:eJe "L@:e"gXem@:e@ em@:egP@e@:e@ em@:egP@e@:e@ em@:egP@e@:eT em@:e𸘞egLMg@:eLe&Mg@:e@ em@:e𸘞egL&Mg@:e@em@:e𸘞egL&Mg@:e@em@:e𸘞egL&Mg@:e@em@:e𸘞egLFMg@:e@em@:e𸘞egLFMg@:e@em@:e𸘞egLfMg@:e@@em@:e𸘞egLf Mg@:e@em@:e𸘞egLfMg@:e@em@:e𸘞egLMg@:e@em@:e𸘞egL Mg@:eeW`n"@8eiQg ~djW @2ie0dg0L$g@k ҂gH@:eJev"Lg@:e"gDe@:e𸘞egLMg@:eBDe:L@:e𸘞egLMg@:eBDe{L@:e𸘞egL Mg@:eBDe@:e𸘞egLMg@:eDeJ@:e𸘞egLMg@:eek`n"@8eiQg0xdej7 @2iedgn8ҁI@9e 9en@"g\e@:ere`jvd\g@:ereap\@:ep\eg@:egXe@:eZeg@8eej @2iedgXnJ@:eg"g\e@:ereap\g@:egHe@:eZeg@8eudjj @2iedg0\@:ee8eg@mddej @2iedgXnJ@:eg"g\e@:ereap\g@:egpHe@:eZeg@8eudjjw @2iedg\@:ee8eg@mddejW @2iedgn8ҁI@9en9e@ \e@:ere`jwd\ @:erXge*D@:e"g@pXe@:epXe @:egPe@:ege"@*@8ej @2iedgXnJ@:eg Ґ\e@:ere`jwdpX @:egTe@:e"ge"L@:eDe@:e𸘞egLM@:eDe@:e𸘞egLM@:eTem@:e𸘞egL M@:eTem@:e𸘞egLM@:eDe@:e𸘞egLM@:eDe@:e𸘞egLM@:eDe@:e eMg@8e_j @2iedgXnJ@:eg Ґ\e@:ere`jwdpX @:eg@e@:e"ge"L@:eDe@:e𸘞egLM@:eDe@:e𸘞egLM@:eTe5@:e𸘞egLM@:eTe5@:e𸘞egLM@:eTe5@:e𸘞egLM@:eTe5@:e𸘞egLM@:eTe5@:e𸘞egL M@:eTe5@:e eMg@8eBejV @2iedgn8ҁI@9e9en@ "g\ e@:ere`jwd)pX @:eP e@:eҞe)P @:e\g@:ere`Dg@:eg0@@:eegm@8eej @2iedgn8 ҁI@9en9e@ n9e@n9e@ \e@:e re`j~d\@:e reaO,p\ @:e pXe@:e Pe@:e pXe@:e Pe@:e pXe@:e"g Pe@:e0D @:e e*@8e\@:e re`ejV @2iedgn8ҁI@9en9e@ \ e@:ere`jyd 3,pX @:eP e@:e pXe @:e"gP e@:eg 0H g@:ee* @8e\@:ere`j @2iedgX0옃Jg?e@ge8e@lddjV @2ie dgҰXgm:e@'gg@e@:e옞e?eg@g@ em@:e옞e?eg@gH e@:e옞eg?e@gPemng@:ee *Dg@:e0eg@8eudj @2iedgXnJ@:eҞe*L0P@:eZeg@8eedg\@:ere a"pX@:egjj6 @2iedgXnJ@:eҞe*L0@=eel@8eedg\@:ere a"pX@:egjej @2iedgn8ҁI@9e n@9ee,%,,*8IpX@:eg0Xg@:eZeg@8e \@:ere`jvd\@:ere`pX@:e"geej @2ied$ F:Z&/Ji*u `M dS'kWKH1 5YN!.Q(#v4La0@rc-t[CUjlT2G7)"s=Re,hE6OI_?9\3D8<^p]PVoXbnfqgm P"  Y R" |YlY\Y)LY `\@:ee6"D@:e5e@gno@:e@ e"gpD@:eeҐP m@:e0e @=eej m@8ej @2iegd؟N O@?eDdej @2iegd؟N O@?eDdej @2iedgp@%g@:ep@eg@:e8ee@gvdjz @2iedgP @&g/XnJ@:e j XJg@:eҞe"@* lmDL @:ereap@ @:e"gH e@:ereFaT𸘑gM@:ee/* pL@:eeaB"g|+0 @=eDe@:e5eX@:e𸘰eMg@?eei /`n "p@8er^aT𸘑gM@:ee*i  nDm@:eU\ e@:e Ҟe *0 @=ee lm 1 C` Ca `C`^`T @:e  eE*H g@:e0 e=e@"gera0H @:eebL @:ere.apH @:eSe"g`+!PLlg@:ege Ҟ"gmD@:e"g\e@:ee".lQgzdj @2iegd؟NcO@?eDdej @2iegd؟NcO@?eDdej @2i $de\gPP@:eDdejy @2iedgXJM:e@$ge", lmX@:e𸘰eMgg@8ejud0\@:egJe *D@:e5e5@8ej @2iedgXnJ@:eX JM@:e"gLe@:ere`lXm@:e𸘰 eMg@8ejvd!@* lpH@:e였e?e@gPel@8ej9 @2iedgXJM@:ee"@*lmX@:e𸘰 eMg@8ejvdD@:e"gj@ِHe@:ee*5PB L@8eej @2i $de\gX@:eDdejy @2iedgXJM@:ee""g, lmX@:e𸘰 eMg@8ejudX@:ek`aBe +D@:e5elL,C4m1JZ`5@8elj @2idegg&g%pX@:ege"gg@8egud Ggjy @2iedgP\ @:eJe*D@:e5eX@:e𸘰eMg@8ejxdP M@:e"ge*D@:e P@ e@:eP@ e@:ege#5P M@:eҞe*D@:e@Heg@:eP@ e@:ee5Tm@:egX8J$Ig9e@ ҢgPe@:e @9eeg@8eej9 @2iedgn8ҢI@9en9e@ Le@:ere`lmX@:e𸘰eMg@8ejwdpH@:e"ge+R` lL @:ereap@ @:egePg@:eeg*D@:e5eM$HM@8ej9 @2iedgXnJ:e@$gg Le@:ere`lmX@:e𸘰eggM8e@iQgwdp@ @:egpXem@:eҞe *D@:e5ePH@:e0e8e@"gjy @2iedgn8ҢI@9e9en@ 9en@ "gL e@:ere`lmX@:e𸘰eMg@8ejyd/!Lg@:ereapHg@:e"gep@ @:eg\e M@:e Ҟe *D@:e5ei+ b$L@:ereZ`@@:e Ҟe*D𘘠PT L@:ep e@8ejP@ :e@o QAe aB` Pm@:e Ce`D@:e e @=eeH @:ee=!g#5Xi /$Q$`H @:e"gep@ @:egP emg@:e#e`D@:e eH@:e#eajiҽipm@8e)ejX @2iedgn8ҢI@9e9en@ "gL e@:ere`lmX@:e𸘰eMg@8ejxd/!Lg@:ereapHg@:eep@ @:eg\eM@:e Ҟe *D@:e5ejK\@:e"gZe `P nom@:ee,"RaZajAoBnUPg@:eAs@ّD emg@:eaMaec`\ @:e𨘞e" @=e񴘞eg@=eeSaKҵ @=eaBekR\g+Ma@i`aBcaC`M`k`AJAI`P g@8eaKa>Hng@:eeej8 @2iedgn8ҢI@9e n9e@Le@:ere`lmX@:e𸘰 eMg@8ejvd$L@:ereap@@:eie&*p@@:egLeg@:eJe*D@:e5ews`xS `fs`rsakmJ`+xsakkPl@8ej8 @2iedgPH @:eaBe+D𘘠PT L@:ep e@8eedej @2iedgXnJ@:e Ҟe"gL@:ere`lmXi@:e𸘰eMg@8eQgxdp@ @:eH e@:eZeFaJQ𸘰T M@:eZeXg \g8IC"gPX/m@:e." &" M@9eeT @:ege1*0 @=eDe@:e5ej+M "+ M+MKM@9eePH@:e0 e8e@"gyjx @2iedgXnJ@:e Ҟe"gL@:ere`lmX@:e𸘰eMg@8ejxdp@ @:eH e@:eZeMaJQ𸘰T M@:eZeXg \g8IJ"gPX/m@:e5" -" M@9ee@ @:e "gJe5*D@:e"g@re`0@=ee5j+M "+ M+MKM@9eeD@:e0 e@=ePeKMg@:eeg*P@g@:eDe@:ee$HM@8eJej @2iedgXnJ:e@$ggLe@:ere`lmX@:e𸘰eMgg@8ejvdp@@:egDe@:eJe *D@:e5ePl@8ej @2iedgXnJ:e@$ggLe@:ere`lmX@:e𸘰eMgg@8ejvdp@@:eg@e@:eeg *D@:e5eM$Hg@8ejW @2iedgn8ҢI@9en9e@ L e@:ere`lmX@:e𸘰eMg@8ejxdL @:eZebg`jFkl"p@ @:eg@e@:e Ҟe *D@:e5e@@:eҞeH @:ee*PP @:e𸘐e#M@8e'B𸘰T IMg@:ee"T𸘑gKM@:ee"L @:ekn e*DnogL@:eer`PHg@:egPe@:eeL@:ereap@ @:egTegn@:eeejw @2ideg X$nm@:eieJa@@:eҞei CPa@8e0XJg@:egLe@:ere`@=eXelm@:e𸘰eMg@8ej{dp@@:eYgkgHne5n@:eIe (2IIPH@:egPe@:eeejw @2iedgn8ҢI@9e n9e@Le@:ere`lmX@:e𸘰 eMg@8ejvdL@:ereap@@:e"gp@e@:egPPeg@:ee "D@:e5ePl@8eej @2iedgn8ҢI@9en9e@n9e@Le@:ere`lmX@:e𸘰eMg@8ejwd ҂gL@:ere `r$`M"D@:ekepH @:eSeaK'+Z$`D@:e"ke`ڀ5p@ @:egLe@:ee*D@:ekeB"g ҂gL@:ere `r0`*jKjKpH @:eSeaK+Zap@@:egpPeg@:eJe*D@:eep@ @:egp\e@:ee"BPl@8e`j @2iedgn8ҢI@9e9en@ "gL e@:ere`lmX@:e𸘰eMg@8ejwdLg@:ereap@ @:epHeg@:egp@e@:eJe *D@:e5ePl@8ej @2iedg𸘐X$gKM@:eDe@:ej@Le@:eJZe+`pT@:e옢g?ee@gpTe@:e옞eg?e@gPXemng@:ee"jKwdp@8e"g @* *QaQgLg@:egpHe@:e e 8e@"gej @2iedgXnJ:e@$ggLe@:ereap@@:eg0Te@:eJe/*D@:e5eXJg@:egJe*lmX@:e𸘰eMgg@8ejvdXPl@8ej6 @2idejgiJJ\g@:e"ge*0@=e lemX@:e𸘰 eMg@8ejvdgP@:ee*D@:e@"re`0𴘑g@=ee5PHg@:e0eґg@8ejv @2iedgn8ҢI@9e n9e@Le@:ere`lmX@:e𸘰 eMg@8ejvdL@:ereap@@:e"gp@e@:eg@eg@:eJe *D@:e5ePl@8ej @2iedgXnJ:e@$ggLe@:ere`lmX@:e𸘰eMgg@8ejvdp@@:egLe@:eJe *D@:e5ePl@8ej @2iedgn8ҢI@9e9en@ "gL e@:ere`lmX@:e𸘰eMg@8ejwd !Lg@:ereap@ @:eҞe!pHg@:egePD@:eJe *D@:e5emPl@8eej @2iedgX&gJn@:eg Le@:ere`lm-!$p@ @:eg @9eJe!*D@:e5eXi@:e𸘰6eMg@8eQg{d0,0@6@:e"ge* l0@6@:eҞeJ" lL kB2lMXm@:e𸘞egPTkM@:e 3r3@2mkKklMXem@:e𸘞egPTkM@:ePTekMg@:ee0@6@:eҞe " j4LPD@:e𸘞egPTkM@:ej 4LPDe@:e𸘞egPTkM@:ej 4LPDe@:e𸘞egPTM@:ej LPDe@:e𸘞egPT M@:e PDe4@:e𸘞egPTM@:ej 4LPDe@:e𸘞egPTM@:ej 4LPDe@:e𸘞egPTM@:ej 4LPDe@:e𸘞egPTM@:ej 4LPDe@:e𸘞egPTM@:ej 4LPDe@:e𸘞egPTM@:ej 4LPDe@:e𸘞egPTM@:ejLPDe@:e𸘞egPT M@:ePTeMg@:eeX@:e𸘞egPT Mg@:elLXem@:e𸘞egPT Mg@:eXem@:e𸘞egPT Mg@:eXem@:e𸘞egPT Mg@:eXem@:e𸘞egPT Mg@:eXe@:e𸘞egPT+Mg@:e Xe5@:e𸘞egPT+Mg@:eX"#e@:e𸘞egPT+Mg@:eX$%e@:e𸘞egPT+Mg@:eX()e@:e𸘞egPTKMg@:eX,-e@:e𸘞egPTgKM@:eegkLKLsPHaKL@:ePegg@8ejsakLsak L sakLsakLsa Lsa𘘋L𘘋 Lj @2ide\gnXJ@:eDdj @2ide\gnXJ@:eDdju @2iedgXnJ@:eg Le@:ere`lmX@:e𸘰eMg@8ejwdjiJJҢg\g@:e"ge *0@=e lep@ @:egDeg@:egJe*0𴘑g@=eDe@:e5eB`Hg@:e0eґg@8eju @2iedgn8ҢI@9e n9e@Le@:ere`lmX@:e𸘰 eMg@8ejvdp@@:e"gLe@:ereap@@:egeHg@:eeg*D@:e5eM $HM@8eej @2iedgn8ҢI@9e n9e@8I @9eJe*D@:ee, lX5@:e𸘰 eMg@8ejvd @9egJe"X@:eJe*D@:eePl@8eej @2iedgn8ҢI@9en9e@ n9e@ L e@:ere`lmX@:e𸘰eMg@8ejxdL @:ere`ap@ @:e@wre[`xR`ar[`rraijaB@U* d"gL@:ereapH @:ee  -"gp@@:egP\em -@:eRe"gagP@:eeg4*D@:e@P@eg@:ee5XJҫiji Ier `xr`+r`KjM jj$HM@8ehj @2ie dg0@l:e@'g,1e)(Bn * @8evd@gpD@:eegPT@:eQgeej @2ide$g$gpT@:eReag@8eudjT @2iedgXJM@:ee""g,X lm@:e𸘰 eMg@8ejudPP@:ePje@l@8eej @2iedgX$gJ@:ee", lmX@:e𸘰eMgg@8ejudpT@:egJe *D@:e5e5@8ejT @2iedgX JM@:eDdej @2iedgX JM@:eDdej @2iedgX$gJ@:ee", lmX@:e𸘰eMgg@8ejud@@:eJe *D@:e5ePl@8ejt @2iedgX JM@:eDdej4 @2iedgX JM@:eDdej @2idŜe2fL2I\g0X@:eDdej @2iedgX J8MI@:en9e@n9e@n9e@ n @9e j e* lmX@:e𸘰eMg@8ejydpT@:e Je"L@:ere`lL @:ereaL @:ereaH@:eH e@:e H e@:e reY`Z1`r`raL @:ereaT @:e"ggHe@:e񬘑ge=e@De:e@eD$5xraL @:ereaH @:e"gp@e @:egHeg@:e Ҟe L @:ereaH @:e"ge p@@:eeg,PLl M@:ee*D𘘠PT L@:ep e@8e0kCl `p@ @:eeg ! 1@@5 @2M 1ML-@:egT e`񬘂g@=eDe@:eekin*p5@8eej @2iedgX%g JM@:eXJng@:eg e* lmX@:e𸘰eMg@8ejwdL@:ere`lp@ @:eie`+pT@:egXeg@:eRe`D@:e5eus`vS`ns `ssakmJxsakkkPl@8eej @2iedgX JM:e@$gXJng@:ee* lmX@:e𸘰eMgg@8ejwd0"gL@:ere`lpH@:eҞe pT@:egp\e @:eRe`D@:e5ej Pl@8eej @2iedgX JM:e@$ge* lmX@:e𸘰eMgg@8ejudgP@:egJe *D@:e5e5@8eejs @2iedgXJM@:ee""g,X lm@:e𸘰 eMg@8ejudH@:ePje@l@8eej @2iedg8jMI@𤙂g pDI@:e egPT@:eJJe*X8ؘ IDJ9eNM@oXؘD J9eMNM@oXؘiJ o9emNM@"g0DgTe@:e𸘞egPTM@:eDgTe@:e𸘞egPTM@:eDgTe@:e𸘞egPTM@:eXelm@:e𸘞egPT M@:eXelm@:e𸘞egPTM@:eXelm@:e𸘞egPT M@:eXelm@:ePe8eM@gwdej @2iegd0@?eDde%x v$%x u$%x t$%x s$%x q$%x p$%x o$%x n$%x l$%x k$%x h$%x g$%x f$%x e$%x d$%x c$%x b$%x a$%x _$%x ^$%x ]$%x \$%x [$%x Z$%x Y$%x X$%x W$%x V$%x U$%x T$%x S$%x R$%x Q$%x P$%x O$%x N$%x M$%x L$%x K$%x J$%x I$%x G$%x F$%x E$%x C$%x A$%x @$%x ?$%x >$%x =$%x <$%x ;$%x :$%x 9$%x 8$%x 7$%x 6$%x 5$%x 4$%x 3$%x 2$%x 1$%x 0$%x /$%x .$%x -$%x ,$%x +$%x *$%x )$%x ($%x '$%x &$%x %$%x $$%x #$%x !$%x  $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x  $%x  $%x  $%x  $%x  $%x $%x $%x $' 'fs.filefs.last_error./fs.proclineallfs.dirrwOut of memory XXXXXX%s%s.XXXXXX/tmp/%s/tmp/%s.XXXXXX/tmp/XXXXXXr+..filenomajorminordevsetuidsetgidstickyuser_readuser_writeuser_execgroup_readgroup_writegroup_execother_readother_writeother_execperminodemodenlinkuidgidsizeblksizeblocksatimemtimectimefiletypedirectorycharblockfifosocketunknownstdinstdoutstderrIOC_DIR_NONEIOC_DIR_READIOC_DIR_WRITEIOC_DIR_RWopenfdopendup2opendirpopenreadlinkstatlstatmkdirrmdirsymlinkunlinkgetcwdchdirchmodchownrenameglobdirnamebasenamelsdirmkstempmkdtempaccessreadfilewritefilerealpathpipereadseektellclosewriteflushisattytruncatelockioctldY[9F[%[mE\0\}D\qC\IC$\!C,\ <4\e;<\:D\Q0L\9T\8\\7d\a5l\4t\q3|\\-\1\}.\ -\+\)\}'\&\q$XZO\"\"\q!\HY\ \\u\\uP]JXZIY ]]N ]M(]!K\!\\}#]JXZIYqP|YlY\YLYX9R+"6Q0I]^,5=_CW`MVE\Z& )k2" &  " |;ld\LL<,t slܢ̢ z|l\L<,9 EDOܡ̡ak|cl\L<, zܠR̠jr%|NlD\L <,&" tMܟ̟|ClR\4L<, "'ܞ̞."\-_|lX\L<4,{_fini__cxa_finalize__deregister_frame_info__register_frame_infoucv_array_setuc_vm_stack_peekucv_typeucv_int64_get__errno_locationucv_array_getucv_array_lengthmemsetmemcpynla_put__stack_chk_guarducv_to_stringstrchrinet_ptonstrtol__stack_chk_failntohlstrtoulhtonlsnprintfucv_resource_dataptrvasprintfstderrfputsabortstrerrorucv_stringbuf_newstrlen_ucv_stringbuf_appenducv_stringbuf_finishnl_geterrorsprintbufhtonsnl_recvmsgsnl_socket_add_membershipsnl_socket_allocnl_connectnl_socket_freeuc_vm_raise_exceptionuloop_fd_addnl_socket_set_buffer_sizenl_socket_disable_seq_checknl_cb_setcallocucv_resource_newucv_getucv_resource_datantohsucv_int64_newucv_uint64_newucv_boolean_newucv_string_new_lengthif_indextonameucv_string_newinet_ntopucv_array_newucv_object_newucv_array_pushnla_parseucv_object_adducv_putnla_oknla_next_ucv_string_getstrcmpuc_vm_stack_pushuc_vm_calluloop_cancelleduc_vm_stack_popucv_to_numberucv_uint64_getucv_is_truishucv_string_lengthif_nametoindexether_atonucv_object_getnla_reservegetsockoptsetsockoptnl_syserr2nlerrnlmsg_alloc_simplenlmsg_reservenlmsg_freenl_cb_allocnl_cb_errnl_send_auto_completenl_cb_putuc_module_initucv_cfunction_newucv_resource_type_adduc_vm_registry_setuc_module_entrylibnl-tiny.so.1libubox.so.20260213libgcc_s.so.1libc.soGLIBC_2.0?ii U $,4<DLT\dlt|  $,08<DHPT\`hltx$8L`|(8L`t0DXl(<Pdx  4Pdx,@Th|$8L`t0D`t(<Pdx  4H\p$8DL`t(<Pdx,@Th|0DXl  4H\p$8L`t(<Pdx,@Th|0DXl  4H\p$8L`t(<Pdx,@Th|0DXl  4H\p$8L`lt(<Pdx,H\p,@Th|0DXl(<Pdx,@Th|,@T`p$8L`t(<Pdx,@Th|0DXl0DXl  4 H \ p         $ 8 L ` t         ( < P d x         4 H \ p          $ 0 8 L ` t       0DXl  4Hdx' '`r>`r>`r>`rajxP2<Ki` bC "\@:e @H2I oN M 0@( J@:ee* @8ejjjj0@ @:e0 eUMg@8ej @2id+eBcJK2nF*dgA#@`Jb>a\g\@:e D eaJ|\g0@A( JN M@:ee"Ckl" ,\gpT@:egeB\g D@:e Bj@xd j\g @=ej( @2iedgT%g@:egLe@:ee=e@ pe@8e@* *@jwdjj @2i de" "e0@JAg udj @2idejj @2iedg8j IDg0\I@:eeg0H @:eJJe*\l@:e800\uIegE M@:eeg0Hg8@:e00\uIeg& M@:eeg0Hg@:e0pX e O M@:ex DpTe@:e𸘞egXp ڕM@?e\ e@:e"gXelm@:exeg0HKӣgg@:eXelm@:eeg0Hg@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXleLm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg M@:eXe lm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg5M@:eXelm@:e𸘞eg0Hg5M@:eXelm@:e𸘞eg0HgUM@:eXleLm@:e𸘞eg0HgU M@:eXleLm@:e𸘞eg0HgUM@:eXelm@:e𸘞eg0Hgu M@:eXleLm@:e𸘞eg0HguM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0Hg5M@:eXelm@:e𸘞eg0Hg5M@:eXelm@:e𸘞eg0HgU M@:eXelm@:e𸘞eg0HguM@:eXelm@:e𸘞eg0HguM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg5 M@:eXelm@:e𸘞eg0HgUM@:eXelm@:e𸘞eg0HgUM@:eXelm@:e𸘞eg0HguM@:eXelm@:e𸘞eg0HguM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg6M@:eXelm@:e𸘞eg0Hg6M@:eXelm@:e𸘞eg0HgVM@:eXelm@:e𸘞eg0HgVM@:eXelm@:e𸘞eg0HgvM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg6M@:eXelm@:e𸘞eg0HgVM@:eXelm@:e𸘞eg0HgvM@:eXelm@:e𸘞eg0HgM@:eXleLm@:e𸘞eg0HgM@:eXleLm@:e𸘞eg0HgM@:eXleLm@:e𸘞eg0HgM@:eXleLm@:e𸘞eg0Hg6M@:eXleLm@:e𸘞eg0HgVM@:eXleLm@:e𸘞eg0HgvM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg6 M@:eXelm@:e𸘞eg0HgVM@:eXelm@:e𸘞eg0HgVM@:eXelm@:e𸘞eg0HgvM@:eXelm@:e𸘞eg0HgvM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg6M@:eXelm@:e𸘞eg0Hg6M@:eXelm@:e𸘞eg0HgVM@:eXelm@:e𸘞eg0HgVM@:eXelm@:e𸘞eg0HgvM@:eXe lm@:e𸘞eg0HgvM@:eXe!lm@:e𸘞eg0HgM@:eXe"lm@:e𸘞eg0Hg M@:eXe$lm@:e𸘞eg0HgM@:eXe%lm@:e𸘞eg0HgM@:eXe&lm@:e𸘞eg0HgM@:eXe(lm@:e𸘞eg0HgM@:eXe)lm@:e𸘞eg0HgM@:eXe*lm@:e𸘞eg0HgM@:eXe,lm@:e𸘞eg0HgM@:eXe-lm@:e𸘞eg0HgM@:eXe.lm@:e𸘞eg0HgM@:eXe0lm@:e𸘞eg0Hg6M@:eXe1lm@:e𸘞eg0Hg6M@:eXe2lm@:e𸘞eg0HgVM@:eXe4lm@:e𸘞eg0HgVM@:eXe:lm@:e𸘞eg0HgvM@:eXe>lm@:e𸘞eg0HgvM@:eXe@lm@:e𸘞eg0Hg M@:eXeBlm@:e𸘞eg0HgM@:eXeClm@:e𸘞eg0Hg M@:eXeDlm@:e𸘞eg0HgM@:eXeHlm@:e𸘞eg0HgM@:eXeIlm@:e𸘞eg0HgM@:eXeJlm@:e𸘞eg0HgM@:eXeNlm@:e𸘞eg0Hg M@:eXeOlm@:e𸘞eg0HgM@:eXePlm@:e𸘞eg0Hg6M@:eXeQlm@:e𸘞eg0Hg6M@:eXeRlm@:e𸘞eg0HgVM@:eXeTlm@:e𸘞eg0HgVM@:eXeUlm@:e𸘞eg0HgvM@:eXeVlm@:e𸘞eg0Hgv M@:eXeXlm@:e𸘞eg0HgvM@:eXeYlm@:e𸘞eg0HgM@:eXeZlm@:e𸘞eg0HgM@:eXe\lm@:e𸘞eg0HgM@:eXe^lm@:e𸘞eg0Hg M@:eXe`lm@:e𸘞eg0HgM@:eXedlm@:e𸘞eg0HgM@:eXeelm@:e𸘞eg0HgM@:eXeflm@:e𸘞eg0HgM@:eXehlm@:e𸘞eg0HgM@:eXeilm@:e𸘞eg0HgM@:eXejlm@:e𸘞eg0Hg6M@:eXellm@:e𸘞eg0Hg6M@:eXemlm@:e𸘞eg0HgVM@:eXenlm@:e𸘞eg0HgVM@:eXeplm@:e𸘞eg0HgvM@:eXeqlm@:e𸘞eg0Hgv M@:eXerlm@:e𸘞eg0HgvM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXe lm@:e𸘞eg0HgM@:eXe lm@:e𸘞eg0HgM@:eXe lm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg7M@:eXelm@:e𸘞eg0Hg7M@:eXelm@:e𸘞eg0HgW M@:eXelm@:e𸘞eg0HgWM@:eXelm@:e𸘞eg0Hgw M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXe@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXe lm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXe lm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg7M@:eXelm@:e𸘞eg0Hg7M@:eXe lm@:e𸘞eg0HgWM@:eXelm@:e𸘞eg0HgWM@:eXe lm@:e𸘞eg0HgwM@:eXelm@:e𸘞eg0HgwM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0Hg7M@:eXelm@:e𸘞eg0Hg7M@:eXelm@:e𸘞eg0HgWM@:eXelm@:e𸘞eg0HgWM@:eXelm@:e𸘞eg0HgwM@:eXelm@:e𸘞eg0Hgw M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXe lm@:e𸘞eg0HgM@:eXe lm@:e𸘞eg0HgM@:eXe lm@:e𸘞eg0HgM@:eXe lm@:e𸘞eg0HgM@:eXe lm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0Hg7M@:eXelm@:e𸘞eg0Hg7M@:eXelm@:e𸘞eg0HgW M@:eXelm@:e𸘞eg0HgwM@:eXelm@:e𸘞eg0HgwM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg7M@:eXelm@:e𸘞eg0Hg7M@:eXelm@:e𸘞eg0HgWM@:eXelm@:e𸘞eg0HgwM@:eXelm@:e𸘞eg0HgwM@:eXe lm@:e𸘞eg0HgM@:eXe!lm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXleLm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg7M@:eXe lm@:e𸘞eg0Hg7M@:eXelm@:e𸘞eg0Hg7M@:eXelm@:e𸘞eg0Hg7M@:eXelm@:e𸘞eg0HgWM@:eXe@lm@:e𸘞eg0HgWM@:eXe lm@:e𸘞eg0HgwM@:eXelm@:e𸘞eg0HgwM@:eXelm@:e𸘞eg0HgwM@:eXelm@:e𸘞eg0HgwM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg M@:eXe@lm@:e𸘞eg0Hg7M@:eXelm@:e𸘞eg0HgWM@:eXelm@:e𸘞eg0HgwM@:eXelm@:e𸘞eg0HgwM@:eXelm@:e𸘞eg0HgM@:eXe lm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXe lm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg7M@:eXelm@:e𸘞eg0Hg7 M@:eXe@lm@:e𸘞eg0Hg7M@:eXelm@:e𸘞eg0HgWM@:eXelm@:e𸘞eg0HgW M@:eXe lm@:e𸘞eg0HgWM@:eXelm@:e𸘞eg0HgwM@:eXe@lm@:e𸘞eg0HgwM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXe lm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXleLm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg8M@:eXelm@:e𸘞eg0Hg8M@:eXelm@:e𸘞eg0HgXM@:eXelm@:e𸘞eg0HgXM@:eXelm@:e𸘞eg0Hgx M@:eXelm@:e𸘞eg0HgxM@:eXelm@:e𸘞eg0HgM@:eXe@lm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg8M@:eXelm@:e𸘞eg0HgXM@:eXelm@:e𸘞eg0HgXM@:eXelm@:e𸘞eg0HgXM@:eXelm@:e𸘞eg0HgxM@:eXelm@:e𸘞eg0HgM@:eXlme@:e𸘞eg0HgM@:eXlme@:e𸘞eg0Hg M@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0Hg8M@:eXelm@:e𸘞eg0Hg8M@:eXelm@:e𸘞eg0HgXM@:eXelm@:e𸘞eg0HgxM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXelm@:e𸘞eg0HgM@:eXe lm@:e𸘞eg0HgM@:e0 e8eM@gvdeeej @2iegd0@?eDde%x c$%x b$%x a$%x `$%x _$%x ^$%x ]$%x \$%x [$%x Y$%x W$%x V$%x U$%x T$%x Q$%x P$%x O$%x N$%x M$%x L$%x K$%x J$%x I$%x H$%x G$%x F$%x E$%x D$%x C$%x B$%x A$%x @$%x >$%x =$%x <$%x ;$%x :$%x 9$%x 8$%x 7$%x 6$%x 5$%x 4$%x 3$%x 2$%x 1$%x 0$%x /$%x .$%x -$%x ,$%x +$%x *$%x )$%x ($%x '$%x &$%x %$%x $$%x #$%x "$%x !$%x  $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x  $%x  $%x  $%x  $%x  $%x $%x $%x $' '%urtnl.listenerOut of memory RTNETLINK answers: %s: %sattributefield%s `%s` has invalid value `%s`: %snumber out of range 0-255number out of range 0-65535number out of range 0-16777215number out of range 0-4294967295Invalid callbackInvalid command ID%02x:%02x:%02x:%02x:%02x:%02x%04x:%04x:%04x:%04x/%hhuviadevweightonlinkrealmencapasslave%02x%02x.%02x:%02x:%02x:%02x:%02x:%02xmodesegshmacbridge_flagsbridge_modebridge_vlan_infovidvid_endflagsbridgemsgheadcmdRuntime exception in callbacknot an integer or out of range 0-255integer must be 0 or 1not an integer or out of range 0-65535integer out of range 0-255not an integer or out of range -2147483648-2147483647not an integer or out of range 0-4294967295integer out of range 0-65535integer out of range 0-16777215not an integer or negativeout of memoryinterface index out of range 0-4294967295interface not foundinvalid MAC addressinvalid addressinvalid IP addresswrong address familyaddress range given but single address expectedinvalid nexthop datanot a two-element array of numbersflag or mask value not an integerflag value not an integer or out of range 0-4294967295mask value not an integer or out of range 0-4294967295value neither an array of flags, mask nor an integerlinkinfo does not specify kindsrh mode not an integer in range 0-4294967295srh hmac not an integer in range 0-4294967295srh segs array missing or emptycannot allocate srh headersrh segs array contains invalid IPv6 addressencap does not specify typeencap specifies unknown typevxlanerspangeneveunknown IP options type specifiedfield bridge.bridge_flags not an integer or out of range 0-65535field bridge.bridge_mode not an integer or out of range 0-65535field bridge.bridge_vlan_info.flags not an integer or out of range 0-65535field bridge.bridge_vlan_info.vid not an integer or out of range 0-4095field bridge.bridge_vlan_info.vid_end not an integer or out of range 0-4095inetinet6unknown address family specifiedUnable to toggle NETLINK_GET_STRICT_CHKInterrupted replycloseset_commandsrtnl.registryNLM_F_ACKNLM_F_ACK_TLVSNLM_F_APPENDNLM_F_ATOMICNLM_F_CAPPEDNLM_F_CREATENLM_F_DUMPNLM_F_DUMP_FILTEREDNLM_F_DUMP_INTRNLM_F_ECHONLM_F_EXCLNLM_F_MATCHNLM_F_MULTINLM_F_NONRECNLM_F_REPLACENLM_F_REQUESTNLM_F_ROOTNLM_F_STRICT_CHKIN6_ADDR_GEN_MODE_EUI64IN6_ADDR_GEN_MODE_NONEIN6_ADDR_GEN_MODE_STABLE_PRIVACYIN6_ADDR_GEN_MODE_RANDOMMACVLAN_MODE_PRIVATEMACVLAN_MODE_VEPAMACVLAN_MODE_BRIDGEMACVLAN_MODE_PASSTHRUMACVLAN_MODE_SOURCEMACVLAN_MACADDR_ADDMACVLAN_MACADDR_DELMACVLAN_MACADDR_FLUSHMACVLAN_MACADDR_SETMACSEC_VALIDATE_DISABLEDMACSEC_VALIDATE_CHECKMACSEC_VALIDATE_STRICTMACSEC_VALIDATE_MAXMACSEC_OFFLOAD_OFFMACSEC_OFFLOAD_PHYMACSEC_OFFLOAD_MACMACSEC_OFFLOAD_MAXIPVLAN_MODE_L2IPVLAN_MODE_L3IPVLAN_MODE_L3SVXLAN_DF_UNSETVXLAN_DF_SETVXLAN_DF_INHERITVXLAN_DF_MAXGENEVE_DF_UNSETGENEVE_DF_SETGENEVE_DF_INHERITGENEVE_DF_MAXGTP_ROLE_GGSNGTP_ROLE_SGSNPORT_REQUEST_PREASSOCIATEPORT_REQUEST_PREASSOCIATE_RRPORT_REQUEST_ASSOCIATEPORT_REQUEST_DISASSOCIATEPORT_VDP_RESPONSE_SUCCESSPORT_VDP_RESPONSE_INVALID_FORMATPORT_VDP_RESPONSE_INSUFFICIENT_RESOURCESPORT_VDP_RESPONSE_UNUSED_VTIDPORT_VDP_RESPONSE_VTID_VIOLATIONPORT_VDP_RESPONSE_VTID_VERSION_VIOALTIONPORT_VDP_RESPONSE_OUT_OF_SYNCPORT_PROFILE_RESPONSE_SUCCESSPORT_PROFILE_RESPONSE_INPROGRESSPORT_PROFILE_RESPONSE_INVALIDPORT_PROFILE_RESPONSE_BADSTATEPORT_PROFILE_RESPONSE_INSUFFICIENT_RESOURCESPORT_PROFILE_RESPONSE_ERRORIPOIB_MODE_DATAGRAMIPOIB_MODE_CONNECTEDHSR_PROTOCOL_HSRHSR_PROTOCOL_PRPLINK_XSTATS_TYPE_UNSPECLINK_XSTATS_TYPE_BRIDGELINK_XSTATS_TYPE_BONDXDP_ATTACHED_NONEXDP_ATTACHED_DRVXDP_ATTACHED_SKBXDP_ATTACHED_HWXDP_ATTACHED_MULTIFDB_NOTIFY_BITFDB_NOTIFY_INACTIVE_BITRTM_BASERTM_NEWLINKRTM_DELLINKRTM_GETLINKRTM_SETLINKRTM_NEWADDRRTM_DELADDRRTM_GETADDRRTM_NEWROUTERTM_DELROUTERTM_GETROUTERTM_NEWNEIGHRTM_DELNEIGHRTM_GETNEIGHRTM_NEWRULERTM_DELRULERTM_GETRULERTM_NEWQDISCRTM_DELQDISCRTM_GETQDISCRTM_NEWTCLASSRTM_DELTCLASSRTM_GETTCLASSRTM_NEWTFILTERRTM_DELTFILTERRTM_GETTFILTERRTM_NEWACTIONRTM_DELACTIONRTM_GETACTIONRTM_NEWPREFIXRTM_GETMULTICASTRTM_GETANYCASTRTM_NEWNEIGHTBLRTM_GETNEIGHTBLRTM_SETNEIGHTBLRTM_NEWNDUSEROPTRTM_NEWADDRLABELRTM_DELADDRLABELRTM_GETADDRLABELRTM_GETDCBRTM_SETDCBRTM_NEWNETCONFRTM_DELNETCONFRTM_GETNETCONFRTM_NEWMDBRTM_DELMDBRTM_GETMDBRTM_NEWNSIDRTM_DELNSIDRTM_GETNSIDRTM_NEWSTATSRTM_GETSTATSRTM_NEWCACHEREPORTRTM_NEWCHAINRTM_DELCHAINRTM_GETCHAINRTM_NEWNEXTHOPRTM_DELNEXTHOPRTM_GETNEXTHOPRTM_NEWLINKPROPRTM_DELLINKPROPRTM_GETLINKPROPRTM_NEWVLANRTM_DELVLANRTM_GETVLANRTN_UNSPECRTN_UNICASTRTN_LOCALRTN_BROADCASTRTN_ANYCASTRTN_MULTICASTRTN_BLACKHOLERTN_UNREACHABLERTN_PROHIBITRTN_THROWRTN_NATRTN_XRESOLVERT_SCOPE_UNIVERSERT_SCOPE_SITERT_SCOPE_LINKRT_SCOPE_HOSTRT_SCOPE_NOWHERERT_TABLE_UNSPECRT_TABLE_COMPATRT_TABLE_DEFAULTRT_TABLE_MAINRT_TABLE_LOCALRT_TABLE_MAXRTAX_MTURTAX_HOPLIMITRTAX_ADVMSSRTAX_REORDERINGRTAX_RTTRTAX_WINDOWRTAX_CWNDRTAX_INITCWNDRTAX_INITRWNDRTAX_FEATURESRTAX_QUICKACKRTAX_CC_ALGORTAX_RTTVARRTAX_SSTHRESHRTAX_FASTOPEN_NO_COOKIEPREFIX_UNSPECPREFIX_ADDRESSPREFIX_CACHEINFONDUSEROPT_UNSPECNDUSEROPT_SRCADDRRTNLGRP_NONERTNLGRP_LINKRTNLGRP_NOTIFYRTNLGRP_NEIGHRTNLGRP_TCRTNLGRP_IPV4_IFADDRRTNLGRP_IPV4_MROUTERTNLGRP_IPV4_ROUTERTNLGRP_IPV4_RULERTNLGRP_IPV6_IFADDRRTNLGRP_IPV6_MROUTERTNLGRP_IPV6_ROUTERTNLGRP_IPV6_IFINFORTNLGRP_DECnet_IFADDRRTNLGRP_NOP2RTNLGRP_DECnet_ROUTERTNLGRP_DECnet_RULERTNLGRP_NOP4RTNLGRP_IPV6_PREFIXRTNLGRP_IPV6_RULERTNLGRP_ND_USEROPTRTNLGRP_PHONET_IFADDRRTNLGRP_PHONET_ROUTERTNLGRP_DCBRTNLGRP_IPV4_NETCONFRTNLGRP_IPV6_NETCONFRTNLGRP_MDBRTNLGRP_MPLS_ROUTERTNLGRP_NSIDRTNLGRP_MPLS_NETCONFRTNLGRP_IPV4_MROUTE_RRTNLGRP_IPV6_MROUTE_RRTNLGRP_NEXTHOPRTNLGRP_BRVLANRTM_F_CLONEDRTM_F_EQUALIZERTM_F_FIB_MATCHRTM_F_LOOKUP_TABLERTM_F_NOTIFYRTM_F_PREFIXAF_UNSPECAF_INETAF_INET6AF_MPLSAF_BRIDGEGRE_CSUMGRE_ROUTINGGRE_KEYGRE_SEQGRE_STRICTGRE_RECGRE_ACKTUNNEL_ENCAP_NONETUNNEL_ENCAP_FOUTUNNEL_ENCAP_GUETUNNEL_ENCAP_MPLSTUNNEL_ENCAP_FLAG_CSUMTUNNEL_ENCAP_FLAG_CSUM6TUNNEL_ENCAP_FLAG_REMCSUMIP6_TNL_F_ALLOW_LOCAL_REMOTEIP6_TNL_F_IGN_ENCAP_LIMITIP6_TNL_F_MIP6_DEVIP6_TNL_F_RCV_DSCP_COPYIP6_TNL_F_USE_ORIG_FLOWLABELIP6_TNL_F_USE_ORIG_FWMARKIP6_TNL_F_USE_ORIG_TCLASSNTF_EXT_LEARNEDNTF_MASTERNTF_OFFLOADEDNTF_PROXYNTF_ROUTERNTF_SELFNTF_STICKYNTF_USENUD_DELAYNUD_FAILEDNUD_INCOMPLETENUD_NOARPNUD_NONENUD_PERMANENTNUD_PROBENUD_REACHABLENUD_STALEIFA_F_DADFAILEDIFA_F_DEPRECATEDIFA_F_HOMEADDRESSIFA_F_MANAGETEMPADDRIFA_F_MCAUTOJOINIFA_F_NODADIFA_F_NOPREFIXROUTEIFA_F_OPTIMISTICIFA_F_PERMANENTIFA_F_SECONDARYIFA_F_STABLE_PRIVACYIFA_F_TEMPORARYIFA_F_TENTATIVEFIB_RULE_PERMANENTFIB_RULE_INVERTFIB_RULE_UNRESOLVEDFIB_RULE_IIF_DETACHEDFIB_RULE_DEV_DETACHEDFIB_RULE_OIF_DETACHEDFR_ACT_TO_TBLFR_ACT_GOTOFR_ACT_NOPFR_ACT_BLACKHOLEFR_ACT_UNREACHABLEFR_ACT_PROHIBITNETCONFA_IFINDEX_ALLNETCONFA_IFINDEX_DEFAULTBRIDGE_FLAGS_MASTERBRIDGE_FLAGS_SELFBRIDGE_MODE_VEBBRIDGE_MODE_VEPABRIDGE_MODE_UNDEFBRIDGE_MODE_UNSPECBRIDGE_MODE_HAIRPINBRIDGE_VLAN_INFO_MASTERBRIDGE_VLAN_INFO_PVIDBRIDGE_VLAN_INFO_UNTAGGEDBRIDGE_VLAN_INFO_RANGE_BEGINBRIDGE_VLAN_INFO_RANGE_ENDBRIDGE_VLAN_INFO_BRENTRYconsterrorrequestlistenermplsipip6ilaseg6bareudpbondbond_slavebridge_slavehsripoibipvlanmacvlanrmnetvlanvrfgregretapip6greip6gretapip6erspanip6tnlipipsitvethvtivti6xfrmfamilyforwardingrp_filtermc_forwardingproxy_neighignore_routes_with_linkdowninputnamethresh1thresh2thresh3gc_intervalparamsconfigstatsallocsdestroyshash_growsres_failedlookupshitsrcv_probes_mcastrcv_probes_ucastperiodic_gc_runsforced_gc_runskey_lenentry_sizeentrieslast_flushlast_randhash_rndhash_maskhash_chain_gcproxy_qlenbase_reachable_timeretrans_timegc_staletimedelay_probe_timequeue_lenapp_probesucast_probesmcast_probesanycast_delayproxy_delaylocktimeseqaddresslabeltosactionprioritydstfwmarkfwmaskiifoifl3mdevuid_rangeip_protosport_rangedport_rangetablesuppress_prefixlensuppress_ifgroupflowgatewaygotoprotocolscopelocalbroadcastanycastcacheinfometricpreferredvalidcstamptstampifindexlink_netnsidlladdrmasterportsrc_vniconfirmedusedupdatedrefcntgbpclassverindexdirhwidif_idlinkikeyokeyremoteinfo_peer6rd_prefix6rd_prefixlen6rd_relay_prefix6rd_relay_prefixlencollect_metadataencap_dportencap_flagsencap_limitencap_sportencap_typeflowinfopmtudiscprotottlerspan_direrspan_hwiderspan_indexerspan_veriflagsignore_dfoflagsageinggpegroupgroup6idl2missl3misslearninglimitlocal6port_rangeproxyremcsum_rxremcsum_txrscttl_inheritudp_csumudp_zero_csum6_rxudp_zero_csum6_txport_tableegress_qos_mapingress_qos_mapmux_idmacaddrmacaddr_countmacaddr_datamacaddr_modepkeyumcastmulticast_specseq_nrslave1slave2supervision_addrversionremote6backup_portbridge_idconfig_pendingcostdesignated_costdesignated_portfast_leaveforward_delay_timergroup_fwd_maskguardhold_timerisolatedlearning_syncmcast_floodmcast_to_ucastmessage_age_timermulticast_routerneigh_suppressnoprotectproxyarpproxyarp_wifiroot_idtopology_change_ackunicast_floodvlan_tunnelageing_timefdb_flushforward_delaygc_timergroup_addrhello_timehello_timermax_agemcast_hash_elasticitymcast_hash_maxmcast_igmp_versionmcast_last_member_cntmcast_last_member_intvlmcast_membership_intvlmcast_mld_versionmcast_queriermcast_querier_intvlmcast_query_intvlmcast_query_response_intvlmcast_query_use_ifaddrmcast_routermcast_snoopingmcast_startup_query_cntmcast_startup_query_intvlmcast_stats_enablednf_call_arptablesnf_call_ip6tablesnf_call_iptablesroot_path_costroot_portstp_statetcn_timertopology_changetopology_change_detectedtopology_change_timervlan_default_pvidvlan_filteringvlan_protocolvlan_stats_enabledad_actor_oper_port_statead_aggregator_idad_partner_oper_port_statelink_failure_countmii_statusperm_hwaddrqueue_idactive_slavead_actor_systemad_actor_sys_prioad_infoad_lacp_ratead_selectad_user_port_keyall_slaves_activearp_all_targetsarp_intervalarp_ip_targetarp_validatedowndelayfail_over_maclp_intervalmiimonmin_linksnum_peer_notifpackets_per_slaveprimaryprimary_reselectresend_igmptlb_dynamic_lbupdelayuse_carrierxmit_hash_policyad_info_actor_keyad_info_aggregatorad_info_num_portsad_info_partner_keyad_info_partner_macethertypemultiproto_modesrcport_minchangetxqlenmtuifaliaslinkmodeoperstatenum_tx_queuesnum_rx_queuesaf_spectarget_netnsidproto_downifnamelinkinfoext_maskstats64rx_packetstx_packetsrx_bytestx_bytesrx_errorstx_errorsrx_droppedtx_droppedmulticastcollisionsrx_length_errorsrx_over_errorsrx_crc_errorsrx_frame_errorsrx_fifo_errorsrx_missed_errorstx_aborted_errorstx_carrier_errorstx_fifo_errorstx_heartbeat_errorstx_window_errorsrx_compressedtx_compressedrx_nohandlerhoplimitmtu6accept_raaccept_redirectsautoconfdad_transmitsrtr_solicitsrtr_solicit_intervalrtr_solicit_delayuse_tempaddrtemp_valid_lfttemp_prefered_lftregen_max_retrymax_desync_factormax_addressesforce_mld_versionaccept_ra_defrtraccept_ra_pinfoaccept_ra_rtr_prefrtr_probe_intervalaccept_ra_rt_info_max_plenproxy_ndpoptimistic_dadaccept_source_routedisable_ipv6accept_dadforce_tllaondisc_notifymldv1_unsolicited_report_intervalmldv2_unsolicited_report_intervalsuppress_frag_ndiscaccept_ra_from_localuse_optimisticaccept_ra_mtustable_secretuse_oif_addrs_onlyaccept_ra_min_hop_limitdrop_unicast_in_l2_multicastdrop_unsolicited_nakeep_addr_on_downrtr_solicit_max_intervalseg6_enabledseg6_require_hmacenhanced_dadaddr_gen_modedisable_policyaccept_ra_rt_info_min_plenndisc_tclassrpl_seg_enabledra_defrtr_metricproxy_arpsecure_redirectssend_redirectsshared_mediabootp_relaylog_martianstagarpfiltermedium_idnoxfrmnopolicyforce_igmp_versionarp_announcearp_ignorepromote_secondariesarp_acceptarp_notifyaccept_localsrc_vmarkproxy_arp_pvlanroute_localnetigmpv2_unsolicited_report_intervaligmpv3_unsolicited_report_intervaldrop_gratuitous_arpbc_forwardingsrhtcoptslocatorcsum_modeident_typehook_typeprefsrcmetricsmultipathmarkprefexpiresuidttl_propagatesportdportnh_idadvmssreorderingrttwindowinitcwndinitrwndecnquickackcc_algorttvarssthreshfastopen_no_cookielockclntreflastusetstsage' 'i.9g I1 TD p`DhX  $ $H ( ,4 4< Dܥ$+P h `Pdltt|`X`HHH4( (D LT\dlx,X  (08@H  ,4@ LXdt (     t ԥ((,4 <@ԥH T  X`hlpx@@    ԥ (,4   ,4@HP ($ԥ P  TX `p x  P8X  ( <Pdp|ԥX  <Pdp | ԥ X   <P ( 0 4<4D P X  `H lt <ԥ0ԥ   ,ԥ<DL\dlt P0 4  <  "  0!,D 8HTdx H   $  $0 <HT\t+, !",H`p#*&%$H    ,8Hd'|)$0 <$HX h|<    $08DT h p ,8HP(ԥT ,  \d! xhp| %`.'  $ 0(<0H8T@`HlPX`hpx  4DT  ԥd5dpx  $(,0$448H<X@lDHLPTX\` dhl p,t<x`|( ,@Tp   4D T$`(p,t048<@DHLPTX \`(d8h\l(p tx|0T  dԥ  0T  <ԥT  <Pԥ T hlH   X D (08d d @ HTXd `l x|   0)k|l\L<, ܢ̢|l\L<, ܡ̡|l\L<, ܠ̠|l\L<, ܟ̟|l\L<, ܞ̞|l\L<,07070101AE232D000081ED0000000000000000000000016A426C280000D196000000FE0000000000000000000000000000001900000000usr/lib/ucode/nl80211.soELF4t4 (ptt000f,,000((QtdRtd000** 7G[i L$ u04X  { tppp p pbppooTooCbHT<2 $ *D ,=J;:617(S!3G -\"0 A E%@/4X+5#'&O._FaWQLK8[)IY9PR?]>BC`N^MVZUL$ Vp" L$ u '9p" u/uu|uCluG\uLu j<0.Mp@=e ep@=e e L@ BZ_apX@:e ҞeJACa\@:e pHem@:e 0𠙞eg\ M@:e He@@:e 0𠙞eg\ M@:e \ e@:eA O[JeA`"e 0@G JAg vdPj @2idegGE J \%g@:e 0@0$J" L@:eNe1)XivJ PP m@:e D em@:e g0@J n@:ee*p @8ej ydXiJej# @2ideKg J \:e@%g PP em@:e D em@:e ag0@aJ nO@:eeE" kCl"LL"M"1, Bj@ydH0 nM@:ege"p@@:eSe a ,pX@:egeBpP @:ege"0 O@?eep @8e @8e ,pX@:egeBِ @8eej @2iedgP@$g:eg@g @"0N0 M0 l%I@9e0 e@8ewd0Njc @2ideed2ifL2gI$g00XM@:e0@  Jng@:ee"gLnm@:e0@J@:ee *00Nmg@8evd jej @2iedgXJV*jydX\"K j80H@:eCe`pP@:e BpP񀙞e@:e 00X eM@:ee" \ `3h3ii@qgdl"D @:eJZey`0@ J@:e Ҟe"\@:e m\e@:e0𠘞eg\  M@:e0\e M@:e0\ e@:ege@?e0\ e@:ege@?e e@?e0@emn@:ee"P j @T@:ep񴘞eg@=eeJ;j @2ideK$g\gg0@ J@:ee\`2JH2IkAdl"\g0@ J@:e"BP@vd jej @2i deBgZ'g `Z`r1`r\`jydraX@:egPe@:epe=e@  e p\@:e@e"0O0@J @:e" Za0O0H@8e c`A`#` ca@j Ңg0@J@:e" Aca0/OM C`bAca#`ca`A`Ar,aX@:egp@e@:epe=e@ p\e@:e@e* RXgi* Bra0@J @:ee *0O0O Oz `DACa#` Canpg@8e `GAJCa#`CXg *nj @2idelm@:e𸘞eg\gM@:e\e?lm@:e𸘞eg\gM@:e\e@lm@:e𸘞eg\gM@:e\eAlm@:e𸘞eg\g0M@:e\eBlm@:e𸘞eg\gPM@:e\eClm@:e𸘞eg\gPM@:e\eDlm@:e𸘞eg\gpM@:e\eElm@:e𸘞eg\gM@:e\eFlm@:e𸘞eg\g M@:e\eGlm@:e𸘞eg\gM@:e\eHlm@:e𸘞eg\gM@:e\eIlm@:e𸘞eg\gM@:e\eJlm@:e𸘞eg\g0M@:e\eKlm@:e𸘞eg\gPM@:e\eLlm@:e𸘞eg\gpM@:e\eMlm@:e𸘞eg\gpM@:e\eNlm@:e𸘞eg\gM@:e\eOlm@:e𸘞eg\gM@:e\ePlm@:e𸘞eg\gM@:e\eQlm@:e𸘞eg\gM@:e\eRlm@:e𸘞eg\gM@:e\eSlm@:e𸘞eg\g0M@:e\eTlm@:e𸘞eg\gPM@:e\eUlm@:e𸘞eg\gpM@:e\eVlm@:e𸘞eg\gM@:e\eWlm@:e𸘞eg\gM@:e\eXlm@:e𸘞eg\gM@:e\eYlm@:e𸘞eg\gM@:e\eZlm@:e𸘞eg\gM@:e\e[lm@:e𸘞eg\g0M@:e\e\lm@:e𸘞eg\g0M@:e\e]lm@:e𸘞eg\gPM@:e\e^lm@:e𸘞eg\gp M@:e\e_lm@:e𸘞eg\gM@:e\e`lm@:e𸘞eg\g M@:e\ealm@:e𸘞eg\gM@:e\eblm@:e𸘞eg\gM@:e\eclm@:e𸘞eg\gM@:e\edlm@:e𸘞eg\g0M@:e\eelm@:e𸘞eg\g0M@:e\eflm@:e𸘞eg\gPM@:e\eglm@:e𸘞eg\gpM@:e\ehlm@:e𸘞eg\gM@:e\eilm@:e𸘞eg\gM@:e\ejlm@:e𸘞eg\gM@:e\eklm@:e𸘞eg\gM@:e\ellm@:e𸘞eg\gM@:e\emlm@:e𸘞eg\gM@:e\enlm@:e𸘞eg\gM@:e\eolm@:e𸘞eg\g0M@:e\eplm@:e𸘞eg\gPM@:e\elm@:e𸘞eg\gM@:e\elm@:e𸘞eg\gM@:e\elm@:e𸘞eg\gM@:e\elm@:e𸘞eg\gM@:e\elm@:e𸘞eg\gM@:e\elm@:e𸘞eg\gM@:e\elm@:e𸘞eg\gM@:e\elm@:e𸘞eg\gM@:e\elm@:e𸘞eg\g1 M@:e\elm@:e𸘞eg\gQM@:e\elm@:e𸘞eg\gQM@:e\elm@:e𸘞eg\gqM@:e\elm@:e𸘞eg\g M@:e\elm@:e𸘞eg\gM@:e\elm@:e𸘞eg\gM@:e\elm@:e𸘞eg\gM@:e\elm@:e𸘞eg\gM@:e\elm@:e𸘞eg\gM@:e\elm@:e𸘞eg\gM@:e\e lm@:e𸘞eg\g1M@:e\e lm@:e𸘞eg\gQ M@:e\e lm@:e𸘞eg\gqM@:ee8eqM@gwdj @2iegd0@?eDde%x a$%x `$%x _$%x ^$%x ]$%x \$%x [$%x Z$%x Y$%x X$%x V$%x T$%x S$%x R$%x Q$%x P$%x N$%x M$%x K$%x J$%x I$%x H$%x G$%x F$%x E$%x D$%x C$%x B$%x A$%x @$%x ?$%x >$%x =$%x ;$%x :$%x 9$%x 8$%x 7$%x 6$%x 5$%x 4$%x 3$%x 2$%x 1$%x 0$%x /$%x .$%x -$%x ,$%x +$%x *$%x )$%x ($%x '$%x &$%x %$%x $$%x #$%x "$%x !$%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x  $%x  $%x  $%x  $%x  $%x $%x $%x $' 'nl80211.listenerOut of memory Illegal error code %d in netlink replyunable to set FD_CLOEXEC flag on socket: %s: %snlctrlnl80211scanregulatorymlmevendornanInvalid callbackInvalid command IDInvalid timeout specifiedInvalid command ID specifiedcmdmsgNo event receivedtx_mcs_setrx_mcs_set%02x:%02x:%02x:%02x:%02x:%02xrx_highest_data_raterx_mcs_indexestx_mcs_set_definedtx_rx_mcs_set_equaltx_max_spatial_streamstx_unequal_modulationcap_infoampdu_params_infoextended_ht_cap_infotx_BF_cap_infoantenna_selection_inforx_maskrx_highesttx_paramsmcsstreamsmcs_indexestx_highest_data_ratebandwidthtypedataMAC80211_HWSIMwiphyattributefield%s `%s` has invalid value `%s`: %snot an integer or out of range 0-255not an integer or out of range 0-65535not an integer or out of range -2147483648-2147483647not an integer or out of range 0-4294967295not an integer or negativenot an arrayout of memoryinterface index out of range 0-4294967295invalid MAC addressinvalid IP addresssplit_wiphy_dumpInterrupted replynl80211.registryNLM_F_ACKNLM_F_ACK_TLVSNLM_F_APPENDNLM_F_ATOMICNLM_F_CAPPEDNLM_F_CREATENLM_F_DUMPNLM_F_DUMP_FILTEREDNLM_F_DUMP_INTRNLM_F_ECHONLM_F_EXCLNLM_F_MATCHNLM_F_MULTINLM_F_NONRECNLM_F_REPLACENLM_F_REQUESTNLM_F_ROOTNL80211_CMD_GET_WIPHYNL80211_CMD_SET_WIPHYNL80211_CMD_NEW_WIPHYNL80211_CMD_DEL_WIPHYNL80211_CMD_GET_INTERFACENL80211_CMD_SET_INTERFACENL80211_CMD_NEW_INTERFACENL80211_CMD_DEL_INTERFACENL80211_CMD_GET_KEYNL80211_CMD_SET_KEYNL80211_CMD_NEW_KEYNL80211_CMD_DEL_KEYNL80211_CMD_GET_BEACONNL80211_CMD_SET_BEACONNL80211_CMD_START_APNL80211_CMD_NEW_BEACONNL80211_CMD_STOP_APNL80211_CMD_DEL_BEACONNL80211_CMD_GET_STATIONNL80211_CMD_SET_STATIONNL80211_CMD_NEW_STATIONNL80211_CMD_DEL_STATIONNL80211_CMD_GET_MPATHNL80211_CMD_SET_MPATHNL80211_CMD_NEW_MPATHNL80211_CMD_DEL_MPATHNL80211_CMD_SET_BSSNL80211_CMD_SET_REGNL80211_CMD_REQ_SET_REGNL80211_CMD_GET_MESH_CONFIGNL80211_CMD_SET_MESH_CONFIGNL80211_CMD_GET_REGNL80211_CMD_GET_SCANNL80211_CMD_TRIGGER_SCANNL80211_CMD_NEW_SCAN_RESULTSNL80211_CMD_SCAN_ABORTEDNL80211_CMD_REG_CHANGENL80211_CMD_AUTHENTICATENL80211_CMD_ASSOCIATENL80211_CMD_DEAUTHENTICATENL80211_CMD_DISASSOCIATENL80211_CMD_MICHAEL_MIC_FAILURENL80211_CMD_REG_BEACON_HINTNL80211_CMD_JOIN_IBSSNL80211_CMD_LEAVE_IBSSNL80211_CMD_TESTMODENL80211_CMD_CONNECTNL80211_CMD_ROAMNL80211_CMD_DISCONNECTNL80211_CMD_SET_WIPHY_NETNSNL80211_CMD_GET_SURVEYNL80211_CMD_NEW_SURVEY_RESULTSNL80211_CMD_SET_PMKSANL80211_CMD_DEL_PMKSANL80211_CMD_FLUSH_PMKSANL80211_CMD_REMAIN_ON_CHANNELNL80211_CMD_CANCEL_REMAIN_ON_CHANNELNL80211_CMD_SET_TX_BITRATE_MASKNL80211_CMD_REGISTER_FRAMENL80211_CMD_REGISTER_ACTIONNL80211_CMD_FRAMENL80211_CMD_ACTIONNL80211_CMD_FRAME_TX_STATUSNL80211_CMD_ACTION_TX_STATUSNL80211_CMD_SET_POWER_SAVENL80211_CMD_GET_POWER_SAVENL80211_CMD_SET_CQMNL80211_CMD_NOTIFY_CQMNL80211_CMD_SET_CHANNELNL80211_CMD_SET_WDS_PEERNL80211_CMD_FRAME_WAIT_CANCELNL80211_CMD_JOIN_MESHNL80211_CMD_LEAVE_MESHNL80211_CMD_UNPROT_DEAUTHENTICATENL80211_CMD_UNPROT_DISASSOCIATENL80211_CMD_NEW_PEER_CANDIDATENL80211_CMD_GET_WOWLANNL80211_CMD_SET_WOWLANNL80211_CMD_START_SCHED_SCANNL80211_CMD_STOP_SCHED_SCANNL80211_CMD_SCHED_SCAN_RESULTSNL80211_CMD_SCHED_SCAN_STOPPEDNL80211_CMD_SET_REKEY_OFFLOADNL80211_CMD_PMKSA_CANDIDATENL80211_CMD_TDLS_OPERNL80211_CMD_TDLS_MGMTNL80211_CMD_UNEXPECTED_FRAMENL80211_CMD_PROBE_CLIENTNL80211_CMD_REGISTER_BEACONSNL80211_CMD_UNEXPECTED_4ADDR_FRAMENL80211_CMD_SET_NOACK_MAPNL80211_CMD_CH_SWITCH_NOTIFYNL80211_CMD_START_P2P_DEVICENL80211_CMD_STOP_P2P_DEVICENL80211_CMD_CONN_FAILEDNL80211_CMD_SET_MCAST_RATENL80211_CMD_SET_MAC_ACLNL80211_CMD_RADAR_DETECTNL80211_CMD_GET_PROTOCOL_FEATURESNL80211_CMD_UPDATE_FT_IESNL80211_CMD_FT_EVENTNL80211_CMD_CRIT_PROTOCOL_STARTNL80211_CMD_CRIT_PROTOCOL_STOPNL80211_CMD_GET_COALESCENL80211_CMD_SET_COALESCENL80211_CMD_CHANNEL_SWITCHNL80211_CMD_VENDORNL80211_CMD_SET_QOS_MAPNL80211_CMD_ADD_TX_TSNL80211_CMD_DEL_TX_TSNL80211_CMD_GET_MPPNL80211_CMD_JOIN_OCBNL80211_CMD_LEAVE_OCBNL80211_CMD_CH_SWITCH_STARTED_NOTIFYNL80211_CMD_TDLS_CHANNEL_SWITCHNL80211_CMD_TDLS_CANCEL_CHANNEL_SWITCHHWSIM_CMD_REGISTERHWSIM_CMD_FRAMEHWSIM_CMD_TX_INFO_FRAMEHWSIM_CMD_NEW_RADIOHWSIM_CMD_DEL_RADIOHWSIM_CMD_GET_RADIOHWSIM_CMD_ADD_MAC_ADDRHWSIM_CMD_DEL_MAC_ADDRHWSIM_CMD_START_PMSRHWSIM_CMD_ABORT_PMSRHWSIM_CMD_REPORT_PMSRNL80211_IFTYPE_ADHOCNL80211_IFTYPE_STATIONNL80211_IFTYPE_APNL80211_IFTYPE_AP_VLANNL80211_IFTYPE_WDSNL80211_IFTYPE_MONITORNL80211_IFTYPE_MESH_POINTNL80211_IFTYPE_P2P_CLIENTNL80211_IFTYPE_P2P_GONL80211_IFTYPE_P2P_DEVICENL80211_IFTYPE_OCBconstset_commandsrequestcloseerrorwaitforaddr_receiveraddr_transmitterframerx_ratetx_infocookiechannelsradio_idreg_hint_alpha2reg_custom_regreg_strict_regsupport_p2p_deviceuse_chanctxdestroy_radio_on_closeradio_nameno_viffreqtx_info_flagsperm_addriftype_supportcipher_supportmlo_supportpmsr_supportpmsr_requestpmsr_resultpeer_measurementsmax_peersreport_ap_tsfrandomize_mac_addrtype_capaidxcount4addrairtime_weightakm_suitesauth_typebandsbeacon_headbeacon_intervalbeacon_tailbssbss_basic_ratescenter_freq1center_freq2channel_widthch_switch_block_txch_switch_countcipher_suitescipher_suites_pairwisecipher_suite_groupcoalesce_rulecqmdfs_cac_timedfs_regiondtim_periodextended_featuresfeature_flagsframe_matchframe_typefreq_fixedftm_responderftm_responder_statshidden_ssidht_capability_maskdevifnameiftypeinactivity_timeoutinterface_combinationskeyskey_seqkey_typelocal_mesh_power_modemacmac_maskmcast_ratemeasurement_durationmesh_idmesh_paramsmesh_setupmgmt_subtypemntr_flagsmpath_next_hopmpath_infomu_mimo_follow_mac_addrnan_funcnan_master_prefnetns_fdnoack_mapnsspidpmkprivacyprotocol_featuresps_stateradar_eventreason_codereg_alpha2reg_initiatorreg_rulesreg_typerx_frame_typesrx_signal_dbmscan_flagsscan_frequenciesscan_ssidssched_scan_delaysched_scan_intervalsched_scan_matchsched_scan_planssmps_modessidstatus_codesta_infosta_plink_actionsta_tx_powersta_tx_power_settingsta_vlansupported_commandstestdatatid_configtxq_limittxq_memory_limittxq_quantumtx_frame_typesuse_mfpvendor_datavendor_idvendor_subcmdwdevwiphy_antenna_avail_rxwiphy_antenna_avail_txwiphy_antenna_rxwiphy_antenna_txwiphy_bandswiphy_channel_typewiphy_coverage_classwiphy_dyn_ackwiphy_frag_thresholdwiphy_freqwiphy_namewiphy_retry_longwiphy_retry_shortwiphy_rts_thresholdwiphy_tx_power_levelwiphy_tx_power_settingwowlan_triggerswpa_versionssupported_iftypessoftware_iftypesmax_ap_assocmlo_linkssurvey_inforadiosvif_radio_masklink_idmlo_link_disabledmlo_ttlm_dlinkmlo_ttlm_ulinkindexfreq_rangesantenna_maskstartendsnmetricexpirediscovery_retrieshop_countpath_changefrequencytime_txtime_rxext_busynoiseinactive_timerx_bytestx_bytesrx_bytes64tx_bytes64rx_packetstx_packetsbeacon_rxt_offsettx_bitraterx_bitratellidplidplink_statetx_retriestx_failedbeacon_lossrx_drop_miscsta_flagslocal_pmpeer_pmnonpeer_pmchain_signalchain_signal_avgtid_statsbss_paramrx_durationtx_durationack_signalack_signal_avgairtime_link_metricconnected_to_asconnected_to_gateconnected_timeassoc_at_boottimebeacon_signal_avgexpected_throughputcts_protshort_preambleshort_slot_timerx_msdutx_msdutx_msdu_retriestx_msdu_failedtxq_statsbacklog_bytesbacklog_packetsflowsdropsecn_marksoverlimitcollisionsbitratebitrate3240_mhz_widthshort_givht_mcsvht_nsshe_mcshe_nsshe_gihe_dcmhe_ru_alloceht_mcseht_nsseht_giwidth_40width_80width_80p80width_160width_320width_10width_5bssidstatuslast_seen_boottimetsfcapabilitysignal_mbmsignal_unspecseen_ms_agoinformation_elementsbeacon_iescoalesce_rule_conditioncoalesce_rule_delaycoalesce_rule_pkt_patternanydisconnectmagic_pktgtk_rekey_failureeap_ident_request4way_handshakerfkill_releasetcp_connectionpkt_patternoffsetsrc_ipv4src_portdst_ipv4dst_portdst_macdata_payloaddata_intervalwake_maskwake_payloaddata_payload_seqdata_payload_tokenfreqsratesht_mcs_setht_capaht_ampdu_factorht_ampdu_densityvht_mcs_setvht_capaiftype_dataedmg_channelsedmg_bw_configiftypeshe_cap_mache_cap_phyhe_cap_mcs_sethe_cap_ppehe_6ghz_capavendor_elemseht_cap_maceht_cap_phy2ghz_shortpreambledisabledno_irno_ibssradarmax_tx_powerdfs_statedfs_timeno_ht40_minusno_ht40_plusno_80mhzno_160mhzindoor_onlyir_concurrentno_20mhzno_10mhzwmmno_he1mhz2mhz4mhz8mhz16mhzcw_mincw_maxaifsntxoptidspsintervaliterationsibssmanagedapap_vlanwdsmonitormesh_pointp2p_clientp2p_gooutside_bss_contextreg_rule_flagsfreq_range_startfreq_range_endfreq_range_max_bwpower_rule_max_ant_gainpower_rule_max_eirpaddrreqchanresphost_timefinalftmget_ap_tsfnum_bursts_expburst_periodnum_ftmr_retriesburst_durationftms_per_burstasaprequest_civiclocrequest_lcipreamblenon_trigger_basedlmr_feedbackbss_colorservice_idpublish_typepublish_bcastsubscribe_activefollow_up_idfollow_up_req_idfollow_up_destclose_rangeservice_infosrfrx_match_filtertx_match_filterinstance_idterm_reasonincludebf_idxbfmac_addrsfcsfailplcpfailcontrolother_bsscook_framesactiveskip_txenable_vendor_syncretry_timeoutconfirm_timeoutholding_timeoutmax_peer_linksmax_retrieselement_ttlauto_open_plinkshwmp_max_preq_retriespath_refresh_timemin_discovery_timeouthwmp_active_path_timeouthwmp_preq_min_intervalhwmp_net_diam_trvs_timehwmp_rootmodehwmp_rann_intervalgate_announcementsforwardingsync_offset_max_neighborrssi_thresholdhwmp_path_to_root_timeouthwmp_root_intervalhwmp_confirmation_intervalpower_modeawake_windowplink_timeoutnolearndefaultcipherenabledlimitsmaxnumsta_ap_bi_matchnum_channelsradar_detect_widthstypesmaxsuccess_numpartial_numfailed_numnon_asap_numtotal_duration_msecunknown_triggers_numreschedule_requests_numout_of_window_triggers_numcqm_pkt_loss_eventcqm_rssi_hystcqm_rssi_levelcqm_rssi_tholdcqm_rssi_threshold_event$p$uGEV*,yV}2uI0 ĉ ؉@( L   @  0@T`x@   Њ܊    `(8L |X(X\SdlL|5@ @/ċ $ȋ ؋9, I<JTh X^x | W̍ 3؉@[Ȍ@eԌ<  ~*0 4<DxX DQp  x@7 k؍# \p @)  $ ,0 H Tdp| `R@F]6!Ȏ0Ԏ" 1d ,(-<Hw\p  @z4@H |ď؏2 E X, <8 8 D Xcd Bt|@xrqĐjܐi 'Y$<?L&dp>|=@baБu 4K  y 08@ TL KX M` 9p &d؋b'FxH@I@ X DВؒܒ( (0<8 vD(L\ht   8ȓ 8ԓܓ  $ 0<DP`t  '"#)(l+Ԕ&*0 DP`px | ̕ԕܕ h `x$08 @HPX`lt|  ̖ Ԗ ܖ $0 HTl  ̗  4 Ȓ@@ $ 0< HT \@ l |@ @ @  Ș И ܘ  , < L T ` l| @  pwԙ 0 @ L |Xdt ȚКؚ w@   $,8 D H L v`p| |ԛ ܛ  \ ܖ x @ &؋x   $4HXh p  x̜@؜ 0 @ d L \ T `p@ ̝ԝ 0@Pd\h|    ܞ  0DPl|ȟԟԔXx@ @x@ $4DX `   $,8 D H L v dp|Ġ ܠ  ,<Vuuu|ulu\uLu  } "   % i!" $ $$U$$]$D$#p$`$P$@$0$( $$$#T#5####%#Y#Gp#g`#tP#I@#0# ##"#"""6"f""""p"h`"P"@"0"1 "E"""!}!." !A!!r!!_fini__cxa_finalize__deregister_frame_info__register_frame_info_ucv_string_getucv_string_lengthuclient_writeuc_vm_stack_peekuloop_initucv_typecallocucv_property_getuclient_newucv_array_lengthucv_array_getucv_getucv_array_setucv_resource_newuclient_freeucv_resource_dataptruc_vm_stack_pushuc_vm_callucv_putuc_vm_stack_popucv_int64_newuclient_pending_bytesuclient_requestucv_resource_datauclient_http_set_ssl_ctxuclient_new_ssl_contextucv_object_getucv_is_truishucv_boolean_newuclient_set_urluclient_set_proxy_urlucv_int64_getuclient_set_timeoutuclient_connectuclient_disconnectuclient_http_set_request_typeuclient_http_reset_headersuclient_http_set_headerucv_to_string__stack_chk_guarducv_object_newucv_object_adduclient_get_addrucv_string_new__stack_chk_failuclient_readucv_stringbuf_new_ucv_stringbuf_appenducv_stringbuf_finishuclient_http_redirectuc_module_initucv_cfunction_newucv_resource_type_adducv_array_newuc_vm_registry_setuc_module_entrylibuclient.solibubox.so.20260213libgcc_s.so.1libc.soGLIBC_2.0ii (?????????????????????????? A' '<'!'A@@ D@ T&$$A '<|'!@A$ T&$A`@2mb`3`3M4g`24m`3ml3ml Je$a`3뢤DD55mc`3m#e`3m4b31lK ijej @2iedgPL$g:e@ pT e@:eeg8e@gvdejv @2idҚe `\gMX@:eDdjej6 @2iedgn8ҁ I@9e9en@ n9e@ 8*Pe *P\@:eje*PX *tp\@:ere a ,p\@:ere `jp\@:ere`X,ml@:e"ge"p@M@:ee"XJ@p@$M@:ee"XbJAp@$M@:ee"X"JBp@DM@:ee"Xb JCp@DM@:ee"XJDPL @:ePLe @:egDe:e@g Ҟe*0g@8ev 3X *H@:e Ҟej * j`PT@:ee"* *X T@:eegpP @:eIX *񜚞e@8eHydJej @2ide"$3g$F@=eeXn*pP@:e e@=e0𸘞eg@=eudj @2idŜe2fL2gIHDM@:e H"g@8ej@udejU @2ie dgX*4X*PT@:eҞef"gp@ @:eҞe\"gp\@:eJZeR` T@:e蘢g?ee@gTe@:e蘢g?ee@gTe@:e蘞egg@?ee-"gT@:e蘞egg@?een@mg@:ee"'AMg@?eei"g@8eQgvdn\g@:e"geej5 @2iedgXJ@:ee8e@gddj @2iegd OnM@?eDdej @2iegd On$M@?eDdej @2iegd OnDM@?eDdejU @2iedgҐL$gg5@:e H8eDM@gudej @2ide3gҊL5@:eg 𸘓X$MJ@:egp\e@:ere `i@8eQgvdpT@:ee"jI!O J@?eieeju @2id3eJRagmT@:e*X J@:ee *J J@8eud mj @2id圚e2fL2gI0\DM@:eDdej @2iedgX$gJ@:e X Jng@:e  e "3G "P nom@:ejeGFpL @:eҞet" F Gِ@ndM@:eҞeK*@ nd M@:eҞeV*@ ndM@:egeW*i@ nM@:ege"@@:e"g gJ@:ePe  g@:eel@8ezdPL@:eg %A@:ee" @=ejGFjPL@:eg %B@:ee"p\@:ereaH@:e Ҟej jaiPT@:eҞe"PL@:eg %C@:eeJej @2iedgX8J I@:en9e@n@9e e*jwdp\@:erea ,PL@:e"gPLe @:eegDg@:ee*l@8ep\@:ere`ej4 @2iedgX8J I@:en9e@n@9e e*jwdp\@:erea ,PL@:e"gPLe @:eegDg@:ee*l@8ep\@:ere`ejt @2iedgXJ@:e"gX J n@:eҞe)jvdp\@:ereaPP@:egHeg@:ee*l@8ej @2iedgXJ@:ee*jddgL@:ee*l@8eej @2iedgXJ@:ee "P𠘂g@=eel@8eddjt @2iedgX8J I@:en9e@n9e@ PLe @:ege*jyd%S jJX@:ee*pH@:ep@e$M@:e"geS"gp\@:ekne* p\g@:ere?aD"$%x =$%x ;$%x :$%x 8$%x 7$%x 6$%x 4$%x 3$%x 2$%x 1$%x 0$%x /$%x .$%x -$%x ,$%x +$%x *$%x )$%x ($%x '$%x &$%x %$%x #$%x "$%x !$%x  $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x  $%x  $%x  $%x  $%x  $%x $%x $%x $' 'data_readget_post_datadata_eofheader_doneerroruclientcert_filekey_fileca_filesverifyeofstatusredirectlocal_addrlocal_portremote_addrremote_portuclient.registrynewfreessl_initset_urlset_proxy_urlset_timeoutget_headersconnectdisconnectrequestreadt%I%&&&u$&]0&8&ED&%%]L&I A} $$$$$$$p$`$P$@$0$ $$$########p#`#P#@#0# ###""""""""p"`"P"@"0" """!!!!!!! A07070101AE2185000081ED0000000000000000000000016A426C280000519A000000FE0000000000000000000000000000001700000000usr/lib/ucode/uloop.soELF4t4 (pDDN^^000  QtdRtdN^^     A^^P p  `lPppp p peppooLooaeW7 2/6BE,HV 9=80(LI?T5$@ <!-C ^+QDb& d);UYFO1K>M' %"*#NP.3_:c]R\GJAXaZ` M=:8" !V A ru<" AjA}AAAAxAdhAXA"HA08A(A A>A @@@@@:@^@@x@h@=X@H@U8@T(@L@@o?????|??\?x?Lh?X?H?Q8?(???>>>"6>>>>>x>gh>X>H>8>(>>>V==t==M=(=9=D=x="hh=~X={H=8=)(==." =<(<<?<<<<_fini__cxa_finalize__deregister_frame_info__register_frame_infouloop_cancelleduc_vm_signal_dispatchucv_resource_dataucv_int64_newucv_boolean_newuloop_interval_remaininguc_vm_stack_peek__errno_locationucv_int64_getuloop_interval_setwritekillucv_resource_value_getucv_getuloop_timeout_remaining64uloop_timeout_setucv_typeuc_vm_registry_getuc_vm_registry_setuloop_doneuloop_cancellinguloop_run_timeoutstrerrorucv_string_newuloop_initclosestderrfputsabortuc_vm_calluc_vm_exception_objectuc_vm_stack_pushuc_vm_stack_popucv_putucv_uint64_new__stack_chk_guardread__stack_chk_failjson_tokener_parse_exjson_tokener_get_errorjson_tokener_freejson_object_putjson_tokener_newucv_from_jsondup2ucv_object_newucv_resource_type_adducv_cfunction_newucv_object_adducv_resource_type_lookupucv_resource_new_exucv_resource_value_set_ucv_string_getstrncasecmpuc_system_signal_namesstrcasecmpucv_to_numberuloop_signal_addforkucv_array_lengthcallocucv_object_lengthprintbuf_newsprintbufucv_to_stringbuf_formatted_exitucv_to_stringexecvpeucv_array_getuloop_process_adducv_property_getucv_uint64_getuloop_fd_adduloop_interval_canceluloop_process_deleteuloop_timeout_cancelprintbuf_memsetmemcpyprintbuf_freepipefdopenucv_resource_newucv_array_newucv_array_setuloop_signal_deleteuloop_fd_deleteuc_module_inituc_vm_signal_notifyfduc_module_entry__environlibubox.so.20260213libgcc_s.so.1libc.soGLIBC_2.0ii ^^^^^^^^___ _____ _$_(_,_0_4_8_<_@_D_H_L_P_T_X_\_`_d_h_l_p_t_x_|_________________________________a' '<˜'!'a@d@d D@ D$$a '<ʜ'!@a$ D$jY @2iegkPX`jPܠej9 @2iedgXJH@:e"Pj@ddej @2idŜe2fL2I\g0X@:eDdej @2iedgXJ(M@:exeg*kpddkpܠ5@8ejy @2iedgXJ(M@:exeg*kpddkpܥ@8ej @2iedgXJHM@:exeg*kpddkp܉@8eej @2iedgXJHM@:exeg*kpddkp܈@8eejy @2iedgXJH M@:exeg*kpddkp @8ej9 @2iedgXJH M@:exe*jPjdd $jۆ5@8eej @2iedgXJHM@:exeg*kpddkp܆5@8eejx @2iedgXJhM@:exeg*kpddkp܃5@8eej @2iedgXJ(M@:exeg*kpddkp܇B0PL@:eegg@8ej @2idҚe `\gM\@:eDdjejx @2iedgXJ(M:e@$gXCJng@:e 8e*jPjwdpT@:ej@ e"gPT@:ege@*pX:e@LZep٘g@8emej @2ide%gg(j\g @gg@:eaBe +\gpT@:e@re`judECjx @2iedgXJH M@:e8e*jPjvd h#jTm@:eJe*p@8e@lP@8eej @2iedgXJhM@:exeg*kpddkp܁Pm@:ePeg@8eej @2iedgXJhM@:exe*kpedBDL@:elݞegg@8ej8 @2iedgXJhM:e@$gXCJng@:e 8e*jPjwdpT@:ej@ e"gPT@:ege@*@:e@LZep٘g@8emejx @2ide\gL@:eJZDd XgjX @2iedgXnCJ@:e"g e*D M@:ePeg@8eud)PHg@:ep e?eM@gel@8eXgJ@:ee*ej @2iedgp@"PH@:ege@?ePHe@:eeg@?e H2IeJaX Jm@:ee "@@:e eg@8evdPH@:eeg@?eIeej @2iegdndOmL@?eDdjw @2iegdDM@=eDdejW @2iegdDM@=eDdej @2iedgP\$g:eg@m Pe@:e Pe@:e dO ?e A@ne@=ee@=e e@8eydj @2iedgҐT@ @ j@@ iD@g@:eaBe+pT@:e@re`pT@:e@e *pT@:eke`GM)*=jjxPj #0ZaJjji-.@*ra0@nMg@:e0\eg@:eҞe𨘑g@=ees"pT@:eke5^an ҢgD@@:e Je*pT@:e@re`!𨘑g@=eepP@:eeq *pT@:e ke`@,*)\@:e"ge*T𘘠PDL@:ePe@8e0@ g@:e0\eg@:eҞe kfH @:e @pPe@:eej@zdjw @2iedgXJHM@:e"gj)jPjvdH* jX# Jn@:edH o@8eej @2iedg$gPLL@:egJe "p@g@:ePeg@8eudej @2ie dgLl:e@'g,1e)(Bn *p @8evd@g0X@:eeg0D@:eQgeej*`/jl+r aPnN3# kk5lPĠj @2ideg&g %pD@:ege*jxdPT o@:e Ҟe"  @PH@:e O?em@APHe@:eP emg@8e jw @2ied$%x =$%x ;$%x 9$%x 8$%x 7$%x 6$%x 5$%x 4$%x 3$%x 2$%x 1$%x 0$%x /$%x .$%x -$%x ,$%x +$%x *$%x )$%x ($%x '$%x &$%x %$%x $$%x #$%x "$%x !$%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x  $%x  $%x  $%x  $%x  $%x $' 'uloop.signaluloop.intervaluloop.pipeuloop.taskuloop.processuloop.handleuloop.timeruloop.ex_handlerOut of memory /dev/nullSIG%s=filenowULOOP_READULOOP_WRITEULOOP_EDGE_TRIGGERULOOP_BLOCKINGerrorinitruntimerhandleprocesstaskcancellingrunningdoneendintervalsignalguardsignodeletesetremainingexpirationscancelsendreceivesendingreceivingpidkillfinishedTC CCC( C,(C)0C38CDCyLCMTCXC'dC&lCtC%|CM8CqCC}C.C1C$C%CCCCyC-|C9B C|C8CCeC90a=:AAAAAAxAhAXAHA8A(AAA@@@@@@@@x@h@X@H@8@(@@@????????x?h?X?H?8?(???>>>>>>>>x>h>X>H>8>(>>>========x=h=X=H=8=(===<<<<<<<a07070101AE23BC000081ED0000000000000000000000016A426C2800002096000000FE0000000000000000000000000000001500000000usr/lib/ucode/log.soELF4t4 (p00..`000  QtdRtd..  h ..PD$  0xppp p p"ppooXoo"     !h  N9" Wh   =" ^q0pU`P@~0 D'7"o]"?."p`_fini__cxa_finalize__deregister_frame_info__register_frame_infouc_vm_stack_peekucv_typeuc_stdlib_function_ucv_string_getulogucv_putucv_boolean_newucv_to_stringfreestrcasecmpucv_int64_get__errno_locationulog_closesnprintfucv_array_getucv_array_lengthucv_uint64_getulog_opencloselogsyslogopenlogulog_thresholduc_module_initucv_cfunction_newucv_object_adducv_int64_newuc_module_entrylibubox.so.20260213libgcc_s.so.1libc.soGLIBC_2.0ii ............................//// /(/0/8/@/H/P/X/`/h/p/x/////////////////0' '<`'!'0@@ Dt@t ,$$0 '<쥜'!@0$ ,$j @2idҚe `\gMpH@:eDdjejt @2ie dgXnAJ:e@$ggPTe@:eeQ"r1a0XL@:eg@:e Ҟe?"0\ @:e𸘐e?e#M@g e@=eelp@8ewdHg@:e"ge"g#M@?e0𴘞eg@=eelj @2ide\gnXaJ@:eDdjt @2ide\gnXaJ@:eDdjT @2ide\gnXaJ@:eDdj4 @2ide\gnXaJ@:eDdj @2iedgPT@:ere)`r`9"jK0\ @:eҞei"X,3JIҠpD@:ee*AvdIqaP@ @:ePe8e@"g@"r`QQg`jjT @2iedgPT@:ere)`r`9"jK0\ @:eҞei"X,3%JIҠpD@:ee*AvdIqaP@ @:ePe8e@"g@"r`QQg`jj @2iegdP@9e@ng"gPTe@:ee"r2a0XL@:eC@:e Ҟe"0\ @:ePe?e#M@g e@=eelp@8ewdHg@:e"ge"Pg#M@?e0𴘞eg@=eej @2iedgXnAJ@:egXaJ@:e n@:eg PTe@:ereb`Z`"r`jKvraj-PD @:e 0\e @:e Ҟe"8IGA!J pD @:ee*aIm JaJҐ@ @:eCean@:egXJ@:eegJ"AF@*lp@8eyd0\ @:eҞei"X,3JIҠpD@:ee*AIqaP@ @:e"gPHe@:e@"r`QѮ`mjp @?elejs @2iedgXnAJ@:egXJ@:egJe*lp@8edd@=eleej @2iedgXnAJ:e@%ggXJ@:eegJ"Y`pl@8eud aHA@8ej @2iedgX%gJ jT  D@:e egp\g@:eJeJJ*p@lm@:e𸘞egp\gCM@:ep@elm@:e𸘞egp\gCM@:ep@elm@:e𸘞egp\gCM@:ep@elm@:e𸘞egp\gcM@:ep@elm@:e𸘞egp\gc M@:ep@e lm@:e𸘞egp\gcM@:ep@ePlm@:e𸘞egp\gM@:ep@eHlm@:e𸘞egp\gM@:ep@elm@:e𸘞egp\gM@:ep@eXlm@:e𸘞egp\g M@:ep@elm@:e𸘞egp\gM@:ep@e0lm@:e𸘞egp\gM@:ep@elm@:e𸘞egp\gM@:ep@e8lm@:e𸘞egp\gM@:ep@e(lm@:e𸘞egp\gM@:ep@elm@:e𸘞egp\g M@:ep@e@lm@:e𸘞egp\gM@:ep@elm@:e𸘞egp\gM@:ep@elm@:e𸘞egp\gM@:ep@elm@:e𸘞egp\gM@:ep@elm@:e𸘞egp\g#M@:ep@elm@:e𸘞egp\g#M@:ep@elm@:e𸘞egp\gCM@:ep@elm@:e𸘞egp\gC M@:ep@elm@:e𸘞egp\gCM@:ep@elm@:e𸘞egp\gcM@:ep@elm@:e𸘞egp\gcM@:ep@elm@:e𸘞egp\gcM@:ep@elm@:e𸘞egp\gM@:ep@elm@:e𸘞egp\gM@:ep@elm@:e𸘞egp\gM@:ep@elm@:e𸘞egp\gM@:ep@elm@:e𸘞egp\gM@:ep@elm@:e𸘞egp\gM@:ep@elm@:e𸘞egp\g M@:ep@elm@:epeg8eM@gwdej @2iegd0@?eDde%x !$%x  $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x  $%x  $%x  $%x  $%x  $%x $%x $%x $' 'sprintf%skmsgsyslogstdioLOG_PIDLOG_CONSLOG_NDELAYLOG_ODELAYLOG_NOWAITLOG_AUTHLOG_AUTHPRIVLOG_CRONLOG_DAEMONLOG_FTPLOG_KERNLOG_LPRLOG_MAILLOG_NEWSLOG_SYSLOGLOG_USERLOG_UUCPLOG_LOCAL0LOG_LOCAL1LOG_LOCAL2LOG_LOCAL3LOG_LOCAL4LOG_LOCAL5LOG_LOCAL6LOG_LOCAL7LOG_EMERGLOG_ALERTLOG_CRITLOG_ERRLOG_WARNINGLOG_NOTICELOG_INFOLOG_DEBUGULOG_KMSGULOG_SYSLOGULOG_STDIOopenlogcloselogulog_openulogulog_closeulog_thresholdNOTEWARNemergalertcriterrwarningnoticeinfodebugauthauthprivcrondaemonftpkernlprmailnewsuseruucplocal0local1local2local3local4local5local6local7pidconsndelayodelaynowait 0  = y ( 0} U (088@HPT\dlt |PHX080(@ $09p`P@0 p`007070101AE2183000081ED0000000000000000000000016A426C2800004146000000FE0000000000000000000000000000001500000000usr/lib/ucode/uci.soELF4t4 (pp7p7P?POPO 000((QtdRtdP?POPO   5POTOX   P ppp p pFp poo` oo CF> )E9/A*'%&:$2 !7 "- 3 85.#6@4,1;0=(+CD<B? a0" j 5 1" 15/|54l5\5L5z<5I,55o 5444|4Q4}44W4|4>l4\4gL4G<4!,4N4 43(333333$3"|3l3\3L3^<3p,3D3 3222P2k202A2"2|2l2\2."L2U<2,2<2 2_fini__cxa_finalize__deregister_frame_info__register_frame_infouci_free_context__stack_chk_guarduc_vm_registry_getucv_int64_getucv_string_newuc_vm_registry_delete__stack_chk_failsnprintfuc_vm_stack_peekmemcpyucv_array_newucv_array_pushstrtoulucv_int64_newuci_lookup_ptrmemsetuci_saveuci_commituci_revertucv_typeucv_to_stringucv_array_lengthucv_array_getucv_boolean_getstrdupstderrfputsabortucv_object_newucv_boolean_newucv_object_adducv_resource_dataptr_ucv_string_getstrcmpuci_add_sectionuc_vm_registry_setuci_deletefreeuci_del_listuci_add_listuci_loaduci_reorder_sectionuci_list_configsuci_unloaducv_getuc_vm_stack_pushuc_vm_calluc_vm_stack_popucv_putuci_alloc_contextucv_resource_type_lookupucv_resource_newuci_set_confdiruci_set_savediruci_set_conf2dirucv_is_truishuci_renameuci_setuci_lookup_nextuc_module_initucv_cfunction_newucv_resource_type_adduc_module_entrylibuci.so.20250120libubox.so.20260213libgcc_s.so.1libc.soGLIBC_2.0ii POTOXO`OhOlOpOtOxO|OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOPPP PPPPDQ' '<'!'PQ@@ D@ l7$$PQ '<\'!@TQ$ l7$j @2iegd@=eDdej @2iedg0@@XJg ҐL@:egPLe@:egj XJ XeJ XJ XJXJX&JX&J0'_`7GGYJ}H@:e"gL e@:ee`n"@8e0DؘFNg$m@:egeiQgpdj @2idҚe `\gML@:eDdjej @2iedg%gPn M @:eEe*jzdP\@:eҞe"DH28JiH@:eg0He@:eHe@:eg0He@:ee$H@:eg0He@:ee$Dra@ nm@:egHem@:ee0g@8eH@:eej @2i de$gg.%C,*G*"@@r'a\gP(n@:e jem \gpDng@:e"ge*\gP(ng@:eQg{d\gpDgng@:e"gej7 @2i degҐT%g(nm@:eqe `q`@8e0n@8e{d 0 j @2i dejg'g@/P @:ere8`Z `" @8e @j@ZaraT @:ee*judPX m@:e gPe@:ere`!j@ ji@ۿpP @:ee"𘘆 L\@:ee*pT𘘠PDL@:ee@8e𘘆Lj @2ideEg"r `jvd\gH@:e\gP\@:eҞe"&G@J."\gH@:ege\g0H@:e ejw @2iedgҰT&g@:eҞeW" D@:e𸘞egLM@:e He@:e𸘞egLM@:e He@:e𸘞egLM@:eQeaHg#5@:e𸘞egLM@:e $ J.*vdC Xg" J@:eegL@:e jw @2id圚e2fL2gIXM@:eDdej7 @2iedgX8 JI@:en9e@n9e@ j ҐP e@:ere`lmGP @:erea@ @JalC PH@:egHe@:ee "  "@8exd @PH@:eegp@ g@:ege"5H@:eeMg@8ejj @2iedgX8 JI@:e9en@9en@ 9en@ gҐTem(n@:eP e@:e8reI`lm;P @:erea $P@:ereaPH @:ePHe @:e e"PH @:enXBJ@:ege"5H@:eegg@8ej}d "*l\@:ege*Lg@:eel@8ej @2ie dgX8 JI@:e9en@ 9en@ 9en@ 9en@ "ggҐTem(n@:eP e@:erXJe`lm8P @:ereaP @:ereaPH @:ePHe @:ePHe @:e nXBJ@:ege"C5H@:ee8e@gj~d*lX"J g@:ee"[* @:e"ge0@=ee!g#5iL@:eel@8eej @2iegd0ܟcO@?eDdej @2iegdܟcO@?eDdej @2ie d*PH @:egXeg @:ee-"@5H@:e𸘞eMg@8ej~dC PH@:egHe@:ee"  $ J.*lH PH@:egHe@:ee" \gXJ *L@:ee@8ePH @:eCPHe @:e nрXBJ@:ege "C5H@:eegjl*lmL@:e" H@8ej @2iedgX8 JI@:e9en@9en@ 9en@  g ҐTem(n@:eP e@:e8reI`lmH@:eegg@8ej}dP @:ereaP@:ereaPL@:eSeaPH @:ePHe @:e nXBJ@:ege"5-lp\@:ege*Lg@:eel@8eej @2iedgX%g J@:e XJng@:e Ҟe "gP@:ere`lmH@:eeMg@8ej zd T@:ege"C5T@:e ҞejI )0@=e eM@8e J*  i@ j@JMaZ* ZXg ҐX@:ee9%lGE)Jn*nGE1Jn"P\@:eҞe:*Hlm@:eeMg@?eePH @:egHeg@:ee"JH@:ee*@j Ұ.GC1J.*,GE)J.-* "pH@:ee"i L@:eeXBJg@:ege"0H@:ee XBJg@:ege"0H@:ee  "jһej5 @2iedgX J@:e"gXJn@:e Ҟe!g@*Hml@:e𸘞eMg@8ejxdP@:ereaPH @:e @e@j` H@:ee%*pH@:eeX n@:ee|gxK"@H5@:eegL@:eel@8eej @2iedgX J@:e"gXJn@:e Ҟe!g@*Hlm@:eeMg@8ejwdP@:erea@@`j aLM@:ele' CPH@:egHe@:ee*pH@:eLeM@:ele@8ej @2ied*N*^*LM@:ePTeM@:ege"0@8ePH @:eg@e@:e"ge"@=ege#5PH@:egHe@:e"ge"PH@:egpXe@:e"ge"P@:ere,aDBj '* fOl mFۆiX @:ex,1IK%ea" mi m j  Bg LCҐH@:ee"H𘘱gL@:ee"iwej @2iedgX8 JI@:e9en@9en@ j gҐTem(n@:ePe@:e8reI`lmH@:eegg@8ej}dP @:erearW`raLm@:e Lem@:e P e@:erea P@:ereaPH@:ePHe @:e e"PH @:eePH @:enXBJ@:ege"5Lm@:ege Ҽ*"l{D@:ege*Lg@:eel@8eqej @2iedgX8 JI@:e9en@9en@ gҐTiem(n:e@ ;P e@:ere`lmH@:eeMg@8ej~dP @:erearF`raLm@:e Lem@:e eҐP@:ereaPH @:ePHe @:e e"PH @:enXBJ@:ege"5Lm@:eҞeg*"lX"J  @:ee"[z"T@:er8ge3)0@=ee*jT@:eCe5aLM@:eel@8eW\@:ege"PP@:e0e=e@"gje!g#5"PX@:eg o@:ee"\@:e0e=e@"ge)JPP@:e0e=e@"ge!ejT @2ie dgX J@:e"gXJn@:eg je Z$P@:erXgXJ Xge"lHm@:e eg@8ejyd@ PH@:eegpLg @:ee* .lXJ@:eҞe\g8I`"C5gH@:egegT @:eҞe"@5H@:e𸘞eMg $j@*0@=elemj pLg @:ee* .K I/0@=eeXJ@:ee"Lg@:eel@8edej @2ide\gnXJ@:eDdjs @2ide\gnXJ@:eDdj3 @2ide\gnXJ@:eDdj @2iedgX%g JgX M@:eegLg@:eX JgXeM@:eegLg@:eTel@:e8jeiIҀP𴙂g XI@:e egL@:eJJe*OM@8ewdj3 @2iegd0@?eDde%x E$%x D$%x C$%x B$%x @$%x >$%x =$%x <$%x ;$%x 9$%x 7$%x 6$%x 5$%x 4$%x 3$%x 2$%x 1$%x 0$%x /$%x .$%x -$%x ,$%x +$%x *$%x ($%x '$%x &$%x %$%x $$%x #$%x "$%x !$%x  $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x  $%x  $%x  $%x  $%x  $%x $%x $' 'uci.errorOut of memoryInvalid argumentEntry not foundI/O errorParse errorDuplicate entryUnknown errorUnknown error: %daddremovesetrenameorderlist-addlist-del10Out of memory .anonymous.type.name.indexuci.cursorstrictprint_errorsloadunloadgetget_allget_firstsavedeletelist_appendlist_removecommitrevertreorderchangesforeachconfigs@666"6#677T6`6,d6U*707$7107<70D70L7T7m \7$d7%' 6T6X6`6d6l6t66DQ05|5l5\5L5<5,55 544444444|4l4\4L4<4,44 433333333|3l3\3L3<3,33 322222222|2l2\2L2<2,22 2DQ07070101AE232B000081ED0000000000000000000000016A426C28000081BA000000FE0000000000000000000000000000001800000000usr/lib/ucode/digest.soELF4t4 (prrDDDv000QtdRtdDDD o}  jDHH d  @4ppp pHpdp pNoooo<ad'DJ@HMBL 1c42T$5WbVE`0O?]G, ZX/N;<>[ S!A IK&P76+*aQ\"%.^#-UY9:=(_FR8C3)   )u ]m Fe 6Z" Za =\ ]^ R !u ]^ + (p ieU gm ~]i a%p `1U5 ( M4h @q  g !. % 5u+} =\ #u Ud I=-u e?h Za ? },  V3 t!# q. . ". "p !Ud '. 1%.  p P}hm 1X j> Ud u 1X m&u 8e Qp Wi aWi .e j .4- u IV 6= +*. 2 f l !]u HWV -- !]i q?a _h  ]^ *p ]4 1+B f1" va jjppj`jPjV@j.0j jjj"iiWiEi_ii}i"Bi."D_fini__cxa_finalize__deregister_frame_info__register_frame_info__stack_chk_guarducv_type__stack_chk_fail_ucv_string_getucv_string_newucv_string_lengthuc_vm_stack_peekMD5DataSHA1DataSHA256DataMD2DataMD4DataSHA384DataSHA512DataMD5FileSHA1FileSHA256FileMD2FileMD4FileSHA384FileSHA512Fileuc_module_initucv_cfunction_newucv_object_adduc_module_entryMD2EndmallocMD2FinalMD2FileChunkMD2Initopen__fstat_time64closelseekreadMD2Update__errno_locationMD4EndMD4FinalMD4FileChunkMD4InitMD4UpdateMD5EndMD5FinalMD5FileChunkMD5InitMD5UpdateSHA1EndSHA1FinalSHA1FileChunkSHA1InitSHA1UpdateSHA256EndSHA256FinalSHA256FileChunkSHA256InitSHA256UpdateSHA384EndSHA384FinalSHA384FileChunkSHA384InitSHA384UpdateSHA512EndSHA512FinalSHA512FileChunkSHA512InitSHA512UpdatememsetMD2TransformmemcpyMD4TransformMD4PadMD5TransformMD5PadSHA1TransformSHA1Pad__lshrdi3SHA224InitSHA256TransformSHA224TransformSHA224UpdateSHA256PadSHA224PadSHA224FinalSHA512TransformSHA512_256TransformSHA384TransformSHA512_256UpdateSHA512PadSHA512_256PadSHA384PadSHA512_256InitSHA512_256Finallibgcc_s.so.1libc.soGCC_3.0GLIBC_2.0oP&y ii DHLPTX\`dhlptx|ďȏ̏Џԏ؏܏' ' @2ideg@ ҐDp @=e @@60T em@:eRe a-*P\ @:eJe*0P @:eej o#p@ @2iedgҐ$'Ր@=e!  @ge'@?eT e@:e!e#p @8esdj @2ied"@jkCCIL|gXgpT*`@@C ` i `C @?epL2I㑘cxgPIqE ei \g@IMg@?ee U@ZW;`:55.! @ILE`)Ca\ggp\,1@:ePq%CXgi0Q` Ca g@?ep,2I㱘@"4cxgPqvd `C\gg@?eP`BCXgQeJpҪ`)Cj @2idge4?jL55-! @ILP`)Ca\ggp\@:e ` Ca g@?eP,1Iᑘ#xgPq +#`RaBCXgrSvd `C\gg@?eP`BCXgepQ *[`RaBCXgrSJҟ`)CjU @2idge4jL0H^*VO8Җ}vktEpYdq [e-`%Fai4@~UG#Q:\κ&,S n( AMRj7l${ Jxcm;9fXwruK 1DPۙ3,+!1"dLȣ_UQSok#@Yw8>(9S%^,+,Ł-؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlg jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqTjjj5jMjjkm kkk k,k-8keDk`kPkTkXk\kdklktk|kkkkkkkkk "a%Q(*"1%q!'*},1++aM4-2e?4=]W1UeUq !]WZ!##ggUd%m&f]()u+=-34>?IV1X=\]^ejjpj`jPj@j0j jjjiiiiiiii07070101AE2046000041ED00000000000000000000000F6A426C2800000000000000FE0000000000000000000000000000000A00000000usr/share07070101AE2171000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001200000000usr/share/libubox07070101AE2172000081A40000000000000000000000016A426C2800001D91000000FE0000000000000000000000000000001A00000000usr/share/libubox/jshn.sh# functions for parsing and generating json _json_get_var() { # dest=$1 # var=$2 eval "$1=\"\$${JSON_PREFIX}$2\"" } _json_set_var() { # var=$1 local ___val="$2" eval "${JSON_PREFIX}$1=\"\$___val\"" } __jshn_raw_append() { # var=$1 local value="$2" local sep="${3:- }" eval "export -- \"$1=\${$1:+\${$1}\${value:+\$sep}}\$value\"" } _jshn_append() { # var=$1 local _a_value="$2" eval "${JSON_PREFIX}$1=\"\${${JSON_PREFIX}$1}\${${JSON_PREFIX}$1:+ }\$_a_value\"" } _get_var() { # var=$1 # value=$2 eval "$1=\"\$$2\"" } _set_var() { # var=$1 local __val="$2" eval "$1=\"\$__val\"" } _json_inc() { # var=$1 # dest=$2 let "${JSON_PREFIX}$1 += 1" "$2 = ${JSON_PREFIX}$1" } _json_add_generic() { # type=$1 # name=$2 # value=$3 # cur=$4 local var if [ "${4%%[0-9]*}" = "J_A" ]; then _json_inc "S_$4" var else var="${2//[^a-zA-Z0-9_]/_}" [[ "$var" == "$2" ]] || export -- "${JSON_PREFIX}N_${4}_${var}=$2" fi export -- \ "${JSON_PREFIX}${4}_$var=$3" \ "${JSON_PREFIX}T_${4}_$var=$1" _jshn_append "JSON_UNSET" "${4}_$var" _jshn_append "K_$4" "$var" } _json_add_table() { # name=$1 # type=$2 # itype=$3 local cur seq _json_get_var cur JSON_CUR _json_inc JSON_SEQ seq local table="J_$3$seq" _json_set_var "U_$table" "$cur" export -- "${JSON_PREFIX}K_$table=" unset "${JSON_PREFIX}S_$table" _json_set_var JSON_CUR "$table" _jshn_append "JSON_UNSET" "$table" _json_add_generic "$2" "$1" "$table" "$cur" } _json_close_table() { local _s_cur _json_get_var _s_cur JSON_CUR _json_get_var "${JSON_PREFIX}JSON_CUR" "U_$_s_cur" } json_set_namespace() { local _new="$1" local _old="$2" [ -n "$_old" ] && _set_var "$_old" "$JSON_PREFIX" JSON_PREFIX="$_new" } json_cleanup() { local unset tmp _json_get_var unset JSON_UNSET for tmp in $unset J_V; do unset \ ${JSON_PREFIX}U_$tmp \ ${JSON_PREFIX}K_$tmp \ ${JSON_PREFIX}S_$tmp \ ${JSON_PREFIX}T_$tmp \ ${JSON_PREFIX}N_$tmp \ ${JSON_PREFIX}$tmp done unset \ ${JSON_PREFIX}JSON_SEQ \ ${JSON_PREFIX}JSON_CUR \ ${JSON_PREFIX}JSON_UNSET } json_init() { json_cleanup export -n ${JSON_PREFIX}JSON_SEQ=0 export -- \ ${JSON_PREFIX}JSON_CUR="J_V" \ ${JSON_PREFIX}K_J_V= } json_add_object() { _json_add_table "$1" object T } json_close_object() { _json_close_table } json_add_array() { _json_add_table "$1" array A } json_close_array() { _json_close_table } json_add_string() { local cur _json_get_var cur JSON_CUR _json_add_generic string "$1" "$2" "$cur" } json_push_string() { local cur _json_get_var cur JSON_CUR [ "${cur%%[0-9]*}" = "J_A" ] || { [ -n "$_json_no_warning" ] || \ echo "WARNING: Not in an array" >&2 return 1 } _json_add_generic string "" "$1" "$cur" } json_add_int() { local cur _json_get_var cur JSON_CUR _json_add_generic int "$1" "$2" "$cur" } json_push_int() { local cur _json_get_var cur JSON_CUR [ "${cur%%[0-9]*}" = "J_A" ] || { [ -n "$_json_no_warning" ] || \ echo "WARNING: Not in an array" >&2 return 1 } _json_add_generic int "" "$1" "$cur" } json_add_boolean() { local cur _json_get_var cur JSON_CUR _json_add_generic boolean "$1" "$2" "$cur" } json_push_boolean() { local cur _json_get_var cur JSON_CUR [ "${cur%%[0-9]*}" = "J_A" ] || { [ -n "$_json_no_warning" ] || \ echo "WARNING: Not in an array" >&2 return 1 } _json_add_generic boolean "" "$1" "$cur" } json_add_double() { local cur _json_get_var cur JSON_CUR _json_add_generic double "$1" "$2" "$cur" } json_push_double() { local cur _json_get_var cur JSON_CUR [ "${cur%%[0-9]*}" = "J_A" ] || { [ -n "$_json_no_warning" ] || \ echo "WARNING: Not in an array" >&2 return 1 } _json_add_generic double "" "$1" "$cur" } json_add_null() { local cur _json_get_var cur JSON_CUR _json_add_generic null "$1" "" "$cur" } json_push_null() { local cur _json_get_var cur JSON_CUR [ "${cur%%[0-9]*}" = "J_A" ] || { [ -n "$_json_no_warning" ] || \ echo "WARNING: Not in an array" >&2 return 1 } _json_add_generic null "" "" "$cur" } json_add_fields() { while [ "$#" -gt 0 ]; do local field="$1" shift local name="${field%%=*}" local val="${field#*=}" [ "$name" != "$val" ] || val="" local type="${name#*:}" [ "$type" != "$name" ] || type=string name="${name%%:*}" case "$type" in string|int|boolean|double) local cur _json_get_var cur JSON_CUR _json_add_generic "$type" "$name" "$val" "$cur" ;; esac done } json_get_index() { local __dest="$1" local __cur __parent __seq _json_get_var __cur JSON_CUR _json_get_var __parent "U_$__cur" if [ "${__parent%%[0-9]*}" != "J_A" ]; then [ -n "$_json_no_warning" ] || \ echo "WARNING: Not inside an array" >&2 return 1 fi __seq="S_$__parent" eval "export -- \"$__dest=\${$__seq}\"; [ -n \"\${$__seq+x}\" ]" } # functions read access to json variables json_compact() { JSON_NONEWLINE=1 JSON_INDENT= } json_pretty() { JSON_NONEWLINE= JSON_INDENT=1 } json_load() { eval "`jshn -r "$1"`" } json_load_file() { eval "`jshn -R "$1"`" } json_dump() { jshn "$@" ${JSON_PREFIX:+-p "$JSON_PREFIX"} ${JSON_NONEWLINE:+-n} ${JSON_INDENT:+-i} -w } json_get_type() { # target=$2 local __dest="$1" local __cur _json_get_var __cur JSON_CUR local __var="${JSON_PREFIX}T_${__cur}_${2//[^a-zA-Z0-9_]/_}" eval "export -- \"$__dest=\${$__var}\"; [ -n \"\${$__var+x}\" ]" } json_get_keys() { local __dest="$1" local _tbl_cur if [ -n "$2" ]; then json_get_var _tbl_cur "$2" else _json_get_var _tbl_cur JSON_CUR fi local __var="${JSON_PREFIX}K_${_tbl_cur}" eval "export -- \"$__dest=\${$__var}\"; [ -n \"\${$__var+x}\" ]" } json_get_values() { local _v_dest="$1" local _v_keys _v_val _select= local _json_no_warning=1 unset "$_v_dest" [ -n "$2" ] && { json_select "$2" || return 1 _select=1 } json_get_keys _v_keys set -- $_v_keys while [ "$#" -gt 0 ]; do json_get_var _v_val "$1" __jshn_raw_append "$_v_dest" "$_v_val" shift done [ -n "$_select" ] && json_select .. return 0 } json_get_var() { local __dest="$1" local __cur _json_get_var __cur JSON_CUR local __var="${JSON_PREFIX}${__cur}_${2//[^a-zA-Z0-9_]/_}" eval "export -- \"$__dest=\${$__var:-$3}\"; [ -n \"\${$__var+x}\${3+x}\" ]" } json_get_vars() { while [ "$#" -gt 0 ]; do local _var="$1"; shift if [ "$_var" != "${_var#*:}" ]; then json_get_var "${_var%%:*}" "${_var%%:*}" "${_var#*:}" else json_get_var "$_var" "$_var" fi done } json_select() { local target="$1" local type local cur [ -z "$target" ] && { _json_set_var JSON_CUR "J_V" return 0 } [[ "$target" == ".." ]] && { _json_get_var cur JSON_CUR _json_get_var cur "U_$cur" _json_set_var JSON_CUR "$cur" return 0 } json_get_type type "$target" case "$type" in object|array) json_get_var cur "$target" _json_set_var JSON_CUR "$cur" ;; *) [ -n "$_json_no_warning" ] || \ echo "WARNING: Variable '$target' does not exist or is not an array/object" >&2 return 1 ;; esac } json_is_a() { # target=$1 # type=$2 local type json_get_type type "$1" [ "$type" = "$2" ] } json_for_each_item() { [ "$#" -ge 2 ] || return 0 local function="$1"; shift local target="$1"; shift local type val json_get_type type "$target" case "$type" in object|array) local keys key json_select "$target" json_get_keys keys for key in $keys; do json_get_var val "$key" eval "$function \"\$val\" \"\$key\" \"\$@\"" done json_select .. ;; *) json_get_var val "$target" eval "$function \"\$val\" \"\" \"\$@\"" ;; esac } 07070101AE21A5000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001100000000usr/share/udhcpc07070101AE21A6000081ED0000000000000000000000016A426C2800000544000000FE0000000000000000000000000000002000000000usr/share/udhcpc/default.script#!/bin/sh [ -z "$1" ] && echo "Error: should be run by udhcpc" && exit 1 set_classless_routes() { local max=128 local type while [ -n "$1" -a -n "$2" -a $max -gt 0 ]; do [ ${1##*/} -eq 32 ] && type=host || type=net echo "udhcpc: adding route for $type $1 via $2" route add -$type "$1" gw "$2" dev "$interface" max=$(($max-1)) shift 2 done } setup_interface() { echo "udhcpc: ip addr add $ip/${subnet:-255.255.255.0} broadcast ${broadcast:-+} dev $interface" ip addr add $ip/${subnet:-255.255.255.0} broadcast ${broadcast:-+} dev $interface [ -n "$router" ] && [ "$router" != "0.0.0.0" ] && [ "$router" != "255.255.255.255" ] && { echo "udhcpc: setting default routers: $router" local valid_gw="" for i in $router ; do route add default gw $i dev $interface valid_gw="${valid_gw:+$valid_gw|}$i" done eval $(route -n | awk ' /^0.0.0.0\W{9}('$valid_gw')\W/ {next} /^0.0.0.0/ {print "route del -net "$1" gw "$2";"} ') } # CIDR STATIC ROUTES (rfc3442) [ -n "$staticroutes" ] && set_classless_routes $staticroutes [ -n "$msstaticroutes" ] && set_classless_routes $msstaticroutes } applied= case "$1" in deconfig) ip -4 addr flush dev "$interface" ;; renew) setup_interface update ;; bound) setup_interface ifup ;; esac # user rules [ -f /etc/udhcpc.user ] && . /etc/udhcpc.user exit 0 07070101AE23CA000041ED0000000000000000000000036A426C2800000000000000FE0000000000000000000000000000000F00000000usr/share/luci07070101AE23CB000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001600000000usr/share/luci/menu.d07070101AE2425000081A40000000000000000000000016A426C28000004D9000000FE0000000000000000000000000000002D00000000usr/share/luci/menu.d/luci-app-firewall.json{ "admin/network/firewall": { "title": "Firewall", "order": 60, "action": { "type": "alias", "path": "admin/network/firewall/zones" }, "depends": { "acl": [ "luci-app-firewall" ], "fs": { "/sbin/fw3": "executable" }, "uci": { "firewall": true } } }, "admin/network/firewall/zones": { "title": "General Settings", "order": 10, "action": { "type": "view", "path": "firewall/zones" } }, "admin/network/firewall/forwards": { "title": "Port Forwards", "order": 20, "action": { "type": "view", "path": "firewall/forwards" } }, "admin/network/firewall/rules": { "title": "Traffic Rules", "order": 30, "action": { "type": "view", "path": "firewall/rules" } }, "admin/network/firewall/snats": { "title": "NAT Rules", "order": 40, "action": { "type": "view", "path": "firewall/snats" } }, "admin/network/firewall/ipsets": { "title": "IP Sets", "order": 45, "action": { "type": "view", "path": "firewall/ipsets" } }, "admin/network/firewall/custom": { "title": "Custom Rules", "order": 50, "action": { "type": "view", "path": "firewall/custom" }, "depends": { "fs": { "/usr/share/fw3/helpers.conf": "file" } } } } 07070101AE2438000081A40000000000000000000000016A426C280000074C000000FE0000000000000000000000000000002C00000000usr/share/luci/menu.d/luci-mod-network.json{ "admin/network/switch": { "title": "Switch", "order": 20, "action": { "type": "view", "path": "network/switch" }, "depends": { "acl": [ "luci-mod-network-config" ], "fs": { "/sbin/swconfig": "executable" }, "uci": { "network": { "@switch": true } } } }, "admin/network/wireless": { "title": "Wireless", "order": 15, "action": { "type": "view", "path": "network/wireless" }, "depends": { "acl": [ "luci-mod-network-config" ], "uci": { "wireless": { "@wifi-device": true } } } }, "admin/network/remote_addr/*": { "action": { "type": "call", "module": "luci.controller.admin.network", "function": "remote_addr" } }, "admin/network/network": { "title": "Interfaces", "order": 10, "action": { "type": "view", "path": "network/interfaces" }, "depends": { "acl": [ "luci-mod-network-config" ] } }, "admin/network/routes": { "title": "Routing", "order": 30, "action": { "type": "view", "path": "network/routes" }, "depends": { "acl": [ "luci-mod-network-config" ] } }, "admin/network/dhcp": { "title": "DHCP", "order": 40, "action": { "type": "view", "path": "network/dhcp" }, "depends": { "acl": [ "luci-mod-network-dhcp" ], "fs": [ { "/usr/sbin/odhcpd": "executable" }, { "/usr/sbin/dnsmasq": "executable" } ], "uci": { "dhcp": true } } }, "admin/network/dns": { "title": "DNS", "order": 45, "action": { "type": "view", "path": "network/dns" }, "depends": { "acl": [ "luci-mod-network-dns" ], "fs": { "/usr/sbin/dnsmasq": "executable" }, "uci": { "dhcp": true } } }, "admin/network/diagnostics": { "title": "Diagnostics", "order": 50, "action": { "type": "view", "path": "network/diagnostics" }, "depends": { "acl": [ "luci-mod-network-diagnostics" ] } } } 07070101AE24C7000081A40000000000000000000000016A426C280000024F000000FE0000000000000000000000000000003700000000usr/share/luci/menu.d/luci-app-attendedsysupgrade.json{ "admin/system/attendedsysupgrade": { "title": "Attended Sysupgrade", "order": 60, "action": { "type": "firstchild" }, "depends": { "acl": [ "luci-app-attendedsysupgrade" ], "uci": { "attendedsysupgrade": true } } }, "admin/system/attendedsysupgrade/overview": { "title": "Overview", "order": 1, "action": { "type": "view", "path": "attendedsysupgrade/overview" } }, "admin/system/attendedsysupgrade/configuration": { "title": "Configuration", "order": 2, "action": { "type": "view", "path": "attendedsysupgrade/configuration" } } } 07070101AE244B000081A40000000000000000000000016A426C2800000CFB000000FE0000000000000000000000000000002B00000000usr/share/luci/menu.d/luci-mod-status.json{ "admin/status/overview": { "title": "Overview", "order": 1, "action": { "type": "template", "path": "admin_status/index" }, "depends": { "acl": [ "luci-mod-status-index" ] } }, "admin/status/routes": { "title": "Routing", "order": 2, "action": { "type": "view", "path": "status/routes" }, "depends": { "acl": [ "luci-mod-status-routes" ], "fs": [ { "/usr/libexec/ip-tiny": "absent", "/usr/libexec/ip-full": "absent" } ] } }, "admin/status/routesj": { "title": "Routing", "order": 2, "action": { "type": "view", "path": "status/routesj" }, "depends": { "acl": [ "luci-mod-status-routes-json" ], "fs": [ { "/usr/libexec/ip-tiny": "executable" }, { "/usr/libexec/ip-full": "executable" } ] } }, "admin/status/iptables": { "title": "Firewall", "order": 3, "action": { "type": "view", "path": "status/iptables" }, "depends": { "acl": [ "luci-mod-status-firewall" ], "fs": [ { "/usr/sbin/nft": "absent", "/usr/sbin/iptables": "executable" }, { "/usr/sbin/nft": "absent", "/usr/sbin/ip6tables": "executable" } ] } }, "admin/status/nftables": { "title": "Firewall", "order": 3, "action": { "type": "view", "path": "status/nftables" }, "depends": { "acl": [ "luci-mod-status-firewall" ], "fs": { "/usr/sbin/nft": "executable" } } }, "admin/status/nftables/iptables": { "action": { "type": "view", "path": "status/iptables" } }, "admin/status/logs": { "title": "System Log", "order": 4, "action": { "type": "alias", "path": "admin/status/logs/syslog" }, "depends": { "acl": [ "luci-mod-status-logs" ] } }, "admin/status/logs/syslog": { "title": "System Log", "order": 1, "action": { "type": "view", "path": "status/syslog" } }, "admin/status/logs/dmesg": { "title": "Kernel Log", "order": 2, "action": { "type": "view", "path": "status/dmesg" } }, "admin/status/processes": { "title": "Processes", "order": 6, "action": { "type": "view", "path": "status/processes" }, "depends": { "acl": [ "luci-mod-status-processes" ] } }, "admin/status/channel_analysis": { "title": "Channel Analysis", "order": 7, "action": { "type": "view", "path": "status/channel_analysis" }, "depends": { "acl": [ "luci-mod-status-channel_analysis" ], "uci": { "wireless": { "@wifi-device": true } } } }, "admin/status/realtime": { "title": "Realtime Graphs", "order": 7, "action": { "type": "alias", "path": "admin/status/realtime/load" }, "depends": { "acl": [ "luci-mod-status-realtime" ] } }, "admin/status/realtime/load": { "title": "Load", "order": 1, "action": { "type": "view", "path": "status/load" } }, "admin/status/realtime/bandwidth": { "title": "Bandwidth", "order": 2, "action": { "type": "view", "path": "status/bandwidth" } }, "admin/status/realtime/wireless": { "title": "Wireless", "order": 3, "action": { "type": "view", "path": "status/wireless" }, "depends": { "uci": { "wireless": { "@wifi-device": true } } } }, "admin/status/realtime/connections": { "title": "Connections", "order": 4, "action": { "type": "view", "path": "status/connections" } } } 07070101AE2420000081A40000000000000000000000016A426C28000000CF000000FE0000000000000000000000000000003400000000usr/share/luci/menu.d/luci-app-package-manager.json{ "admin/system/package-manager": { "title": "Software", "order": 30, "action": { "type": "view", "path": "package-manager" }, "depends": { "acl": [ "luci-app-package-manager" ] } } } 07070101AE23CC000081A40000000000000000000000016A426C28000009FD000000FE0000000000000000000000000000002500000000usr/share/luci/menu.d/luci-base.json{ "admin": { "title": "Administration", "order": 10, "action": { "type": "firstchild", "recurse": true }, "auth": { "methods": [ "cookie:sysauth_https", "cookie:sysauth_http" ], "login": true } }, "admin/status": { "title": "Status", "order": 10, "action": { "type": "firstchild", "preferred": "overview", "recurse": true } }, "admin/system": { "title": "System", "order": 20, "action": { "type": "firstchild", "preferred": "system", "recurse": true } }, "admin/services": { "title": "Services", "order": 40, "action": { "type": "firstchild", "recurse": true } }, "admin/network": { "title": "Network", "order": 50, "action": { "type": "firstchild", "recurse": true } }, "admin/vpn": { "title": "VPN", "order": 70, "action": { "type": "firstchild", "recurse": true } }, "admin/translations/*": { "action": { "type": "function", "module": "luci.controller.admin.index", "function": "action_translations" }, "auth": {} }, "admin/ubus/*": { "action": { "type": "function", "module": "luci.controller.admin.index", "function": "action_ubus" }, "auth": {} }, "admin/logout": { "title": "Log out", "order": 999, "action": { "type": "function", "module": "luci.controller.admin.index", "function": "action_logout" }, "depends": { "acl": [ "luci-base" ] }, "firstchild_ineligible": true }, "admin/uci": { "action": { "type": "firstchild" } }, "admin/uci/revert": { "action": { "type": "function", "module": "luci.controller.admin.uci", "function": "action_revert", "post": true } }, "admin/uci/apply_rollback": { "cors": true, "action": { "type": "function", "module": "luci.controller.admin.uci", "function": "action_apply_rollback", "post": true }, "auth": { "methods": [ "cookie:sysauth_https", "cookie:sysauth_http" ] } }, "admin/uci/apply_unchecked": { "cors": true, "action": { "type": "function", "module": "luci.controller.admin.uci", "function": "action_apply_unchecked", "post": true }, "auth": { "methods": [ "cookie:sysauth_https", "cookie:sysauth_http" ] } }, "admin/uci/confirm": { "cors": true, "action": { "type": "function", "module": "luci.controller.admin.uci", "function": "action_confirm" }, "auth": {} }, "admin/menu": { "action": { "type": "function", "module": "luci.controller.admin.index", "function": "action_menu" }, "auth": {} } } 07070101AE2471000081A40000000000000000000000016A426C2800000AFF000000FE0000000000000000000000000000002B00000000usr/share/luci/menu.d/luci-mod-system.json{ "admin/system/system": { "title": "System", "order": 1, "action": { "type": "view", "path": "system/system" }, "depends": { "acl": [ "luci-mod-system-config" ] } }, "admin/system/admin": { "title": "Administration", "order": 2, "action": { "type": "firstchild" }, "depends": { "acl": [ "luci-mod-system-config", "luci-mod-system-ssh" ] } }, "admin/system/admin/password": { "title": "Router Password", "order": 1, "action": { "type": "view", "path": "system/password" }, "depends": { "acl": [ "luci-mod-system-config" ] } }, "admin/system/admin/dropbear": { "title": "SSH Access", "order": 2, "action": { "type": "view", "path": "system/dropbear" }, "depends": { "acl": [ "luci-mod-system-ssh" ], "fs": { "/usr/sbin/dropbear": "executable" } } }, "admin/system/admin/sshkeys": { "title": "SSH-Keys", "order": 3, "action": { "type": "view", "path": "system/sshkeys" }, "depends": { "acl": [ "luci-mod-system-ssh" ], "fs": { "/usr/sbin/dropbear": "executable" } } }, "admin/system/admin/uhttpd": { "title": "HTTP(S) Access", "order": 4, "action": { "type": "view", "path": "system/uhttpd" }, "depends": { "acl": [ "luci-mod-system-uhttpd" ], "fs": { "/usr/sbin/uhttpd": "executable" } } }, "admin/system/admin/repokeys": { "title": "Repo Public Keys", "order": 5, "action": { "type": "view", "path": "system/repokeys" }, "depends": { "acl": [ "luci-mod-system-repokeys" ] } }, "admin/system/startup": { "title": "Startup", "order": 45, "action": { "type": "view", "path": "system/startup" }, "depends": { "acl": [ "luci-mod-system-init" ] } }, "admin/system/crontab": { "title": "Scheduled Tasks", "order": 46, "action": { "type": "view", "path": "system/crontab" }, "depends": { "acl": [ "luci-mod-system-cron" ] } }, "admin/system/mounts": { "title": "Mount Points", "order": 50, "action": { "type": "view", "path": "system/mounts" }, "depends": { "acl": [ "luci-mod-system-mounts" ], "fs": { "/sbin/block": "executable" } } }, "admin/system/leds": { "title": "LED Configuration", "order": 60, "action": { "type": "view", "path": "system/leds" }, "depends": { "acl": [ "luci-mod-system-config" ], "fs": { "/sys/class/leds": "directory" } } }, "admin/system/flash": { "title": "Backup / Flash Firmware", "order": 70, "action": { "type": "view", "path": "system/flash" }, "depends": { "acl": [ "luci-mod-system-flash" ] } }, "admin/system/reboot": { "title": "Reboot", "order": 90, "action": { "type": "view", "path": "system/reboot" }, "depends": { "acl": [ "luci-mod-system-reboot" ] } } } 07070101AE226C000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001200000000usr/share/dnsmasq07070101AE226E000081800000000000000000000000016A426C2800000137000000FE0000000000000000000000000000001F00000000usr/share/dnsmasq/rfc6761.conf# RFC6761 included configuration file for dnsmasq # # includes a list of domains that should not be forwarded to Internet name servers # to reduce burden on them, asking questions that they won't know the answer to. server=/bind/ server=/invalid/ server=/local/ server=/localhost/ server=/onion/ server=/test/ 07070101AE226D000081800000000000000000000000016A426C2800000154000000FE0000000000000000000000000000002900000000usr/share/dnsmasq/dhcpbogushostname.conf# dhcpbogushostname.conf included configuration file for dnsmasq # # includes a list of hostnames that should not be associated with dhcp leases # in response to CERT VU#598349 # file included by default, option dhcpbogushostname 0 to disable dhcp-name-match=set:dhcp_bogus_hostname,localhost dhcp-name-match=set:dhcp_bogus_hostname,wpad 07070101AE231B000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001500000000usr/share/nftables.d07070101AE231C000081A40000000000000000000000016A426C28000003DF000000FE0000000000000000000000000000001C00000000usr/share/nftables.d/READMEThis directory may contain partial nftables files which are automatically included into the nftables ruleset generated by the fw4 program. Only accessible files (no broken symlinks, no files with insufficient permissions) with an `*.nft` file extension are considered. The include position of each file within the overall ruleset is derived from the file path: - Files in ./ruleset-pre/ and ./ruleset-post/ are included before and after the `table inet fw4 { ... }` declaration respectively - Files in ./table-pre/ and ./table-post/ are included before the first chain and after the last chain declaration within the fw4 table respectively - Files in ./chain-pre/${chain}/ and ./chain-post/${chain}/ are included before the first and after the last rule within the mentioned chain of the fw4 table respectively Automatic inclusion of these files can be disabled by setting the global `auto_includes` option to `0` within the defaults section of /etc/config/firewall. 07070101AE2327000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001100000000usr/share/hostap07070101AE2344000081A40000000000000000000000016A426C28000010B5000000FE0000000000000000000000000000001900000000usr/share/hostap/wdev.uc#!/usr/bin/env ucode 'use strict'; import { vlist_new, is_equal, wdev_set_mesh_params, wdev_remove, wdev_set_up, phy_open } from "/usr/share/hostap/common.uc"; import { readfile, writefile, basename, readlink, glob } from "fs"; let libubus = require("ubus"); let keep_devices = {}; let phy_name = shift(ARGV); let command = shift(ARGV); let phy, phydev; function iface_stop(wdev) { if (keep_devices[wdev.ifname]) return; wdev_remove(wdev.ifname); } function iface_start(wdev) { let ifname = wdev.ifname; if (readfile(`/sys/class/net/${ifname}/ifindex`)) { wdev_set_up(ifname, false); wdev_remove(ifname); } let wdev_config = {}; for (let key in wdev) wdev_config[key] = wdev[key]; if (!wdev_config.macaddr && wdev.mode != "monitor") wdev_config.macaddr = phydev.macaddr_next(); phydev.wdev_add(ifname, wdev_config); wdev_set_up(ifname, true); let htmode = wdev.htmode || "NOHT"; if (wdev.freq) system(`iw dev ${ifname} set freq ${wdev.freq} ${htmode}`); if (wdev.mode == "adhoc") { let cmd = ["iw", "dev", ifname, "ibss", "join", wdev.ssid, wdev.freq, htmode, "fixed-freq" ]; if (wdev.bssid) push(cmd, wdev.bssid); for (let key in [ "beacon-interval", "basic-rates", "mcast-rate", "keys" ]) if (wdev[key]) push(cmd, key, wdev[key]); system(cmd); } else if (wdev.mode == "mesh") { let cmd = [ "iw", "dev", ifname, "mesh", "join", wdev.ssid ]; if (wdev.freq) { push(cmd, "freq", wdev.freq); if (htmode && htmode != "NOHT") push(cmd, htmode); } for (let key in [ "basic-rates", "mcast-rate", "beacon-interval" ]) if (wdev[key]) push(cmd, key, wdev[key]); system(cmd); wdev_set_mesh_params(ifname, wdev); } } function iface_cb(new_if, old_if) { if (old_if && new_if && is_equal(old_if, new_if)) return; if (old_if) iface_stop(old_if); if (new_if) iface_start(new_if); } function drop_inactive(config) { for (let key in config) { if (!readfile(`/sys/class/net/${key}/ifindex`)) delete config[key]; } } function add_ifname(config) { for (let key in config) config[key].ifname = key; } function delete_ifname(config) { for (let key in config) delete config[key].ifname; } function add_existing(phydev, config) { phydev.for_each_wdev((wdev) => { if (config[wdev]) return; if (trim(readfile(`/sys/class/net/${wdev}/operstate`)) == "down") config[wdev] = {}; }); } function usage() { warn(`Usage: ${basename(sourcepath())} [] Commands: set_config [ - get phy MAC address for vif index `); exit(1); } const commands = { set_config: function(args) { let statefile = `/var/run/wdev-${phy_name}.json`; let new_config = shift(args); for (let dev in ARGV) keep_devices[dev] = true; if (!new_config) usage(); new_config = json(new_config); if (!new_config) { warn("Invalid configuration\n"); exit(1); } let old_config = readfile(statefile); if (old_config) old_config = json(old_config); let config = vlist_new(iface_cb); if (type(old_config) == "object") config.data = old_config; add_existing(phydev, config.data); add_ifname(config.data); drop_inactive(config.data); let ubus = libubus.connect(); let data = ubus.call("hostapd", "config_get_macaddr_list", { phy: phydev.name, radio: phydev.radio ?? -1 }); let macaddr_list = []; if (type(data) == "object" && data.macaddr) macaddr_list = data.macaddr; ubus.disconnect(); phydev.macaddr_init(macaddr_list); add_ifname(new_config); config.update(new_config); drop_inactive(config.data); delete_ifname(config.data); writefile(statefile, sprintf("%J", config.data)); }, get_macaddr: function(args) { let data = {}; for (let arg in args) { arg = split(arg, "=", 2); data[arg[0]] = arg[1]; } let macaddr = phydev.macaddr_generate(data); if (!macaddr) { warn(`Could not get MAC address for phy ${phy_name}\n`); exit(1); } print(macaddr + "\n"); }, }; if (!phy_name || !command | !commands[command]) usage(); let phy_split = split(phy_name, ":"); phydev = phy_open(phy_split[0], phy_split[1]); phy = phydev.phy; if (!phydev) { warn(`PHY ${phy_name} does not exist\n`); exit(1); } commands[command](ARGV); 07070101AE2345000081A40000000000000000000000016A426C28000016BA000000FE0000000000000000000000000000002000000000usr/share/hostap/wifi-detect.uc#!/usr/bin/env ucode 'use strict'; import { readfile, writefile, realpath, glob, basename, unlink, open, rename } from "fs"; import { is_equal } from "/usr/share/hostap/common.uc"; let nl = require("nl80211"); let board_file = "/etc/board.json"; let prev_board_data = json(readfile(board_file)); let board_data = json(readfile(board_file)); function phy_idx(name) { return +rtrim(readfile(`/sys/class/ieee80211/${name}/index`)); } function phy_path(name) { let devpath = realpath(`/sys/class/ieee80211/${name}/device`); devpath = replace(devpath, /^\/sys\/devices\//, ""); if (match(devpath, /^platform\/.*\/pci/)) devpath = replace(devpath, /^platform\//, ""); let dev_phys = map(glob(`/sys/class/ieee80211/${name}/device/ieee80211/*`), basename); sort(dev_phys, (a, b) => phy_idx(a) - phy_idx(b)); let ofs = index(dev_phys, name); if (ofs > 0) devpath += `+${ofs}`; return devpath; } function cleanup() { let wlan = board_data.wlan; for (let name in wlan) if (substr(name, 0, 3) == "phy") delete wlan[name]; else delete wlan[name].info; } function wiphy_get_entry(phy, path) { board_data.wlan ??= {}; let wlan = board_data.wlan; for (let name in wlan) if (wlan[name].path == path) return wlan[name]; wlan[phy] = { path: path }; return wlan[phy]; } function freq_to_channel(freq) { if (freq < 1000) return 0; if (freq == 2484) return 14; if (freq == 5935) return 2; if (freq < 2484) return (freq - 2407) / 5; if (freq >= 4910 && freq <= 4980) return (freq - 4000) / 5; if (freq < 5950) return (freq - 5000) / 5; if (freq <= 45000) return (freq - 5950) / 5; if (freq >= 58320 && freq <= 70200) return (freq - 56160) / 2160; return 0; } function freq_range_match(ranges, freq) { freq *= 1000; for (let range in ranges) { if (freq >= range[0] && freq <= range[1]) return true; } return false; } function wiphy_detect() { let phys = nl.request(nl.const.NL80211_CMD_GET_WIPHY, nl.const.NLM_F_DUMP, { split_wiphy_dump: true }); if (!phys) return; for (let phy in phys) { if (!phy) continue; let name = phy.wiphy_name; let path = phy_path(name); let info = { antenna_rx: phy.wiphy_antenna_avail_rx, antenna_tx: phy.wiphy_antenna_avail_tx, bands: {}, radios: [] }; for (let radio in phy.radios) { // S1G is not supported yet radio.freq_ranges = filter(radio.freq_ranges, (range) => range.end > 2000000 ); if (!length(radio.freq_ranges)) continue; push(info.radios, { index: radio.index, freq_ranges: map(radio.freq_ranges, (range) => [ range.start, range.end ] ), bands: {} }); } let bands = info.bands; for (let band in phy.wiphy_bands) { if (!band || !band.freqs) continue; let freq = band.freqs[0].freq; let band_info = {}; let band_name; if (freq > 50000) band_name = "60G"; else if (freq > 5900) band_name = "6G"; else if (freq > 4000) band_name = "5G"; else if (freq > 2000) band_name = "2G"; else continue; bands[band_name] = band_info; if (band.ht_capa > 0) band_info.ht = true; if (band.vht_capa > 0) band_info.vht = true; let he_phy_cap = 0; let eht_phy_cap = 0; for (let ift in band.iftype_data) { if (!ift.he_cap_phy) continue; band_info.he = true; he_phy_cap |= ift.he_cap_phy[0]; if (!ift.eht_cap_phy) continue; band_info.eht = true; eht_phy_cap |= ift.eht_cap_phy[0]; } if (band_name != "2G" && (he_phy_cap & 0x18) || ((band.vht_capa >> 2) & 0x3)) band_info.max_width = 160; else if (band_name != "2G" && (he_phy_cap & 4) || band.vht_capa > 0) band_info.max_width = 80; else if ((band.ht_capa & 0x2) || (he_phy_cap & 0x2)) band_info.max_width = 40; else band_info.max_width = 20; let modes = band_info.modes = [ "NOHT" ]; if (band_info.ht) push(modes, "HT20"); if (band_info.vht) push(modes, "VHT20"); if (band_info.he) push(modes, "HE20"); if (band_info.eht) push(modes, "EHT20"); if (band.ht_capa & 0x2) { push(modes, "HT40"); if (band_info.vht) push(modes, "VHT40") } if (he_phy_cap & 2) push(modes, "HE40"); if (eht_phy_cap && he_phy_cap & 2) push(modes, "EHT40"); for (let radio in info.radios) { let freq_match = filter(band.freqs, (freq) => freq_range_match(radio.freq_ranges, freq.freq) ); if (!length(freq_match)) continue; let radio_band = {}; radio.bands[band_name] = radio_band; freq_match = filter(freq_match, (freq) => !freq.disabled ); let freq = freq_match[0]; if (freq) radio_band.default_channel = freq_to_channel(freq.freq); } for (let freq in band.freqs) { if (freq.disabled) continue; let chan = freq_to_channel(freq.freq); if (!chan) continue; band_info.default_channel = chan; break; } if (band_name == "2G") continue; if (he_phy_cap & 4) push(modes, "HE40"); if (eht_phy_cap && he_phy_cap & 4) push(modes, "EHT40"); if (band_info.vht) push(modes, "VHT80"); if (he_phy_cap & 4) push(modes, "HE80"); if (eht_phy_cap && he_phy_cap & 4) push(modes, "EHT80"); if ((band.vht_capa >> 2) & 0x3) push(modes, "VHT160"); if (he_phy_cap & 0x18) push(modes, "HE160"); if (eht_phy_cap && he_phy_cap & 0x18) push(modes, "EHT160"); if (eht_phy_cap & 2) push(modes, "EHT320"); } let entry = wiphy_get_entry(name, path); entry.info = info; } } cleanup(); wiphy_detect(); if (!is_equal(prev_board_data, board_data)) { let new_file = board_file + ".new"; unlink(new_file); let f = open(new_file, "wx"); if (!f) exit(1); f.write(sprintf("%.J\n", board_data)); f.close(); rename(new_file, board_file); } 07070101AE2343000081A40000000000000000000000016A426C28000024B3000000FE0000000000000000000000000000001B00000000usr/share/hostap/common.ucimport * as nl80211 from "nl80211"; import * as rtnl from "rtnl"; import { readfile, glob, basename, readlink, open } from "fs"; const iftypes = { ap: nl80211.const.NL80211_IFTYPE_AP, mesh: nl80211.const.NL80211_IFTYPE_MESH_POINT, sta: nl80211.const.NL80211_IFTYPE_STATION, adhoc: nl80211.const.NL80211_IFTYPE_ADHOC, monitor: nl80211.const.NL80211_IFTYPE_MONITOR, }; const mesh_params = { mesh_retry_timeout: "retry_timeout", mesh_confirm_timeout: "confirm_timeout", mesh_holding_timeout: "holding_timeout", mesh_max_peer_links: "max_peer_links", mesh_max_retries: "max_retries", mesh_ttl: "ttl", mesh_element_ttl: "element_ttl", mesh_auto_open_plinks: "auto_open_plinks", mesh_hwmp_max_preq_retries: "hwmp_max_preq_retries", mesh_path_refresh_time: "path_refresh_time", mesh_min_discovery_timeout: "min_discovery_timeout", mesh_hwmp_active_path_timeout: "hwmp_active_path_timeout", mesh_hwmp_preq_min_interval: "hwmp_preq_min_interval", mesh_hwmp_net_diameter_traversal_time: "hwmp_net_diam_trvs_time", mesh_hwmp_rootmode: "hwmp_rootmode", mesh_hwmp_rann_interval: "hwmp_rann_interval", mesh_gate_announcements: "gate_announcements", mesh_sync_offset_max_neighor: "sync_offset_max_neighbor", mesh_rssi_threshold: "rssi_threshold", mesh_hwmp_active_path_to_root_timeout: "hwmp_path_to_root_timeout", mesh_hwmp_root_interval: "hwmp_root_interval", mesh_hwmp_confirmation_interval: "hwmp_confirmation_interval", mesh_awake_window: "awake_window", mesh_plink_timeout: "plink_timeout", mesh_fwding: "forwarding", mesh_power_mode: "power_mode", mesh_nolearn: "nolearn" }; function wdev_remove(name) { nl80211.request(nl80211.const.NL80211_CMD_DEL_INTERFACE, 0, { dev: name }); } function __phy_is_fullmac(phyidx) { let data = nl80211.request(nl80211.const.NL80211_CMD_GET_WIPHY, 0, { wiphy: phyidx }); return !data.software_iftypes.monitor; } function phy_is_fullmac(phy) { let phyidx = int(trim(readfile(`/sys/class/ieee80211/${phy}/index`))); return __phy_is_fullmac(phyidx); } function find_reusable_wdev(phyidx) { if (!__phy_is_fullmac(phyidx)) return null; let data = nl80211.request( nl80211.const.NL80211_CMD_GET_INTERFACE, nl80211.const.NLM_F_DUMP, { wiphy: phyidx }); for (let res in data) if (trim(readfile(`/sys/class/net/${res.ifname}/operstate`)) == "down") return res.ifname; return null; } function wdev_set_radio_mask(name, mask) { nl80211.request(nl80211.const.NL80211_CMD_SET_INTERFACE, 0, { dev: name, vif_radio_mask: mask }); } function wdev_create(phy, name, data) { let phyidx = int(readfile(`/sys/class/ieee80211/${phy}/index`)); wdev_remove(name); if (!iftypes[data.mode]) return `Invalid mode: ${data.mode}`; let req = { wiphy: phyidx, ifname: name, iftype: iftypes[data.mode], }; if (data["4addr"]) req["4addr"] = data["4addr"]; if (data.macaddr) req.mac = data.macaddr; if (data.radio_mask > 0) req.vif_radio_mask = data.radio_mask; else if (data.radio != null && data.radio >= 0) req.vif_radio_mask = 1 << data.radio; nl80211.error(); let reuse_ifname = find_reusable_wdev(phyidx); if (reuse_ifname && (reuse_ifname == name || rtnl.request(rtnl.const.RTM_SETLINK, 0, { dev: reuse_ifname, ifname: name}) != false)) { req.dev = req.ifname; delete req.ifname; nl80211.request(nl80211.const.NL80211_CMD_SET_INTERFACE, 0, req); } else { nl80211.request( nl80211.const.NL80211_CMD_NEW_INTERFACE, nl80211.const.NLM_F_CREATE, req); } let error = nl80211.error(); if (error) return error; if (data.powersave != null) { nl80211.request(nl80211.const.NL80211_CMD_SET_POWER_SAVE, 0, { dev: name, ps_state: data.powersave ? 1 : 0}); } return null; } function wdev_set_mesh_params(name, data) { let mesh_cfg = {}; for (let key in mesh_params) { let val = data[key]; if (val == null) continue; mesh_cfg[mesh_params[key]] = int(val); } if (!length(mesh_cfg)) return null; nl80211.request(nl80211.const.NL80211_CMD_SET_MESH_CONFIG, 0, { dev: name, mesh_params: mesh_cfg }); return nl80211.error(); } function wdev_set_up(name, up) { rtnl.request(rtnl.const.RTM_SETLINK, 0, { dev: name, change: 1, flags: up ? 1 : 0 }); } function phy_sysfs_file(phy, name) { return trim(readfile(`/sys/class/ieee80211/${phy}/${name}`)); } function macaddr_split(str) { return map(split(str, ":"), (val) => hex(val)); } function macaddr_join(addr) { return join(":", map(addr, (val) => sprintf("%02x", val))); } function wdev_macaddr(wdev) { return trim(readfile(`/sys/class/net/${wdev}/address`)); } const phy_proto = { macaddr_init: function(used, options) { this.macaddr_options = options ?? {}; this.macaddr_list = {}; if (type(used) == "object") for (let addr in used) this.macaddr_list[addr] = used[addr]; else for (let addr in used) this.macaddr_list[addr] = -1; this.for_each_wdev((wdev) => { let macaddr = wdev_macaddr(wdev); this.macaddr_list[macaddr] ??= -1; }); return this.macaddr_list; }, macaddr_generate: function(data) { let phy = this.phy; let radio_idx = this.radio; let idx = int(data.id ?? 0); let mbssid = int(data.mbssid ?? 0) > 0; let num_global = int(data.num_global ?? 1); let use_global = !mbssid && idx < num_global; let base_addr = phy_sysfs_file(phy, "macaddress"); if (!base_addr) return null; let base_mask = phy_sysfs_file(phy, "address_mask"); if (!base_mask) return null; if (base_mask == "00:00:00:00:00:00") base_mask = "ff:ff:ff:ff:ff:ff"; if (data.macaddr_base) base_addr = data.macaddr_base; else if (base_mask == "ff:ff:ff:ff:ff:ff" && (radio_idx > 0 || idx >= num_global)) { let addrs = split(phy_sysfs_file(phy, "addresses"), "\n"); if (radio_idx != null) { if (radio_idx && radio_idx < length(addrs)) base_addr = addrs[radio_idx]; else idx += radio_idx * 16; } else { if (idx < length(addrs)) return addrs[idx]; } } if (!idx && !mbssid) return base_addr; let addr = macaddr_split(base_addr); let mask = macaddr_split(base_mask); let type; if (mbssid) type = "b5"; else if (use_global) type = "add"; else if (mask[0] > 0) type = "b1"; else if (mask[5] < 0xff) type = "b5"; else type = "add"; switch (type) { case "b1": if (!(addr[0] & 2)) idx--; addr[0] |= 2; addr[0] ^= idx << 2; break; case "b5": if (mbssid) addr[0] |= 2; addr[5] ^= idx; break; default: for (let i = 5; i > 0; i--) { addr[i] += idx; if (addr[i] < 256) break; addr[i] %= 256; } break; } return macaddr_join(addr); }, macaddr_next: function(val) { let data = this.macaddr_options ?? {}; let list = this.macaddr_list; for (let i = 0; i < 32; i++) { data.id = i; let mac = this.macaddr_generate(data); if (!mac) return null; if (list[mac] != null) continue; list[mac] = val != null ? val : -1; return mac; } }, wdev_add: function(name, data) { let phydev = this; wdev_create(this.phy, name, { ...data, radio: this.radio, }); }, for_each_wdev: function(cb) { let wdevs = nl80211.request( nl80211.const.NL80211_CMD_GET_INTERFACE, nl80211.const.NLM_F_DUMP, { wiphy: this.idx } ); let mac_wdev = {}; for (let wdev in wdevs) { if (wdev.iftype == nl80211.const.NL80211_IFTYPE_AP_VLAN) continue; if (this.radio != null && wdev.vif_radio_mask != null && wdev.vif_radio_mask != (1 << this.radio)) continue; mac_wdev[wdev.mac] = wdev; } for (let wdev in wdevs) { if (!mac_wdev[wdev.mac]) continue; cb(wdev.ifname); } } }; function phy_open(phy, radio) { let phyidx = readfile(`/sys/class/ieee80211/${phy}/index`); if (!phyidx) return null; let name = phy; if (radio === "" || radio < 0) radio = null; if (radio != null) name += "." + radio; return proto({ phy, name, radio, idx: int(phyidx), }, phy_proto); } const vlist_proto = { update: function(values, arg) { let data = this.data; let cb = this.cb; let seq = { }; let new_data = {}; let old_data = {}; this.data = new_data; if (type(values) == "object") { for (let key in values) { old_data[key] = data[key]; new_data[key] = values[key]; delete data[key]; } } else { for (let val in values) { let cur_key = val[0]; let cur_obj = val[1]; old_data[cur_key] = data[cur_key]; new_data[cur_key] = val[1]; delete data[cur_key]; } } for (let key in data) { cb(null, data[key], arg); delete data[key]; } for (let key in new_data) cb(new_data[key], old_data[key], arg); } }; function is_equal(val1, val2) { let t1 = type(val1); if (t1 != type(val2)) return false; if (t1 == "array") { if (length(val1) != length(val2)) return false; for (let i = 0; i < length(val1); i++) if (!is_equal(val1[i], val2[i])) return false; return true; } else if (t1 == "object") { for (let key in val1) if (!is_equal(val1[key], val2[key])) return false; for (let key in val2) if (val1[key] == null) return false; return true; } else { return val1 == val2; } } function vlist_new(cb) { return proto({ cb: cb, data: {} }, vlist_proto); } export { wdev_remove, wdev_create, wdev_set_mesh_params, wdev_set_radio_mask, wdev_set_up, is_equal, vlist_new, phy_is_fullmac, phy_open }; 07070101AE2515000081A40000000000000000000000016A426C2800007AE5000000FE0000000000000000000000000000001C00000000usr/share/hostap/hostapd.uclet libubus = require("ubus"); import { open, readfile, access } from "fs"; import { wdev_remove, is_equal, vlist_new, phy_is_fullmac, phy_open, wdev_set_radio_mask, wdev_set_up } from "common"; let ubus = libubus.connect(null, 60); function ex_handler(e) { e = split(`${e}\n${e.stacktrace[0].context}`, '\n'); for (let line in e) hostapd.printf(line); return libubus.STATUS_UNKNOWN_ERROR; } libubus.guard(ex_handler); hostapd.data.config = {}; hostapd.data.pending_config = {}; hostapd.data.file_fields = { vlan_file: true, wpa_psk_file: true, sae_password_file: true, rxkh_file: true, accept_mac_file: true, deny_mac_file: true, eap_user_file: true, ca_cert: true, server_cert: true, server_cert2: true, private_key: true, private_key2: true, dh_file: true, eap_sim_db: true, }; hostapd.data.iface_fields = { ft_iface: true, upnp_iface: true, snoop_iface: true, bridge: true, iapp_interface: true, }; hostapd.data.bss_info_fields = { // radio hw_mode: true, channel: true, ieee80211ac: true, ieee80211ax: true, // bss bssid: true, ssid: true, wpa: true, wpa_key_mgmt: true, wpa_pairwise: true, auth_algs: true, ieee80211w: true, owe_transition_ifname: true, }; hostapd.data.mld = {}; function iface_remove(cfg) { if (!cfg || !cfg.bss || !cfg.bss[0] || !cfg.bss[0].ifname) return; for (let bss in cfg.bss) if (!bss.mld_ap) wdev_remove(bss.ifname); } function iface_gen_config(config, start_disabled) { let str = `data: ${join("\n", config.radio.data)} channel=${config.radio.channel} `; for (let i = 0; i < length(config.bss); i++) { let bss = config.bss[i]; let type = i > 0 ? "bss" : "interface"; let nasid = bss.nasid ?? replace(bss.bssid, ":", ""); let bssid = bss.bssid; if (bss.mld_ap) bssid += "\nmld_addr=" + bss.mld_bssid; str += ` ${type}=${bss.ifname} bssid=${bssid} ${join("\n", bss.data)} nas_identifier=${nasid} `; if (start_disabled) str += ` start_disabled=1 `; } return str; } function iface_freq_info(iface, config, params) { let freq = params.frequency; if (!freq) return null; let sec_offset = params.sec_chan_offset; if (sec_offset != -1 && sec_offset != 1) sec_offset = 0; let width = 0; for (let line in config.radio.data) { if (!sec_offset && match(line, /^ht_capab=.*HT40/)) { sec_offset = null; // auto-detect continue; } let val = match(line, /^(vht_oper_chwidth|he_oper_chwidth)=(\d+)/); if (!val) continue; val = int(val[2]); if (val > width) width = val; } if (freq < 4000) width = 0; return hostapd.freq_info(freq, sec_offset, width); } function iface_add(phy, config, phy_status) { let config_inline = iface_gen_config(config, !!phy_status); let bss = config.bss[0]; let ret = hostapd.add_iface(`bss_config=${phy}:${config_inline}`); if (ret < 0) return false; if (!phy_status) return true; let iface = hostapd.interfaces[phy]; if (!iface) return false; let freq_info = iface_freq_info(iface, config, phy_status); return iface.start(freq_info) >= 0; } function iface_config_macaddr_list(config) { let macaddr_list = {}; for (let name, mld in hostapd.data.mld) if (mld.macaddr) macaddr_list[mld.macaddr] = -1; for (let i = 0; i < length(config.bss); i++) { let bss = config.bss[i]; if (!bss.default_macaddr) macaddr_list[bss.bssid] = i; } return macaddr_list; } function iface_update_supplicant_macaddr(phydev, config) { let macaddr_list = []; for (let name, mld in hostapd.data.mld) if (mld.macaddr) push(macaddr_list, mld.macaddr); for (let bss in config.bss) push(macaddr_list, bss.bssid); ubus.defer("wpa_supplicant", "phy_set_macaddr_list", { phy: phydev.phy, radio: phydev.radio ?? -1, macaddr: macaddr_list }); } function __iface_pending_next(pending, state, ret, data) { let config = pending.config; let phydev = pending.phydev; let phy = pending.phy; let bss = config.bss[0]; if (pending.defer) pending.defer.abort(); delete pending.defer; switch (state) { case "init": iface_update_supplicant_macaddr(phydev, config); return "create_bss"; case "create_bss": if (!bss.mld_ap) { let err = phydev.wdev_add(bss.ifname, { mode: "ap", radio: phydev.radio, }); if (err) { hostapd.printf(`Failed to create ${bss.ifname} on phy ${phy}: ${err}`); return null; } } pending.call("wpa_supplicant", "phy_status", { phy: phydev.phy, radio: phydev.radio ?? -1, }); return "check_phy"; case "check_phy": let phy_status = data; if (phy_status && phy_status.state == "COMPLETED") { if (iface_add(phy, config, phy_status)) return "done"; hostapd.printf(`Failed to bring up phy ${phy} ifname=${bss.ifname} with supplicant provided frequency`); } pending.call("wpa_supplicant", "phy_set_state", { phy: phydev.phy, radio: phydev.radio ?? -1, stop: true }); return "wpas_stopped"; case "wpas_stopped": if (!iface_add(phy, config)) hostapd.printf(`hostapd.add_iface failed for phy ${phy} ifname=${bss.ifname}`); pending.call("wpa_supplicant", "phy_set_state", { phy: phydev.phy, radio: phydev.radio ?? -1, stop: false }); return null; case "done": default: delete hostapd.data.pending_config[phy]; break; } } function iface_pending_next(ret, data) { let pending = true; let cfg = this; while (pending) { try { this.next_state = __iface_pending_next(cfg, this.next_state, ret, data); if (!this.next_state) { __iface_pending_next(cfg, "done"); return; } } catch(e) { hostapd.printf(`Exception: ${e}\n${e.stacktrace[0].context}`); return; } pending = !this.defer; } } function iface_pending_abort() { this.next_state = "done"; this.next(); } function iface_pending_ubus_call(obj, method, arg) { let ubus = hostapd.data.ubus; let pending = this; this.defer = ubus.defer(obj, method, arg, (ret, data) => { delete pending.defer; pending.next(ret, data) }); } const iface_pending_proto = { next: iface_pending_next, call: iface_pending_ubus_call, abort: iface_pending_abort, }; function iface_pending_init(phydev, config) { let phy = phydev.name; let pending = proto({ next_state: "init", phydev: phydev, phy: phy, config: config, next: iface_pending_next, }, iface_pending_proto); hostapd.data.pending_config[phy] = pending; pending.next(); } function iface_macaddr_init(phydev, config, macaddr_list) { let macaddr_data = { num_global: config.num_global_macaddr ?? 1, macaddr_base: config.macaddr_base, mbssid: config.mbssid ?? 0, }; return phydev.macaddr_init(macaddr_list, macaddr_data); } function iface_restart(phydev, config, old_config) { let phy = phydev.name; let pending = hostapd.data.pending_config[phy]; if (pending) pending.abort(); hostapd.remove_iface(phy); iface_remove(old_config); iface_remove(config); if (!config.bss || !config.bss[0]) { hostapd.printf(`No bss for phy ${phy}`); return; } iface_macaddr_init(phydev, config, iface_config_macaddr_list(config)); for (let i = 0; i < length(config.bss); i++) { let bss = config.bss[i]; if (bss.default_macaddr) bss.bssid = phydev.macaddr_next(); } iface_pending_init(phydev, config); } function array_to_obj(arr, key, start) { let obj = {}; start ??= 0; for (let i = start; i < length(arr); i++) { let cur = arr[i]; obj[cur[key]] = cur; } return obj; } function find_array_idx(arr, key, val) { for (let i = 0; i < length(arr); i++) if (arr[i][key] == val) return i; return -1; } function bss_reload_psk(bss, config, old_config) { if (is_equal(old_config.hash.wpa_psk_file, config.hash.wpa_psk_file)) return; old_config.hash.wpa_psk_file = config.hash.wpa_psk_file; if (!is_equal(old_config, config)) return; let ret = bss.ctrl("RELOAD_WPA_PSK"); ret ??= "failed"; hostapd.printf(`Reload WPA PSK file for bss ${config.ifname}: ${ret}`); } function normalize_rxkhs(txt) { const pat = { sep: "\x20", mac: "([[:xdigit:]]{2}:?){5}[[:xdigit:]]{2}", r0kh_id: "[\x21-\x7e]{1,48}", r1kh_id: "([[:xdigit:]]{2}:?){5}[[:xdigit:]]{2}", key: "[[:xdigit:]]{32,}", r0kh: function() { return "r0kh=" + this.mac + this.sep + this.r0kh_id; }, r1kh: function() { return "r1kh=" + this.mac + this.sep + this.r1kh_id; }, rxkh: function() { return "(" + this.r0kh() + "|" + this.r1kh() + ")" + this.sep + this.key; }, }; let rxkhs = filter( split(txt, "\n"), (line) => match(line, regexp("^" + pat.rxkh() + "$")) ) ?? []; rxkhs = map(rxkhs, function(k) { k = split(k, " ", 3); k[0] = lc(k[0]); if(match(k[0], /^r1kh/)) { k[1] = lc(k[1]); } if(!k[2] = hostapd.rkh_derive_key(k[2])) { return; } return join(" ", k); }); return join("\n", sort(filter(rxkhs, length))); } function bss_reload_rxkhs(bss, config, old_config) { let bss_rxkhs = join("\n", sort(split(bss.ctrl("GET_RXKHS"), "\n"))); let bss_rxkhs_hash = hostapd.sha1(bss_rxkhs); if (is_equal(config.hash.rxkh_file, bss_rxkhs_hash)) { if (is_equal(old_config.hash.rxkh_file, config.hash.rxkh_file)) return; } old_config.hash.rxkh_file = config.hash.rxkh_file; if (!is_equal(old_config, config)) return; let ret = bss.ctrl("RELOAD_RXKHS"); ret ??= "failed"; hostapd.printf(`Reload RxKH file for bss ${config.ifname}: ${ret}`); } function remove_file_fields(config) { return filter(config, (line) => !match(line, /^\s*$/) && !match(line, /^\s*#/) && !hostapd.data.file_fields[split(line, "=")[0]] ); } function bss_remove_file_fields(config) { let new_cfg = {}; for (let key in config) new_cfg[key] = config[key]; new_cfg.data = remove_file_fields(new_cfg.data); new_cfg.hash = {}; for (let key in config.hash) new_cfg.hash[key] = config.hash[key]; delete new_cfg.hash.wpa_psk_file; delete new_cfg.hash.sae_password_file; delete new_cfg.hash.vlan_file; return new_cfg; } function bss_ifindex_list(config) { config = filter(config, (line) => !!hostapd.data.iface_fields[split(line, "=")[0]]); return join(",", map(config, (line) => { try { let file = "/sys/class/net/" + split(line, "=")[1] + "/ifindex"; let val = trim(readfile(file)); return val; } catch (e) { return ""; } })); } function bss_config_hash(config) { return hostapd.sha1(remove_file_fields(config) + bss_ifindex_list(config)); } function bss_find_existing(config, prev_config, prev_hash) { let hash = bss_config_hash(config.data); for (let i = 0; i < length(prev_config.bss); i++) { if (!prev_hash[i] || hash != prev_hash[i]) continue; prev_hash[i] = null; return i; } return -1; } function get_config_bss(name, config, idx) { if (!config.bss[idx]) { hostapd.printf(`Invalid bss index ${idx}`); return; } let ifname = config.bss[idx].ifname; if (!ifname) { hostapd.printf(`Could not find bss ${config.bss[idx].ifname}`); return; } let if_bss = hostapd.bss[name]; if (!if_bss) { hostapd.printf(`Could not find interface ${name} bss list`); return; } return if_bss[ifname]; } function iface_reload_config(name, phydev, config, old_config) { let phy = phydev.name; if (!old_config || !is_equal(old_config.radio, config.radio)) return false; if (is_equal(old_config.bss, config.bss)) return true; if (hostapd.data.pending_config[name]) return false; if (!old_config.bss || !old_config.bss[0]) return false; let iface = hostapd.interfaces[name]; let iface_name = old_config.bss[0].ifname; if (!iface) { hostapd.printf(`Could not find previous interface ${iface_name}`); return false; } if (iface.state() != "ENABLED") { hostapd.printf(`Interface ${iface_name} is not fully configured`); return false; } let first_bss = get_config_bss(name, old_config, 0); if (!first_bss) { hostapd.printf(`Could not find bss of previous interface ${iface_name}`); return false; } let macaddr_list = iface_config_macaddr_list(config); let bss_list = []; let bss_list_cfg = []; let prev_bss_hash = []; for (let bss in old_config.bss) { let hash = bss_config_hash(bss.data); push(prev_bss_hash, bss_config_hash(bss.data)); } // Step 1: find (possibly renamed) interfaces with the same config // and store them in the new order (with gaps) for (let i = 0; i < length(config.bss); i++) { let prev; // For fullmac devices, the first interface needs to be preserved, // since it's treated as the master if (!i && phy_is_fullmac(phy)) { prev = 0; prev_bss_hash[0] = null; } else { prev = bss_find_existing(config.bss[i], old_config, prev_bss_hash); } if (prev < 0) continue; let cur_config = config.bss[i]; let prev_config = old_config.bss[prev]; if (prev_config.force_reload) { delete prev_config.force_reload; continue; } let prev_bss = get_config_bss(name, old_config, prev); if (!prev_bss) return false; // try to preserve MAC address of this BSS by reassigning another // BSS if necessary if ((cur_config.default_macaddr || cur_config.random_macaddr) && cur_config.random_macaddr == prev_config.random_macaddr && cur_config.default_macaddr == prev_config.default_macaddr && !macaddr_list[prev_config.bssid]) { macaddr_list[prev_config.bssid] = i; cur_config.bssid = prev_config.bssid; } bss_list[i] = prev_bss; bss_list_cfg[i] = old_config.bss[prev]; } if (config.mbssid && !bss_list_cfg[0]) { hostapd.printf("First BSS changed with MBSSID enabled"); return false; } // Step 2: if none were found, rename and preserve the first one if (length(bss_list) == 0) { // can't change the bssid of the first bss if (config.bss[0].bssid != old_config.bss[0].bssid) { if (!config.bss[0].default_macaddr) { hostapd.printf(`BSSID of first interface changed: ${lc(old_config.bss[0].bssid)} -> ${lc(config.bss[0].bssid)}`); return false; } config.bss[0].bssid = old_config.bss[0].bssid; } let prev_bss = get_config_bss(name, old_config, 0); if (!prev_bss) return false; macaddr_list[config.bss[0].bssid] = 0; bss_list[0] = prev_bss; bss_list_cfg[0] = old_config.bss[0]; prev_bss_hash[0] = null; } // Step 3: delete all unused old interfaces for (let i = 0; i < length(prev_bss_hash); i++) { if (!prev_bss_hash[i]) continue; let prev_bss = get_config_bss(name, old_config, i); if (!prev_bss) return false; let ifname = old_config.bss[i].ifname; hostapd.printf(`Remove bss '${ifname}' on phy '${name}'`); prev_bss.delete(); if (!old_config.bss[i].mld_ap) wdev_remove(ifname); } // Step 4: rename preserved interfaces, use temporary name on duplicates let rename_list = []; for (let i = 0; i < length(bss_list); i++) { if (!bss_list[i]) continue; let old_ifname = bss_list_cfg[i].ifname; let new_ifname = config.bss[i].ifname; if (old_ifname == new_ifname) continue; if (hostapd.bss[name][new_ifname]) { new_ifname = "tmp_" + substr(hostapd.sha1(new_ifname), 0, 8); push(rename_list, i); } hostapd.printf(`Rename bss ${old_ifname} to ${new_ifname}`); if (!bss_list[i].rename(new_ifname)) { hostapd.printf(`Failed to rename bss ${old_ifname} to ${new_ifname}`); return false; } bss_list_cfg[i].ifname = new_ifname; } // Step 5: rename interfaces with temporary names for (let i in rename_list) { let new_ifname = config.bss[i].ifname; if (!bss_list[i].rename(new_ifname)) { hostapd.printf(`Failed to rename bss to ${new_ifname}`); return false; } bss_list_cfg[i].ifname = new_ifname; } // Step 6: assign BSSID for newly created interfaces macaddr_list = iface_macaddr_init(phydev, config, macaddr_list); for (let i = 0; i < length(config.bss); i++) { if (bss_list[i]) continue; let bsscfg = config.bss[i]; let mac_idx = macaddr_list[bsscfg.bssid]; if (mac_idx < 0) macaddr_list[bsscfg.bssid] = i; if (mac_idx == i) continue; // statically assigned bssid of the new interface is in conflict // with the bssid of a reused interface. reassign the reused interface if (!bsscfg.default_macaddr) { // can't update bssid of the first BSS, need to restart if (!mac_idx < 0) return false; bsscfg = config.bss[mac_idx]; } let addr = phydev.macaddr_next(i); if (!addr) { hostapd.printf(`Failed to generate mac address for phy ${name}`); return false; } bsscfg.bssid = addr; } let config_inline = iface_gen_config(config); // Step 7: fill in the gaps with new interfaces for (let i = 0; i < length(config.bss); i++) { let ifname = config.bss[i].ifname; let bss = bss_list[i]; if (bss) continue; hostapd.printf(`Add bss ${ifname} on phy ${name}`); bss_list[i] = iface.add_bss(config_inline, i); if (!bss_list[i]) { hostapd.printf(`Failed to add new bss ${ifname} on phy ${name}`); return false; } } // Step 8: update interface bss order if (!iface.set_bss_order(bss_list)) { hostapd.printf(`Failed to update BSS order on phy '${name}'`); return false; } // Step 9: update config for (let i = 0; i < length(config.bss); i++) { if (!bss_list_cfg[i]) continue; let ifname = config.bss[i].ifname; let bss = bss_list[i]; if (is_equal(config.bss[i], bss_list_cfg[i])) continue; if (is_equal(bss_remove_file_fields(config.bss[i]), bss_remove_file_fields(bss_list_cfg[i]))) { hostapd.printf(`Update config data files for bss ${ifname}`); if (bss.set_config(config_inline, i, true) < 0) { hostapd.printf(`Could not update config data files for bss ${ifname}`); return false; } else { bss.ctrl("RELOAD_WPA_PSK"); continue; } } bss_reload_psk(bss, config.bss[i], bss_list_cfg[i]); bss_reload_rxkhs(bss, config.bss[i], bss_list_cfg[i]); if (is_equal(config.bss[i], bss_list_cfg[i])) continue; hostapd.printf(`Reload config for bss '${config.bss[0].ifname}' on phy '${name}'`); if (bss.set_config(config_inline, i) < 0) { hostapd.printf(`Failed to set config for bss ${ifname}`); return false; } } return true; } function bss_check_mld(phydev, iface_name, bss) { if (!bss.ifname) return; let mld_data = hostapd.data.mld[bss.ifname]; if (!mld_data || !mld_data.ifname || !mld_data.macaddr) return; bss.mld_bssid = mld_data.macaddr; mld_data.iface[iface_name] = true; if (!access('/sys/class/net/' + bss.ifname, 'x')) mld_data.has_wdev = false; if (mld_data.has_wdev) return true; hostapd.printf(`Create MLD interface ${bss.ifname} on phy ${phydev.name}, radio mask: ${mld_data.radio_mask}`); let err = phydev.wdev_add(bss.ifname, { mode: "ap", macaddr: mld_data.macaddr, radio_mask: mld_data.radio_mask, }); wdev_set_up(bss.ifname, true); if (err) { hostapd.printf(`Failed to create MLD ${bss.ifname} on phy ${phydev.name}: ${err}`); delete mld_data.iface[iface_name]; return; } mld_data.has_wdev = true; return true; } function iface_check_mld(phydev, name, config) { phydev = phy_open(phydev.phy); for (let mld_name, mld_data in hostapd.data.mld) delete mld_data.iface[name]; for (let i = 0; i < length(config.bss); i++) { let bss = config.bss[i]; if (!bss.mld_ap) continue; if (!bss_check_mld(phydev, name, bss)) { hostapd.printf(`Skip MLD interface ${name} on phy ${phydev.name}`); splice(config.bss, i--, 1); } } for (let mld_name, mld_data in hostapd.data.mld) { if (length(mld_data.iface) > 0) continue; hostapd.printf(`Remove MLD interface ${mld_name}`); wdev_remove(mld_name); delete mld_data.has_wdev; } } function iface_config_remove(name, old_config) { hostapd.remove_iface(name); return iface_remove(old_config); } function iface_set_config(name, config) { let old_config = hostapd.data.config[name]; hostapd.data.config[name] = config; let phy = config.phy; let phydev = phy_open(phy, config.radio_idx); if (!phydev) { hostapd.printf(`Failed to open phy ${phy}`); return false; } config.orig_bss = [ ...config.bss ]; iface_check_mld(phydev, name, config); if (!length(config.bss)) return iface_config_remove(name, old_config); try { let ret = iface_reload_config(name, phydev, config, old_config); if (ret) { iface_update_supplicant_macaddr(phydev, config); hostapd.printf(`Reloaded settings for phy ${name}`); return 0; } } catch (e) { hostapd.printf(`Error reloading config: ${e}\n${e.stacktrace[0].context}`); } hostapd.printf(`Restart interface for phy ${name}`); let ret = iface_restart(phydev, config, old_config); return ret; } function config_add_bss(config, name) { let bss = { ifname: name, data: [], hash: {} }; push(config.bss, bss); return bss; } function iface_load_config(phy, radio, filename) { if (radio < 0) radio = null; let config = { phy, radio_idx: radio, radio: { data: [] }, bss: [], orig_file: filename, }; let f = open(filename, "r"); if (!f) return config; let bss; let line; while ((line = rtrim(f.read("line"), "\n")) != null) { let val = split(line, "=", 2); if (!val[0]) continue; if (val[0] == "interface") { bss = config_add_bss(config, val[1]); break; } if (val[0] == "channel") { config.radio.channel = val[1]; continue; } if (val[0] == "#num_global_macaddr") config[substr(val[0], 1)] = int(val[1]); else if (val[0] == "#macaddr_base") config[substr(val[0], 1)] = val[1]; else if (val[0] == "mbssid") config[val[0]] = int(val[1]); push(config.radio.data, line); } while ((line = rtrim(f.read("line"), "\n")) != null) { if (line == "#default_macaddr") bss.default_macaddr = true; if (line == "#random_macaddr") bss.random_macaddr = true; let val = split(line, "=", 2); if (!val[0]) continue; if (val[0] == "bssid") { bss.bssid = lc(val[1]); continue; } if (val[0] == "nas_identifier") bss.nasid = val[1]; if (val[0] == "mld_ap") bss[val[0]] = int(val[1]); if (val[0] == "bss") { bss = config_add_bss(config, val[1]); continue; } if (hostapd.data.file_fields[val[0]]) { if (val[0] == "rxkh_file") { bss.hash[val[0]] = hostapd.sha1(normalize_rxkhs(readfile(val[1]))); } else { bss.hash[val[0]] = hostapd.sha1(readfile(val[1])); } } push(bss.data, line); } f.close(); return config; } function phy_name(phy, radio) { if (!phy) return null; if (radio != null && radio >= 0) phy += "." + radio; return phy; } function bss_config(bss_name) { for (let phy, config in hostapd.data.config) { if (!config) continue; for (let bss in config.bss) if (bss.ifname == bss_name) return [ config, bss ]; } } function mld_rename_bss(data, name) { if (data.ifname == name) return true; // TODO: handle rename gracefully return false; } function mld_add_bss(name, data, phy_list, i) { let config = data.config; if (!config.phy) return; hostapd.printf(`Add MLD interface ${name}`); wdev_remove(name); let phydev = phy_list[config.phy]; if (!phydev) { phydev = phy_open(config.phy, 0); if (!phydev) return; let macaddr_list = {}; let phy_config = hostapd.data.config[phy_name(config.phy, 0)]; if (phy_config) macaddr_list = iface_config_macaddr_list(phy_config); iface_macaddr_init(phydev, data.config, macaddr_list); phy_list[config.phy] = phydev; } data.macaddr = config.macaddr; if (!data.macaddr) { data.macaddr = phydev.macaddr_next(); data.default_macaddr = true; } let radio_mask = 0; for (let r in config.radios) if (r != null) radio_mask |= 1 << r; data.radio_mask = radio_mask; data.ifname = name; } function mld_find_matching_config(list, config) { for (let name, data in list) if (is_equal(data.config, config)) return name; } function mld_reload_interface(name) { let config = hostapd.data.config[name]; if (!config) return; config = { ...config }; config.bss = config.orig_bss; iface_set_config(name, config); } function mld_set_config(config) { let prev_mld = { ...hostapd.data.mld }; let new_mld = {}; let phy_list = {}; let new_config = !length(prev_mld); hostapd.printf(`Set MLD config: ${keys(config)}`); // find renamed/new interfaces for (let name, data in config) { let prev = mld_find_matching_config(prev_mld, data); if (prev) { let data = prev_mld[prev]; if (mld_rename_bss(data, name)) { new_mld[name] = data; delete prev_mld[prev]; continue; } } new_mld[name] = { config: data, iface: {}, }; } let reload_iface = {}; for (let name, data in prev_mld) { delete hostapd.data.mld[name]; if (!data.ifname) continue; for (let iface, bss_list in hostapd.bss) { if (!bss_list[name]) continue; reload_iface[iface] = true; } } for (let name in reload_iface) mld_reload_interface(name); for (let name, data in prev_mld) { if (data.ifname) hostapd.printf(`Remove MLD interface ${name}`); wdev_remove(name); } // add new interfaces hostapd.data.mld = new_mld; for (let name, data in new_mld) if (!data.ifname) mld_add_bss(name, data, phy_list); if (!new_config) return; hostapd.printf(`Reload all interfaces`); for (let name in hostapd.data.config) mld_reload_interface(name); } let main_obj = { reload: { args: { phy: "", radio: 0, }, call: function(req) { let phy_list = req.args.phy ? [ phy_name(req.args.phy, req.args.radio) ] : keys(hostapd.data.config); for (let phy_name in phy_list) { let phy = hostapd.data.config[phy_name]; let config = iface_load_config(phy.phy, phy.radio_idx, phy.orig_file); iface_set_config(phy_name, config); } return 0; } }, apsta_state: { args: { phy: "", radio: 0, up: true, frequency: 0, sec_chan_offset: 0, csa: true, csa_count: 0, }, call: function(req) { let phy = phy_name(req.args.phy, req.args.radio); if (req.args.up == null || !phy) return libubus.STATUS_INVALID_ARGUMENT; let config = hostapd.data.config[phy]; if (!config || !config.bss || !config.bss[0] || !config.bss[0].ifname) return 0; let iface = hostapd.interfaces[phy]; if (!iface) return 0; if (!req.args.up) { iface.stop(); return 0; } let freq_info; if (req.args.frequency) { freq_info = iface_freq_info(iface, config, req.args); if (!freq_info) return libubus.STATUS_UNKNOWN_ERROR; if (req.args.csa) { freq_info.csa_count = req.args.csa_count ?? 10; let ret = iface.switch_channel(freq_info); if (!ret) return libubus.STATUS_UNKNOWN_ERROR; return 0; } } let ret = iface.start(freq_info); if (!ret) return libubus.STATUS_UNKNOWN_ERROR; return 0; } }, config_get_macaddr_list: { args: { phy: "", radio: 0, }, call: function(req) { let phy = phy_name(req.args.phy, req.args.radio); if (!phy) return libubus.STATUS_INVALID_ARGUMENT; let ret = { macaddr: [], }; let config = hostapd.data.config[phy]; if (!config) return ret; ret.macaddr = map(config.bss, (bss) => bss.bssid); return ret; } }, switch_channel: { args: { phy: "", radio: 0, csa_count: 0, sec_channel: 0, oper_chwidth: 0, frequency: 0, center_freq1: 0, center_freq2: 0, }, call: function(req) { let phy = phy_name(req.args.phy, req.args.radio); if (!req.args.frequency || !phy) return libubus.STATUS_INVALID_ARGUMENT; let iface = hostapd.interfaces[phy]; if (!iface) return libubus.STATUS_NOT_FOUND; req.args.csa_count ??= 10; let ret = iface.switch_channel(req.args); if (!ret) return libubus.STATUS_UNKNOWN_ERROR; return 0; }, }, mld_set: { args: { config: {} }, call: function(req) { if (!req.args.config) return libubus.STATUS_INVALID_ARGUMENT; mld_set_config(req.args.config); return { pid: hostapd.getpid() }; } }, config_reset: { args: { }, call: function(req) { for (let name in hostapd.data.config) iface_set_config(name); mld_set_config({}); return 0; } }, config_set: { args: { phy: "", radio: 0, config: "", prev_config: "", }, call: function(req) { let phy = req.args.phy; let radio = req.args.radio; let name = phy_name(phy, radio); let file = req.args.config; let prev_file = req.args.prev_config; if (!phy) return libubus.STATUS_INVALID_ARGUMENT; if (prev_file && !hostapd.data.config[name]) { let config = iface_load_config(phy, radio, prev_file); if (config) config.radio.data = []; hostapd.data.config[name] = config; } let config = iface_load_config(phy, radio, file); hostapd.printf(`Set new config for phy ${name}: ${file}`); iface_set_config(name, config); if (hostapd.data.auth_obj) hostapd.data.auth_obj.notify("reload", { phy, radio }); return { pid: hostapd.getpid() }; } }, config_add: { args: { iface: "", config: "", }, call: function(req) { if (!req.args.iface || !req.args.config) return libubus.STATUS_INVALID_ARGUMENT; if (hostapd.add_iface(`bss_config=${req.args.iface}:${req.args.config}`) < 0) return libubus.STATUS_INVALID_ARGUMENT; return { pid: hostapd.getpid() }; } }, config_remove: { args: { iface: "" }, call: function(req) { if (!req.args.iface) return libubus.STATUS_INVALID_ARGUMENT; hostapd.remove_iface(req.args.iface); return 0; } }, bss_info: { args: { iface: "" }, call: function(req) { if (!req.args.iface) return libubus.STATUS_INVALID_ARGUMENT; let config = bss_config(req.args.iface); if (!config) return libubus.STATUS_NOT_FOUND; let bss = config[1]; config = config[0]; let ret = {}; for (let line in [ ...config.radio.data, ...bss.data ]) { let fields = split(line, "=", 2); let name = fields[0]; if (hostapd.data.bss_info_fields[name]) ret[name] = fields[1]; } return ret; } }, }; hostapd.data.ubus = ubus; hostapd.data.obj = ubus.publish("hostapd", main_obj); let auth_obj = {}; hostapd.data.auth_obj = ubus.publish("hostapd-auth", auth_obj); hostapd.udebug_set("hostapd", hostapd.data.ubus); function bss_event(type, name, data) { let ubus = hostapd.data.ubus; data ??= {}; data.name = name; hostapd.data.obj.notify(`bss.${type}`, data, null, null, null, -1); ubus.call("service", "event", { type: `hostapd.${name}.${type}`, data: {} }); } return { shutdown: function() { for (let phy in hostapd.data.config) iface_set_config(phy); hostapd.udebug_set(null); hostapd.ubus.disconnect(); }, bss_create: function(phy, name, obj) { phy = hostapd.data.config[phy]; if (!phy) return; if (phy.radio_idx != null && phy.radio_idx >= 0) wdev_set_radio_mask(name, 1 << phy.radio_idx); }, bss_add: function(phy, name, obj) { bss_event("add", name); }, bss_reload: function(phy, name, obj, reconf) { bss_event("reload", name, { reconf: reconf != 0 }); }, bss_remove: function(phy, name, obj) { bss_event("remove", name); }, sta_auth: function(iface, sta) { let msg = { iface, sta }; let ret = {}; let data_cb = (type, data) => { ret = { ...ret, ...data }; }; if (hostapd.data.auth_obj) hostapd.data.auth_obj.notify("sta_auth", msg, data_cb, null, null, 1000); return ret; }, sta_connected: function(iface, sta, data) { let msg = { iface, sta, ...data }; let ret = {}; let data_cb = (type, data) => { ret = { ...ret, ...data }; }; if (hostapd.data.auth_obj) hostapd.data.auth_obj.notify("sta_connected", msg, data_cb, null, null, 1000); return ret; }, }; 07070101AE2516000081A40000000000000000000000016A426C280000442A000000FE0000000000000000000000000000002300000000usr/share/hostap/wpa_supplicant.uclet libubus = require("ubus"); import * as uloop from "uloop"; import { open, readfile } from "fs"; import { wdev_create, wdev_set_mesh_params, wdev_remove, is_equal, wdev_set_up, vlist_new, phy_open } from "common"; let ubus = libubus.connect(); function ex_handler(e) { e = split(`${e}\n${e.stacktrace[0].context}`, '\n'); for (let line in e) wpas.printf(line); return libubus.STATUS_UNKNOWN_ERROR; } libubus.guard(ex_handler); wpas.data.mld = {}; wpas.data.config = {}; wpas.data.iface_phy = {}; wpas.data.iface_ubus = {}; wpas.data.macaddr_list = {}; function iface_stop(iface) { let ifname = iface.config.iface; if (!iface.running) return; delete wpas.data.iface_phy[ifname]; wpas.remove_iface(ifname); wdev_remove(ifname); iface.running = false; } function iface_start(phydev, iface, macaddr_list) { let phy = phydev.name; if (iface.running) return; let ifname = iface.config.iface; let wdev_config = {}; for (let field in iface.config) wdev_config[field] = iface.config[field]; if (!wdev_config.macaddr) wdev_config.macaddr = phydev.macaddr_next(); wpas.data.iface_phy[ifname] = phy; wdev_remove(ifname); let ret = phydev.wdev_add(ifname, wdev_config); if (ret) wpas.printf(`Failed to create device ${ifname}: ${ret}`); wdev_set_up(ifname, true); wpas.add_iface(iface.config); iface.running = true; } function iface_cb(new_if, old_if) { if (old_if && new_if && is_equal(old_if.config, new_if.config)) { new_if.running = old_if.running; return; } if (new_if && old_if) wpas.printf(`Update configuration for interface ${old_if.config.iface}`); else if (old_if) wpas.printf(`Remove interface ${old_if.config.iface}`); if (old_if) iface_stop(old_if); } function prepare_config(config, radio) { config.config_data = readfile(config.config); return { config }; } function phy_dev_open(phy_name) { let phy = wpas.data.config[phy_name]; if (!phy) { warn(`Missing phy config for ${phy_name}\n`); return; } let phydev = phy_open(phy.name, phy.radio); if (!phydev) return; let macaddr_list = wpas.data.macaddr_list[phy_name]; phydev.macaddr_init(macaddr_list, { num_global: phy.num_global_macaddr, macaddr_base: phy.macaddr_base, }); return phydev; } function start_pending(phy_name) { let phy = wpas.data.config[phy_name]; if (!phy || !phy.data) return; let phydev = phy_dev_open(phy_name); if (!phydev) { wpas.printf(`Could not open phy ${phy_name}`); return; } for (let ifname in phy.data) iface_start(phydev, phy.data[ifname]); } function phy_name(phy, radio) { if (!phy) return null; if (radio != null && radio >= 0) phy += "." + radio; return phy; } function mld_remove(data) { if (!data.radio_mask_up) return; let name = data.name; wpas.printf(`Remove MLD interface ${name}`); wpas.remove_iface(name); wdev_remove(name); data.radio_mask_up = 0; } function mld_first_phy(data) { let mask = data.radio_mask_present; for (let i = 0; mask; i++, mask >>= 1) if (mask & 1) return i; } function mld_radio_index(data, freq) { let phys = data.phy_config; for (let i = 0; i < length(phys); i++) if (phys[i] && index(phys[i].freq_list, freq) >= 0) return i; } function mld_add(data, phy_list) { let name = data.name; phy_list ??= []; wpas.printf(`Add MLD interface ${name}`); let radio = mld_first_phy(data); if (radio == null) return; let phy_name = data.phy + '.' + radio; let phydev = phy_list[phy_name]; if (!phydev) { phydev = phy_dev_open(phy_name); if (!phydev) return; phy_list[phy_name] = phydev; } let wdev_config = { ...data.config, radio_mask: data.radio_mask }; if (!wdev_config.macaddr) wdev_config.macaddr = phydev.macaddr_next(); let ret = phydev.wdev_add(name, wdev_config); if (ret) wpas.printf(`Failed to create device ${name}: ${ret}`); let first_config = data.phy_config[radio]; wdev_set_up(name, true); wpas.add_iface(first_config); let iface = wpas.interfaces[name]; if (!iface) { wpas.printf(`Interface ${name} not found after adding\n`); wpas.remove_iface(name); wdev_remove(name); return; } if (length(data.freq_list) > 0) iface.config('freq_list', data.freq_list); data.radio_mask_up = data.radio_mask_present; } function mld_remove_links(data) { // TODO mld_remove(data); } function mld_add_links(data) { // TODO: incremental update mld_remove(data); mld_add(data); } function mld_set_config(config) { let prev_mld = { ...wpas.data.mld }; let new_mld = {}; let phy_list = {}; let new_config = !length(prev_mld); wpas.printf(`Set MLD config: ${keys(config)}`); for (let name, data in config) { let prev = prev_mld[name]; if (prev && is_equal(prev.config, data)) { new_mld[name] = prev; delete prev_mld[name]; continue; } let radio_mask = 0; for (let r in data.radios) if (r != null) radio_mask |= 1 << r; new_mld[name] = { name, config: data, phy: data.phy, phy_config: [], radio_mask, radio_mask_up: 0, radio_mask_present: 0, }; } for (let name, data in prev_mld) mld_remove(data); wpas.data.mld = new_mld; } function mld_set_iface_config(name, data, radio, config) { wpas.printf(`Set MLD interface ${name} radio ${radio} config: ${keys(config)}`); data.phy_config[radio] = config; if (config) data.radio_mask_present |= 1 << radio; else data.radio_mask_present &= ~(1 << radio); let freq_list; for (let config in data.phy_config) { if (!config || !config.freq_list) continue; if (!freq_list) freq_list = [ ...config.freq_list ]; else push(freq_list, ...config.freq_list); } data.freq_list = freq_list; } function mld_update_iface(name, data) { if (!data.radio_mask_up) return; if (!data.radio_mask_present) { mld_remove(data); return; } let mask = data.radio_mask_up & ~data.radio_mask_present; if (!mask) return; mld_remove_links(data); } function mld_update_phy(phy, ifaces) { for (let name, data in wpas.data.mld) { if (data.phy != phy.name) continue; mld_set_iface_config(name, data, phy.radio, ifaces[name]); mld_update_iface(name, data); } } function mld_start() { if (wpas.data.mld_pending) return; wpas.printf(`Start pending MLD interfaces\n`); let phy_list = {}; for (let name, data in wpas.data.mld) { wpas.printf(`MLD interface ${name} present=${data.radio_mask_present} up=${data.radio_mask_up}`); let add_mask = data.radio_mask_present & ~data.radio_mask_up; if (!add_mask) continue; if (!data.radio_mask_up) mld_add(data, phy_list); else mld_add_links(data); } } function mld_bss_allowed(data, bss) { if (!data.freq_list) return true; return index(data.freq_list, bss.freq) >= 0; } function set_config(config_name, phy_name, radio, num_global_macaddr, macaddr_base, config_list) { let phy = wpas.data.config[config_name]; if (radio < 0) radio = null; if (!phy) { phy = vlist_new(iface_cb, false); phy.name = phy_name; wpas.data.config[config_name] = phy; } phy.radio = radio; phy.num_global_macaddr = num_global_macaddr; phy.macaddr_base = macaddr_base; let values = []; let mlo_ifaces = {}; for (let config in config_list) if (config.mlo) mlo_ifaces[config.iface] = config; else push(values, [ config.iface, prepare_config(config) ]); mld_update_phy(phy, mlo_ifaces); phy.update(values); } function iface_status_fill_radio_link(mld, radio, msg, link) { let config = mld.phy_config[radio]; if (!config) return; let freq_list = config.freq_list; if (!freq_list) return; if (!link || index(freq_list, link.frequency) < 0) return; msg.frequency = link.frequency; msg.sec_chan_offset = link.sec_chan_offset; } function iface_status_fill_radio(mld, radio, msg, status) { if (status.links) for (let link in status.links) iface_status_fill_radio_link(mld, radio, msg, link); else iface_status_fill_radio_link(mld, radio, msg, status); } let main_obj = { phy_set_state: { args: { phy: "", radio: 0, stop: true, }, call: function(req) { let name = phy_name(req.args.phy, req.args.radio); if (!name || req.args.stop == null) return libubus.STATUS_INVALID_ARGUMENT; let phy = wpas.data.config[name]; if (!phy) return libubus.STATUS_NOT_FOUND; let radio_mask = phy.radio != null ? (1 << phy.radio) : 0; if (req.args.stop) { for (let ifname in phy.data) iface_stop(phy.data[ifname]); for (let name, data in wpas.data.mld) { data.radio_mask_present &= ~radio_mask; if (data.radio_mask_up & radio_mask) mld_update_iface(name, data); } } else { start_pending(name); let found; for (let name, data in wpas.data.mld) { if (!(data.radio_mask & radio_mask)) continue; data.radio_mask_present |= radio_mask; found = true; } if (found) mld_start(); } return 0; } }, phy_set_macaddr_list: { args: { phy: "", radio: 0, macaddr: [], }, call: function(req) { let phy = phy_name(req.args.phy, req.args.radio); if (!phy) return libubus.STATUS_INVALID_ARGUMENT; wpas.data.macaddr_list[phy] = req.args.macaddr; return 0; } }, phy_status: { args: { phy: "", radio: 0, }, call: function(req) { let phy = phy_name(req.args.phy, req.args.radio); if (!phy) return libubus.STATUS_INVALID_ARGUMENT; phy = wpas.data.config[phy]; if (!phy) return libubus.STATUS_NOT_FOUND; let ifnames = keys(phy.data); let radio_mask = phy.radio != null ? (1 << phy.radio) : 0; for (let name, data in wpas.data.mld) if (data.radio_mask_up & radio_mask) push(ifnames, name); for (let ifname in ifnames) { try { let iface = wpas.interfaces[ifname]; if (!iface) continue; let status = iface.status(); if (!status) continue; if (status.state == "INTERFACE_DISABLED") continue; if (phy.data[ifname]) { status.ifname = ifname; return status; } let ret = { ifname, state: status.state, }; let mld = wpas.data.mld[ifname]; iface_status_fill_radio(mld, phy.radio, ret, status); return ret; } catch (e) { ex_handler(e); continue; } } return libubus.STATUS_NOT_FOUND; } }, iface_status: { args: { name: "" }, call: function(req) { let iface = wpas.interfaces[req.args.name]; if (!iface) return libubus.STATUS_NOT_FOUND; return iface.status(); }, }, mld_set: { args: { config: {} }, call: function(req) { if (!req.args.config) return libubus.STATUS_INVALID_ARGUMENT; wpas.data.mld_pending = true; mld_set_config(req.args.config); return 0; } }, mld_start: { args: {}, call: function(req) { wpas.data.mld_pending = false; mld_start(); return 0; } }, config_set: { args: { phy: "", radio: 0, num_global_macaddr: 0, macaddr_base: "", config: [], defer: true, }, call: function(req) { let phy = phy_name(req.args.phy, req.args.radio); if (!phy) return libubus.STATUS_INVALID_ARGUMENT; wpas.printf(`Set new config for phy ${phy}`); if (req.args.config) set_config(phy, req.args.phy, req.args.radio, req.args.num_global_macaddr, req.args.macaddr_base, req.args.config); if (!req.args.defer) uloop.timer(100, () => start_pending(phy)); return { pid: wpas.getpid() }; } }, config_add: { args: { driver: "", iface: "", bridge: "", hostapd_ctrl: "", ctrl: "", config: "", }, call: function(req) { if (!req.args.iface || !req.args.config) return libubus.STATUS_INVALID_ARGUMENT; if (wpas.add_iface(req.args) < 0) return libubus.STATUS_INVALID_ARGUMENT; return { pid: wpas.getpid() }; } }, config_remove: { args: { iface: "" }, call: function(req) { if (!req.args.iface) return libubus.STATUS_INVALID_ARGUMENT; wpas.remove_iface(req.args.iface); return 0; } }, bss_info: { args: { iface: "", }, call: function(req) { let ifname = req.args.iface; if (!ifname) return libubus.STATUS_INVALID_ARGUMENT; let iface = wpas.interfaces[ifname]; if (!iface) return libubus.STATUS_NOT_FOUND; let status = iface.ctrl("STATUS"); if (!status) return libubus.STATUS_NOT_FOUND; let ret = {}; status = split(status, "\n"); for (let line in status) { line = split(line, "=", 2); ret[line[0]] = line[1]; } return ret; } }, }; wpas.data.ubus = ubus; wpas.data.obj = ubus.publish("wpa_supplicant", main_obj); wpas.udebug_set("wpa_supplicant", wpas.data.ubus); function iface_event(type, name, data) { let ubus = wpas.data.ubus; data ??= {}; data.name = name; let req = wpas.data.obj.notify(`iface.${type}`, data, null, null, null, -1); if (req) req.abort(); ubus.call("service", "event", { type: `wpa_supplicant.${name}.${type}`, data: {} }); } function iface_hostapd_notify(ifname, iface, state) { let status = iface.status(); let ubus = wpas.data.ubus; let msg = {}; let mld = wpas.data.mld[ifname]; switch (state) { case "DISCONNECTED": case "AUTHENTICATING": case "SCANNING": msg.up = false; break; case "INTERFACE_DISABLED": case "INACTIVE": msg.up = true; break; case "COMPLETED": msg.up = true; if (!mld) { msg.frequency = status.frequency; msg.sec_chan_offset = status.sec_chan_offset; } break; default: return; } if (!mld) { msg.phy = wpas.data.iface_phy[ifname]; if (!msg.phy) { wpas.printf(`no PHY for ifname ${ifname}`); return; } ubus.call("hostapd", "apsta_state", msg); return; } let radio_mask = mld.radio_mask; for (let i = 0; radio_mask; i++, radio_mask >>= 1) { if (!(radio_mask & 1)) { wpas.printf(`skip radio ${i}`); continue; } let radio_msg = { ...msg, phy: mld.phy, radio: i, }; if (state == "COMPLETED") iface_status_fill_radio(mld, i, radio_msg, status); ubus.call("hostapd", "apsta_state", radio_msg); } } function iface_channel_switch(ifname, iface, info) { let msg = { up: true, csa: true, csa_count: info.csa_count ? info.csa_count - 1 : 0, frequency: info.frequency, sec_chan_offset: info.sec_chan_offset, }; let mld = wpas.data.mld[ifname]; if (mld) { msg.phy = mld.phy; msg.radio = mld_radio_index(mld, info.frequency); if (msg.radio == null) { wpas.printf(`PHY ${mld.phy} radio for frequency ${info.frequency} not found`); return; } } else { msg.phy = wpas.data.iface_phy[ifname]; if (!msg.phy) { wpas.printf(`no PHY for ifname ${ifname}`); return; } } ubus.call("hostapd", "apsta_state", msg); } function iface_ubus_remove(ifname) { let obj = wpas.data.iface_ubus[ifname]; if (!obj) return; obj.remove(); delete wpas.data.iface_ubus[ifname]; } function iface_ubus_notify(ifname, event) { let obj = wpas.data.iface_ubus[ifname]; if (!obj) return; obj.notify('ctrl-event', { event }, null, null, null, -1); } function iface_ubus_add(ifname) { let ubus = wpas.data.ubus; iface_ubus_remove(ifname); let obj = ubus.publish(`wpa_supplicant.${ifname}`, { reload: { args: {}, call: (req) => { let iface = wpas.interfaces[ifname]; if (!iface) return libubus.STATUS_NOT_FOUND; iface.ctrl("RECONFIGURE"); return 0; }, }, wps_start: { args: { multi_ap: true }, call: (req) => { let iface = wpas.interfaces[ifname]; if (!iface) return libubus.STATUS_NOT_FOUND; iface.ctrl(`WPS_PBC multi_ap=${+req.args.multi_ap}`); return 0; }, }, wps_cancel: { args: {}, call: (req) => { let iface = wpas.interfaces[ifname]; if (!iface) return libubus.STATUS_NOT_FOUND; iface.ctrl("WPS_CANCEL"); return 0; }, }, control: { args: { command: "" }, call: (req) => { let iface = wpas.interfaces[ifname]; if (!iface) return libubus.STATUS_NOT_FOUND; return { result: iface.ctrl(req.args.command) }; }, }, }); wpas.data.iface_ubus[ifname] = obj; } return { shutdown: function() { for (let phy in wpas.data.config) set_config(phy, []); wpas.ubus.disconnect(); }, bss_allowed: function(ifname, bss) { let mld = wpas.data.mld[ifname]; if (!mld) return true; return mld_bss_allowed(mld, bss); }, iface_add: function(name, obj) { iface_ubus_add(name); iface_event("add", name); }, iface_remove: function(name, obj) { iface_event("remove", name); iface_ubus_remove(name); }, ctrl_event: function(name, iface, ev) { iface_ubus_notify(name, ev); }, state: function(ifname, iface, state) { let event_data = iface.status(); event_data.name = ifname; iface_event("state", ifname, event_data); try { iface_hostapd_notify(ifname, iface, state); if (state != "COMPLETED") return; let phy = wpas.data.iface_phy[ifname]; if (!phy) return; let phy_data = wpas.data.config[phy]; if (!phy_data) return; let iface_data = phy_data.data[ifname]; if (!iface_data) return; let wdev_config = iface_data.config; if (!wdev_config || wdev_config.mode != "mesh") return; wdev_set_mesh_params(ifname, wdev_config); } catch (e) { ex_handler(e); } }, event: function(ifname, iface, ev, info) { if (ev == "CH_SWITCH_STARTED") iface_channel_switch(ifname, iface, info); }, wps_credentials: function(ifname, iface, cred) { cred.ifname = ifname; ubus.event("wps_credentials", cred); } }; 07070101AE2341000081A40000000000000000000000016A426C2800001413000000FE0000000000000000000000000000001700000000usr/share/iso3166.json{ "00": "World", "AD": "Andorra", "AE": "United Arab Emirates", "AF": "Afghanistan", "AG": "Antigua and Barbuda", "AI": "Anguilla", "AL": "Albania", "AM": "Armenia", "AN": "Netherlands Antilles", "AO": "Angola", "AQ": "Antarctica", "AR": "Argentina", "AS": "American Samoa", "AT": "Austria", "AU": "Australia", "AW": "Aruba", "AX": "Aland Islands", "AZ": "Azerbaijan", "BA": "Bosnia and Herzegovina", "BB": "Barbados", "BD": "Bangladesh", "BE": "Belgium", "BF": "Burkina Faso", "BG": "Bulgaria", "BH": "Bahrain", "BI": "Burundi", "BJ": "Benin", "BL": "Saint Barthelemy", "BM": "Bermuda", "BN": "Brunei Darussalam", "BO": "Bolivia", "BR": "Brazil", "BS": "Bahamas", "BT": "Bhutan", "BV": "Bouvet Island", "BW": "Botswana", "BY": "Belarus", "BZ": "Belize", "CA": "Canada", "CC": "Cocos (Keeling) Islands", "CD": "Congo", "CF": "Central African Republic", "CG": "Congo", "CH": "Switzerland", "CI": "Cote d'Ivoire", "CK": "Cook Islands", "CL": "Chile", "CM": "Cameroon", "CN": "China", "CO": "Colombia", "CR": "Costa Rica", "CU": "Cuba", "CV": "Cape Verde", "CX": "Christmas Island", "CY": "Cyprus", "CZ": "Czech Republic", "DE": "Germany", "DJ": "Djibouti", "DK": "Denmark", "DM": "Dominica", "DO": "Dominican Republic", "DZ": "Algeria", "EC": "Ecuador", "EE": "Estonia", "EG": "Egypt", "EH": "Western Sahara", "ER": "Eritrea", "ES": "Spain", "ET": "Ethiopia", "FI": "Finland", "FJ": "Fiji", "FK": "Falkland Islands", "FM": "Micronesia", "FO": "Faroe Islands", "FR": "France", "GA": "Gabon", "GB": "United Kingdom", "GD": "Grenada", "GE": "Georgia", "GF": "French Guiana", "GG": "Guernsey", "GH": "Ghana", "GI": "Gibraltar", "GL": "Greenland", "GM": "Gambia", "GN": "Guinea", "GP": "Guadeloupe", "GQ": "Equatorial Guinea", "GR": "Greece", "GS": "South Georgia", "GT": "Guatemala", "GU": "Guam", "GW": "Guinea-Bissau", "GY": "Guyana", "HK": "Hong Kong", "HM": "Heard and McDonald Islands", "HN": "Honduras", "HR": "Croatia", "HT": "Haiti", "HU": "Hungary", "ID": "Indonesia", "IE": "Ireland", "IL": "Israel", "IM": "Isle of Man", "IN": "India", "IO": "Chagos Islands", "IQ": "Iraq", "IR": "Iran", "IS": "Iceland", "IT": "Italy", "JE": "Jersey", "JM": "Jamaica", "JO": "Jordan", "JP": "Japan", "KE": "Kenya", "KG": "Kyrgyzstan", "KH": "Cambodia", "KI": "Kiribati", "KM": "Comoros", "KN": "Saint Kitts and Nevis", "KP": "North Korea", "KR": "South Korea", "KW": "Kuwait", "KY": "Cayman Islands", "KZ": "Kazakhstan", "LA": "Laos", "LB": "Lebanon", "LC": "Saint Lucia", "LI": "Liechtenstein", "LK": "Sri Lanka", "LR": "Liberia", "LS": "Lesotho", "LT": "Lithuania", "LU": "Luxembourg", "LV": "Latvia", "LY": "Libyan Arab Jamahiriya", "MA": "Morocco", "MC": "Monaco", "MD": "Moldova", "ME": "Montenegro", "MF": "Saint Martin (French part)", "MG": "Madagascar", "MH": "Marshall Islands", "MK": "Macedonia", "ML": "Mali", "MM": "Myanmar", "MN": "Mongolia", "MO": "Macao", "MP": "Northern Mariana Islands", "MQ": "Martinique", "MR": "Mauritania", "MS": "Montserrat", "MT": "Malta", "MU": "Mauritius", "MV": "Maldives", "MW": "Malawi", "MX": "Mexico", "MY": "Malaysia", "MZ": "Mozambique", "NA": "Namibia", "NC": "New Caledonia", "NE": "Niger", "NF": "Norfolk Island", "NG": "Nigeria", "NI": "Nicaragua", "NL": "Netherlands", "NO": "Norway", "NP": "Nepal", "NR": "Nauru", "NU": "Niue", "NZ": "New Zealand", "OM": "Oman", "PA": "Panama", "PE": "Peru", "PF": "French Polynesia", "PG": "Papua New Guinea", "PH": "Philippines", "PK": "Pakistan", "PL": "Poland", "PM": "Saint Pierre and Miquelon", "PN": "Pitcairn", "PR": "Puerto Rico", "PS": "Palestinian Territory", "PT": "Portugal", "PW": "Palau", "PY": "Paraguay", "QA": "Qatar", "RE": "Reunion", "RO": "Romania", "RS": "Serbia", "RU": "Russian Federation", "RW": "Rwanda", "SA": "Saudi Arabia", "SB": "Solomon Islands", "SC": "Seychelles", "SD": "Sudan", "SE": "Sweden", "SG": "Singapore", "SH": "St. Helena and Dependencies", "SI": "Slovenia", "SJ": "Svalbard and Jan Mayen", "SK": "Slovakia", "SL": "Sierra Leone", "SM": "San Marino", "SN": "Senegal", "SO": "Somalia", "SR": "Suriname", "ST": "Sao Tome and Principe", "SV": "El Salvador", "SY": "Syrian Arab Republic", "SZ": "Swaziland", "TC": "Turks and Caicos Islands", "TD": "Chad", "TF": "French Southern Territories", "TG": "Togo", "TH": "Thailand", "TJ": "Tajikistan", "TK": "Tokelau", "TL": "Timor-Leste", "TM": "Turkmenistan", "TN": "Tunisia", "TO": "Tonga", "TR": "Turkey", "TT": "Trinidad and Tobago", "TV": "Tuvalu", "TW": "Taiwan", "TZ": "Tanzania", "UA": "Ukraine", "UG": "Uganda", "UM": "U.S. Minor Outlying Islands", "US": "United States", "UY": "Uruguay", "UZ": "Uzbekistan", "VA": "Vatican City State", "VC": "St. Vincent and Grenadines", "VE": "Venezuela", "VG": "Virgin Islands, British", "VI": "Virgin Islands, U.S.", "VN": "Viet Nam", "VU": "Vanuatu", "WF": "Wallis and Futuna", "WS": "Samoa", "YE": "Yemen", "YT": "Mayotte", "ZA": "South Africa", "ZM": "Zambia", "ZW": "Zimbabwe" } 07070101AE23A1000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001400000000usr/share/libiwinfo07070101AE23A2000081A40000000000000000000000016A426C280000461D000000FE0000000000000000000000000000002000000000usr/share/libiwinfo/devices.txt# libiwinfo hardware database # vendor id | device id | subsystem vendor id | subsystem device id | # txpower offset | frequency offset | "vendor name" | "device name" 0x0777 0x11ac 0x0777 0xe7f9 0 0 "Ubiquiti" "LiteBeam 5AC" 0xffff 0xffff 0xffff 0xb102 0 0 "Ubiquiti" "PowerStation2 (18V)" 0xffff 0xffff 0xffff 0xb202 0 0 "Ubiquiti" "PowerStation2 (16D)" 0xffff 0xffff 0xffff 0xb302 0 0 "Ubiquiti" "PowerStation2 (EXT)" 0xffff 0xffff 0xffff 0xb105 0 0 "Ubiquiti" "PowerStation5 (22V)" 0xffff 0xffff 0xffff 0xb305 0 0 "Ubiquiti" "PowerStation5 (EXT)" 0xffff 0xffff 0xffff 0xc302 0 0 "Ubiquiti" "PicoStation2" 0xffff 0xffff 0xffff 0xc3a2 10 0 "Ubiquiti" "PicoStation2 HP" 0xffff 0xffff 0xffff 0xa105 0 0 "Ubiquiti" "WispStation5" 0xffff 0xffff 0xffff 0xa002 10 0 "Ubiquiti" "LiteStation2" 0xffff 0xffff 0xffff 0xa005 5 0 "Ubiquiti" "LiteStation5" 0xffff 0xffff 0xffff 0xc002 10 0 "Ubiquiti" "NanoStation2" 0xffff 0xffff 0xffff 0xc005 5 0 "Ubiquiti" "NanoStation5" 0xffff 0xffff 0xffff 0xc102 10 0 "Ubiquiti" "NanoStation Loco2" 0xffff 0xffff 0xffff 0xc105 5 0 "Ubiquiti" "NanoStation Loco5" 0xffff 0xffff 0xffff 0xc202 10 0 "Ubiquiti" "Bullet2" 0xffff 0xffff 0xffff 0xc205 5 0 "Ubiquiti" "Bullet5" 0x168c 0xffff 0x0777 0xe002 6 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe003 3 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe005 5 0 "Ubiquiti" "NanoStation M5" /* airOS XM */ 0x168c 0xffff 0x0777 0xe006 5 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe009 6 0 "Ubiquiti" "NanoStation Loco M9" /* airOS XM */ 0x168c 0xffff 0x0777 0xe012 10 0 "Ubiquiti" "NanoStation M2" /* airOS XM */ 0x168c 0xffff 0x0777 0xe035 3 0 "Ubiquiti" "NanoStation M3" /* airOS XM */ 0x168c 0xffff 0x0777 0xe0a2 2 0 "Ubiquiti" "NanoStation Loco M2" /* airOS XM */ 0x168c 0xffff 0x0777 0xe0a5 1 0 "Ubiquiti" "NanoStation Loco M5" /* airOS XM */ 0x168c 0xffff 0x0777 0xe102 6 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe105 5 0 "Ubiquiti" "Rocket M5" /* airOS XM */ 0x168c 0xffff 0x0777 0xe112 10 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe115 3 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe1a3 3 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe1a5 5 0 "Ubiquiti" "PowerBridge M5" /* airOS XM */ 0x168c 0xffff 0x0777 0xe1b2 10 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe1b3 3 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe1b5 5 0 "Ubiquiti" "Rocket M5" /* airOS XM */ 0x168c 0xffff 0x0777 0xe1b6 5 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe1b9 6 0 "Ubiquiti" "Rocket M9" /* airOS XM */ 0x168c 0xffff 0x0777 0xe1c2 10 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe1c3 3 0 "Ubiquiti" "Rocket M3" /* airOS XM */ 0x168c 0xffff 0x0777 0xe1c5 5 0 "Ubiquiti" "Rocket M5 GPS" /* airOS XM */ 0x168c 0xffff 0x0777 0xe1c5 5 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe1d2 10 0 "Ubiquiti" "Rocket M2 Titanium" /* airOS XM/XW */ 0x168c 0xffff 0x0777 0xe1d3 3 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe1d5 5 0 "Ubiquiti" "airOS XM/XW" 0x168c 0xffff 0x0777 0xe1d9 6 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe1e3 3 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe1e5 5 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe202 12 0 "Ubiquiti" "Bullet M2" /* airOS XM */ 0x168c 0xffff 0x0777 0xe205 6 0 "Ubiquiti" "Bullet M5" /* airOS XM */ 0x168c 0xffff 0x0777 0xe212 1 0 "Ubiquiti" "AirGrid M2" /* airOS XM */ 0x168c 0xffff 0x0777 0xe215 1 0 "Ubiquiti" "AirGrid M5" /* airOS XM */ 0x168c 0xffff 0x0777 0xe232 2 0 "Ubiquiti" "NanoBridge M2" /* airOS XM */ 0x168c 0xffff 0x0777 0xe233 3 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe235 1 0 "Ubiquiti" "NanoBridge M5" /* airOS XM */ 0x168c 0xffff 0x0777 0xe239 6 0 "Ubiquiti" "NanoBridge M9" /* airOS XM */ 0x168c 0xffff 0x0777 0xe242 9 0 "Ubiquiti" "AirGrid M2 HP" /* airOS XM */ 0x168c 0xffff 0x0777 0xe243 3 0 "Ubiquiti" "NanoBridge M3" /* airOS XM */ 0x168c 0xffff 0x0777 0xe245 6 0 "Ubiquiti" "AirGrid M5 HP" /* airOS XM */ 0x168c 0xffff 0x0777 0xe252 9 0 "Ubiquiti" "AirGrid M2 HP" /* airOS XM */ 0x168c 0xffff 0x0777 0xe255 6 0 "Ubiquiti" "AirGrid M5 HP" /* airOS XM */ 0x168c 0xffff 0x0777 0xe2a3 3 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe2a5 5 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe2b2 10 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe2b5 1 0 "Ubiquiti" "NanoBridge M5" /* airOS XM */ 0x168c 0xffff 0x0777 0xe2b9 6 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe2c2 10 0 "Ubiquiti" "NanoBeam M2 Int" /* airOS XW */ 0x168c 0xffff 0x0777 0xe2c3 6 0 "Ubiquiti" "Bullet M2 XW" /* airOS XW */ 0x168c 0xffff 0x0777 0xe2c4 6 0 "Ubiquiti" "airOS XW" 0x168c 0xffff 0x0777 0xe2d2 12 0 "Ubiquiti" "Bullet M2 Titanium HP" /* airOS XM */ 0x168c 0xffff 0x0777 0xe2d4 6 0 "Ubiquiti" "airOS XW" 0x168c 0xffff 0x0777 0xe2d5 6 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe2e5 4 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe302 12 0 "Ubiquiti" "PicoStation M2" /* airOS XM */ 0x168c 0xffff 0x0777 0xe305 6 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe345 6 0 "Ubiquiti" "WispStation M5" /* airOS XM */ 0x168c 0xffff 0x0777 0xe3a5 5 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe3b5 6 0 "Ubiquiti" "airOS XM/XW" 0x168c 0xffff 0x0777 0xe3e5 4 0 "Ubiquiti" "PowerBeam M5 300" /* airOS XW */ 0x168c 0xffff 0x0777 0xe402 10 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe405 1 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe4a2 1 0 "Ubiquiti" "AirRouter" /* airOS XM */ 0x168c 0xffff 0x0777 0xe4a5 1 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe4b2 9 0 "Ubiquiti" "AirRouter HP" /* airOS XM */ 0x168c 0xffff 0x0777 0xe4d5 5 0 "Ubiquiti" "Rocket M5 Titanium" /* airOS XW */ 0x168c 0xffff 0x0777 0xe4e5 4 0 "Ubiquiti" "PowerBeam M5 400" /* airOS XW */ 0x168c 0xffff 0x0777 0xe5e5 4 0 "Ubiquiti" "airOS XW" 0x168c 0xffff 0x0777 0xe6a2 1 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe6b2 1 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe6b5 5 0 "Ubiquiti" "Rocket M5 XW" /* airOS XW */ 0x168c 0xffff 0x0777 0xe6c2 6 0 "Ubiquiti" "airOS XM" 0x168c 0xffff 0x0777 0xe6e5 4 0 "Ubiquiti" "PowerBeam M5 400 ISO" /* airOS XW */ 0x168c 0xffff 0x0777 0xe7f8 2 0 "Ubiquiti" "airOS XW" 0x168c 0xffff 0x0777 0xe805 5 0 "Ubiquiti" "airOS XM" /* e.g. NanoStation M5, Bullet M5 */ 0x168c 0xffff 0x0777 0xe812 6 0 "Ubiquiti" "NanoBeam M2 13" /* airOS XW */ 0x168c 0xffff 0x0777 0xe815 4 0 "Ubiquiti" "NanoBeam M5 16" /* airOS XW */ 0x168c 0xffff 0x0777 0xe825 4 0 "Ubiquiti" "NanoBeam M5 19" /* airOS XW */ 0x168c 0xffff 0x0777 0xe835 6 0 "Ubiquiti" "AirGrid M5 XW" /* airOS XW */ 0x168c 0xffff 0x0777 0xe845 1 0 "Ubiquiti" "NanoStation Loco M5 XW" /* airOS XW */ 0x168c 0xffff 0x0777 0xe855 5 0 "Ubiquiti" "NanoStation M5 XW" /* airOS XW */ 0x168c 0xffff 0x0777 0xe865 6 0 "Ubiquiti" "LiteBeam M5" /* airOS XW */ 0x168c 0xffff 0x0777 0xe866 6 0 "Ubiquiti" "NanoStation M2 XW" /* airOS XW */ 0x168c 0xffff 0x0777 0xe867 2 0 "Ubiquiti" "NanoStation Loco M2 XW" /* airOS XW */ 0x168c 0xffff 0x0777 0xe868 7 0 "Ubiquiti" "Rocket M2 XW" /* airOS XW */ 0x168c 0xffff 0x0777 0xe869 2 0 "Ubiquiti" "airOS XW" 0x168c 0xffff 0x0777 0xe875 4 0 "Ubiquiti" "airOS XW" 0x168c 0xffff 0x0777 0xe879 2 0 "Ubiquiti" "airOS XW" 0x168c 0xffff 0x0777 0xe885 4 0 "Ubiquiti" "PowerBeam M5 620 XW" /* airOS XW */ 0x168c 0xffff 0x0777 0xe895 4 0 "Ubiquiti" "airOS XW" 0x168c 0xffff 0x0777 0xe8a5 1 0 "Ubiquiti" "NanoStation Loco M5" /* airOS XM */ 0x168c 0xffff 0x0777 0xe8b5 5 0 "Ubiquiti" "airOS XM" 0x168c 0x001b 0x0777 0x3002 10 0 "Ubiquiti" "XR2" 0x168c 0x001b 0x7777 0x3002 10 0 "Ubiquiti" "XR2" 0x168c 0x001b 0x0777 0x3b02 10 0 "Ubiquiti" "XR2.3" 0x168c 0x001b 0x0777 0x3c02 10 0 "Ubiquiti" "XR2.6" 0x168c 0x001b 0x0777 0x3b03 10 0 "Ubiquiti" "XR3-2.8" 0x168c 0x001b 0x0777 0x3c03 10 0 "Ubiquiti" "XR3-3.6" 0x168c 0x001b 0x0777 0x3003 10 0 "Ubiquiti" "XR3" 0x168c 0x001b 0x0777 0x3004 10 0 "Ubiquiti" "XR4" 0x168c 0x001b 0x0777 0x3005 10 0 "Ubiquiti" "XR5" 0x168c 0x001b 0x7777 0x3005 10 0 "Ubiquiti" "XR5" 0x168c 0x001b 0x0777 0x3007 10 0 "Ubiquiti" "XR7" 0x168c 0x001b 0x0777 0x3009 10 -1520 "Ubiquiti" "XR9" 0x168c 0x001b 0x168c 0x2063 0 0 "Atheros" "AR5413" 0x168c 0x0013 0x168c 0x1042 1 0 "Ubiquiti" "SRC" 0x168c 0x0013 0x0777 0x2041 10 0 "Ubiquiti" "SR2" 0x168c 0x0013 0x0777 0x2004 6 0 "Ubiquiti" "SR4" 0x168c 0x0013 0x7777 0x2004 6 0 "Ubiquiti" "SR4" 0x168c 0x0013 0x0777 0x1004 6 0 "Ubiquiti" "SR4C" 0x168c 0x0013 0x7777 0x1004 6 0 "Ubiquiti" "SR4C" 0x168c 0x0013 0x168c 0x2042 7 0 "Ubiquiti" "SR5" 0x168c 0x0013 0x7777 0x2009 12 -1500 "Ubiquiti" "SR9" 0x168c 0x0027 0x168c 0x2082 7 0 "Ubiquiti" "SR71A" 0x168c 0x0027 0x0777 0x4082 7 0 "Ubiquiti" "SR71" 0x168c 0x0029 0x0777 0x4005 7 0 "Ubiquiti" "SR71-15" 0x168c 0x002a 0x0777 0xe302 12 0 "Ubiquiti" "PicoStation M2" /* ToDo: confirm offset - Correct! */ 0x168c 0x002a 0x0777 0xe012 12 0 "Ubiquiti" "NanoStation M2" /* ToDo: confirm offset - Wrong! */ 0x168c 0x002a 0x0777 0xe005 5 0 "Ubiquiti" "NanoStation M5" /* ToDo: confirm offset - Correct! */ 0x168c 0x002a 0x0777 0xe202 12 0 "Ubiquiti" "Bullet M2" 0x168c 0x002a 0x0777 0xe805 5 0 "Ubiquiti" "Bullet M5" 0x168c 0x002a 0x0777 0xe345 0 0 "Ubiquiti" "WispStation M5" /* ToDo: confirm offset - Wrong! */ 0x168c 0x0029 0x168c 0xa094 0 0 "Atheros" "AR9220" 0x168c 0x0029 0x168c 0xa095 0 0 "Atheros" "AR9223" 0x168c 0x002a 0x168c 0xa093 0 0 "Atheros" "AR9280" 0x168c 0x002b 0x168c 0xa091 0 0 "Atheros" "AR9285" 0x168c 0x002d 0x168c 0x209a 0 0 "Atheros" "AR9287" 0x168c 0x002e 0x1a3b 0x1121 0 0 "Atheros" "AR9287" 0x168c 0x002e 0x0777 0xe0a2 8 0 "Ubiquiti" "NanoStation Loco M2 (XM)" /* wrong offset! */ 0x168c 0x002e 0x168c 0x30a4 0 0 "Atheros" "AR9287" 0x168c 0x002e 0x168c 0xa199 0 0 "Atheros" "AR9287" 0x168c 0x0030 0x168c 0x3112 0 0 "Atheros" "AR9380" 0x168c 0x0030 0x168c 0x3114 0 0 "Atheros" "AR9390" 0x168c 0x0033 0x168c 0xa120 0 0 "Atheros" "AR9580" 0x168c 0x0033 0x168c 0xa136 0 0 "Atheros" "AR9580" 0x168c 0x0033 0x168c 0x3123 0 0 "Atheros" "AR9590" 0x168c 0x0033 0x19b6 0xd014 0 0 "MikroTik" "R11e-5HnD" 0x168c 0x0033 0x19b6 0xd057 0 0 "MikroTik" "R11e-5HnDr2" 0x168c 0x0033 0x19b6 0xd016 0 0 "MikroTik" "R11e-2HPnD" 0x168c 0x0034 0x17aa 0x3214 0 0 "Atheros" "AR9462" 0x168c 0x003c 0x0000 0x0000 0 0 "Qualcomm Atheros" "QCA9880" 0x168c 0x003c 0x168c 0x3223 0 0 "Qualcomm Atheros" "QCA9880" 0x168c 0x003c 0x1a56 0x1420 0 0 "Qualcomm Atheros" "QCA9862" 0x168c 0x003c 0x19b6 0xd03c 0 0 "Mikrotik" "R11e-5HacT" 0x168c 0x003c 0x19b6 0xd075 0 0 "Mikrotik" "R11e-5HacD" 0x168c 0x003e 0x168c 0x3361 0 0 "Qualcomm Atheros" "QCA6174" 0x168c 0x0040 0x168c 0x0002 0 0 "Qualcomm Atheros" "QCA9990" 0x168c 0x0046 0x168c 0xcafe 0 0 "Qualcomm Atheros" "QCA9984" 0x168c 0x0050 0x0000 0x0000 0 0 "Qualcomm Atheros" "QCA9887" 0x168c 0x0056 0x0000 0x0000 0 0 "Qualcomm Atheros" "QCA9886" 0x17cb 0x1104 0x17cb 0x1104 0 0 "Qualcomm Atheros" "QCN6024/9024/9074" 0x1814 0x3051 0x1814 0x0007 0 0 "Ralink" "Rt3051" /* needs fixing */ 0x1814 0x3052 0x1814 0x0008 0 0 "Ralink" "Rt3052" /* needs fixing */ 0x1814 0x3091 0x1814 0x3091 0 0 "Ralink" "RT5592" 0x1814 0x3350 0x1814 0x000b 0 0 "Ralink" "Rt3350" /* needs fixing */ 0x1814 0x3662 0x1814 0x000d 0 0 "Ralink" "Rt3662" /* needs fixing */ 0x11ab 0x2a55 0x11ab 0x0000 0 0 "Marvell" "88W8864" 0x02df 0x9135 0x0000 0x0000 0 0 "Marvell" "88W8887" 0x11ab 0x2b40 0x11ab 0x0000 0 0 "Marvell" "88W8964" 0x02df 0x9141 0x0000 0x0000 0 0 "Marvell" "88W8997" 0x14c3 0x0608 0x14c3 0x0608 0 0 "AMD" "RZ608" 0x14c3 0x7603 0x14c3 0x7603 0 0 "MediaTek" "MT7603E" 0x14c3 0x7610 0x14c3 0x7610 0 0 "MediaTek" "MT7610E" 0x14c3 0x7612 0x14c3 0x7612 0 0 "MediaTek" "MT7612E" 0x14c3 0x7663 0x14c3 0x7663 0 0 "MediaTek" "MT7613BE" 0x14c3 0x7615 0x7615 0x14c3 0 0 "MediaTek" "MT7615E" 0x14c3 0x7628 0x14c3 0x0004 0 0 "MediaTek" "MT76x8" 0x14c3 0x7650 0x14c3 0x7650 0 0 "MediaTek" "MT7610E" 0x14c3 0x7662 0x14c3 0x7662 0 0 "MediaTek" "MT76x2E" 0x14c3 0x7915 0x14c3 0x7915 0 0 "MediaTek" "MT7915E" 0x14c3 0x7906 0x14c3 0x7906 0 0 "MediaTek" "MT7916AN" 0x14c3 0x7925 0x1a3b 0x6002 0 0 "MediaTek" "MT7925E" 0x14c3 0x7990 0x14C3 0x6639 0 0 "MediaTek" "MT7996E" 0x14c3 0x7992 0x14c3 0x7992 0 0 "MediaTek" "MT7992E" 0x14e4 0xaa52 0x14e4 0xaa52 0 0 "Broadcom" "BCM43602" 0x02d0 0xa9a6 0x0000 0x0000 0 0 "Cypress" "CYW43455" 0x02d0 0x4345 0x0000 0x0000 0 0 "Cypress" "CYW43455" 0x1ae9 0x0310 0x1ae9 0x0000 0 0 "Wilocity" "Wil6210" # USB devices # 0x0000 | 0x0000 | vendor id | product id | ... # mt7601u/usb.c 0x0000 0x0000 0x148f 0x7601 0 0 "MediaTek" "MT7601U" # mt7921/usb.c 0x0000 0x0000 0x0e8d 0x7961 0 0 "MediaTek" "MT7921AU" # mt76x2/usb.c 0x0000 0x0000 0x0b05 0x1833 0 0 "ASUS" "USB-AC54" 0x0000 0x0000 0x0b05 0x17eb 0 0 "ASUS" "USB-AC55" 0x0000 0x0000 0x0b05 0x180b 0 0 "ASUS" "USB-N53 B1" 0x0000 0x0000 0x0e8d 0x7612 0 0 "Aukey" "USBAC1200" /* Alfa AWUS036ACM */ 0x0000 0x0000 0x057c 0x8503 0 0 "AVM" "FRITZ!WLAN AC860" 0x0000 0x0000 0x7392 0xb711 0 0 "Edimax" "EW-7722UAC" 0x0000 0x0000 0x0e8d 0x7632 0 0 "High Cloud" "HC-M7662BU1" 0x0000 0x0000 0x2c4e 0x0103 0 0 "Mercury" "UD13" 0x0000 0x0000 0x0846 0x9053 0 0 "Netgear" "A6210" 0x0000 0x0000 0x045e 0x02e6 0 0 "Microsoft" "XBox One Wireless Adapter" 0x0000 0x0000 0x045e 0x02fe 0 0 "Microsoft" "XBox One Wireless Adapter" # mt76x0/usb.c 0x0000 0x0000 0x148f 0x7610 0 0 "MediaTek" "MT7610U" 0x0000 0x0000 0x13b1 0x003e 0 0 "Linksys" "AE6000" 0x0000 0x0000 0x0e8d 0x7610 0 0 "Sabrent" "NTWLAC" 0x0000 0x0000 0x7392 0xa711 0 0 "Edimax" "7711MAC" 0x0000 0x0000 0x148f 0x761a 0 0 "TP-Link" "TL-WDN5200" 0x0000 0x0000 0x0b05 0x17d1 0 0 "ASUS" "USB-AC51" 0x0000 0x0000 0x0b05 0x17db 0 0 "ASUS" "USB-AC50" 0x0000 0x0000 0x0df6 0x0075 0 0 "Sitecom" "WLA-3100" 0x0000 0x0000 0x2019 0xab31 0 0 "Planex" "GW-450D" 0x0000 0x0000 0x2001 0x3d02 0 0 "D-Link" "DWA-171 rev B1" 0x0000 0x0000 0x0586 0x3425 0 0 "Zyxel" "NWD6505" 0x0000 0x0000 0x07b8 0x7610 0 0 "AboCom" "AU7212" 0x0000 0x0000 0x04bb 0x0951 0 0 "I-O DATA" "WN-AC433UK" 0x0000 0x0000 0x057c 0x8502 0 0 "AVM" "FRITZ!WLAN AC430" 0x0000 0x0000 0x293c 0x5702 0 0 "Comcast" "Xfinity KXW02AAA" 0x0000 0x0000 0x20f4 0x806b 0 0 "TRENDnet" "TEW-806UBH" 0x0000 0x0000 0x7392 0xc711 0 0 "Devolo" "WiFi Stick ac" 0x0000 0x0000 0x0df6 0x0079 0 0 "Sitecom" "WL-356" 0x0000 0x0000 0x2357 0x0123 0 0 "TP-Link" "T2UHP US v1" 0x0000 0x0000 0x2357 0x010b 0 0 "TP-Link" "T2UHP UN v1" 0x0000 0x0000 0x2357 0x0105 0 0 "TP-Link" "Archer T1U" 0x0000 0x0000 0x0e8d 0x7630 0 0 "MediaTek" "MT7630U" 0x0000 0x0000 0x0e8d 0x7650 0 0 "MediaTek" "MT7650U" # mt7615/usb.c 0x0000 0x0000 0x0e8d 0x7663 0 0 "MediaTek" "MT7663U" 0x0000 0x0000 0x043e 0x310c 0 0 "LG" "LGSBWAC02" # rtl8xxxu/rtl8xxxu_core.c 0x0000 0x0000 0x0bda 0x8176 0 0 "Realtek" "RTL8188CU" 0x0000 0x0000 0x0bda 0xf179 0 0 "Realtek" "RTL8188FTV" # FDT compatible strings # "compatible" | txpower offset | frequency offset | ... "qca,ar9130-wmac" 0 0 "Atheros" "AR9130" "qca,ar9330-wmac" 0 0 "Atheros" "AR9330" "qca,ar9340-wmac" 0 0 "Atheros" "AR9340" "qca,qca9530-wmac" 0 0 "Qualcomm Atheros" "QCA9530" "qca,qca9550-wmac" 0 0 "Qualcomm Atheros" "QCA9550" "qca,qca9560-wmac" 0 0 "Qualcomm Atheros" "QCA9560" "qcom,ipq4019-wifi" 0 0 "Qualcomm Atheros" "IPQ4019" "qcom,ipq5018-wifi" 0 0 "Qualcomm Atheros" "IPQ5018" "qcom,ipq6018-wifi" 0 0 "Qualcomm Atheros" "IPQ6018" "qcom,ipq8074-wifi" 0 0 "Qualcomm Atheros" "IPQ8074" "qcom,qcn6122-wifi" 0 0 "Qualcomm Atheros" "QCN6102/QCN6122" "mediatek,mt7622-wmac" 0 0 "MediaTek" "MT7622" "mediatek,mt7628-wmac" 0 0 "MediaTek" "MT7628" "mediatek,mt7981-wmac" 0 0 "MediaTek" "MT7981" "mediatek,mt7986-wmac" 0 0 "MediaTek" "MT7986" "ralink,rt2880-wmac" 0 0 "Ralink" "Rt2880" "ralink,rt3050-wmac" 0 0 "Ralink" "Rt3050" "ralink,rt3352-wmac" 0 0 "Ralink" "Rt3352" "ralink,rt3883-wmac" 0 0 "Ralink" "Rt3883" "ralink,rt5350-wmac" 0 0 "Ralink" "Rt5350" "ralink,rt7620-wmac" 0 0 "MediaTek" "MT7620" 07070101AE2155000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001000000000usr/share/acl.d07070101AE2156000081A40000000000000000000000016A426C2800000054000000FE0000000000000000000000000000001A00000000usr/share/acl.d/ntpd.json{ "user": "ntp", "access": { "hotplug.ntp": { "methods": [ "call" ] } } } 07070101AE23B2000081A40000000000000000000000016A426C280000002B000000FE0000000000000000000000000000001A00000000usr/share/acl.d/logd.json{ "user": "logd", "publish": [ "log" ] } 07070101AE2326000081A40000000000000000000000016A426C28000001C1000000FE0000000000000000000000000000001E00000000usr/share/acl.d/wpad_acl.json{ "user": "network", "access": { "service": { "methods": [ "event" ] }, "wpa_supplicant": { "methods": [ "phy_set_state", "phy_set_macaddr_list", "phy_status" ] }, "hostapd": { "methods": [ "apsta_state" ] }, "udebug": { "methods": [ "get_config" ] } }, "subscribe": [ "udebug" ], "publish": [ "hostapd", "hostapd.*", "wpa_supplicant", "wpa_supplicant.*", "hostapd-auth" ], "send": [ "bss.*", "wps_credentials" ] } 07070101AE226B000081A40000000000000000000000016A426C28000000D9000000FE0000000000000000000000000000002100000000usr/share/acl.d/dnsmasq_acl.json{ "user": "dnsmasq", "publish": [ "dnsmasq" ], "access": { "hotplug.dhcp": { "methods": [ "call" ] }, "hotplug.neigh": { "methods": [ "call" ] }, "hotplug.tftp": { "methods": [ "call" ] } } } 07070101AE23C9000081A40000000000000000000000016A426C280000005B000000FE0000000000000000000000000000001F00000000usr/share/acl.d/luci-base.json{ "user": "nobody", "access": { "system": { "methods": [ "board", "info" ] } } } 07070101AE2427000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001300000000usr/share/ucitrack07070101AE243B000081A40000000000000000000000016A426C2800000048000000FE0000000000000000000000000000003400000000usr/share/ucitrack/luci-mod-network-interfaces.json{ "config": "network", "init": "network", "affects": [ "dhcp" ] } 07070101AE2428000081A40000000000000000000000016A426C2800000069000000FE0000000000000000000000000000002A00000000usr/share/ucitrack/luci-app-firewall.json{ "config": "firewall", "init": "firewall", "affects": [ "luci-splash", "qos", "miniupnpd" ] } 07070101AE243A000081A40000000000000000000000016A426C2800000047000000FE0000000000000000000000000000003100000000usr/share/ucitrack/luci-mod-network-dnsmasq.json{ "config": "dhcp", "init": "dnsmasq", "affects": [ "odhcpd" ] } 07070101AE2474000081A40000000000000000000000016A426C2800000035000000FE0000000000000000000000000000002F00000000usr/share/ucitrack/luci-mod-system-mounts.json{ "config": "fstab", "exec": "/sbin/block mount" } 07070101AE243D000081A40000000000000000000000016A426C2800000038000000FE0000000000000000000000000000003200000000usr/share/ucitrack/luci-mod-network-wireless.json{ "config": "wireless", "affects": [ "network" ] } 07070101AE2473000081A40000000000000000000000016A426C280000002F000000FE0000000000000000000000000000003100000000usr/share/ucitrack/luci-mod-system-dropbear.json{ "config": "dropbear", "init": "dropbear" } 07070101AE2475000081A40000000000000000000000016A426C280000007B000000FE0000000000000000000000000000002F00000000usr/share/ucitrack/luci-mod-system-system.json{ "config": "system", "init": "led", "exec": "/etc/init.d/log reload", "affects": [ "luci_statistics", "dhcp" ] } 07070101AE243C000081A40000000000000000000000016A426C280000002B000000FE0000000000000000000000000000003000000000usr/share/ucitrack/luci-mod-network-odhcpd.json{ "config": "odhcpd", "init": "odhcpd" } 07070101AE2048000041ED0000000000000000000000046A426C2800000000000000FE0000000000000000000000000000000F00000000usr/share/rpcd07070101AE2049000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001500000000usr/share/rpcd/acl.d07070101AE244C000081A40000000000000000000000016A426C28000005FF000000FE0000000000000000000000000000003000000000usr/share/rpcd/acl.d/luci-mod-status-index.json{ "luci-mod-status-index": { "description": "Grant access to main status display", "read": { "file": { "/etc/board.json": [ "read" ], "/proc/sys/net/netfilter/nf_conntrack_count": [ "read" ], "/proc/sys/net/netfilter/nf_conntrack_max": [ "read" ], "/www/luci-static/resources/view/status/include": [ "list" ] }, "ubus": { "luci": [ "getVersion", "getUnixtime", "getOdhcp6cStats" ], "file": [ "list", "read" ], "system": [ "board", "info" ] } }, "write": { "uci": [ "dhcp" ] } }, "luci-mod-status-index-storage": { "description": "Grant access to Storage and Mount status display", "read": { "ubus": { "luci": [ "getMountPoints" ], "system": [ "info" ] } } }, "luci-mod-status-index-dhcp": { "description": "Grant access to DHCP status display", "read": { "ubus": { "luci-rpc": [ "getDHCPLeases" ], "fingerprint": [ "fingerprint" ] } } }, "luci-mod-status-index-dsl": { "description": "Grant access to DSL status display", "read": { "ubus": { "dsl": [ "metrics" ] } } }, "luci-mod-status-index-ports": { "description": "Grant access to port status display", "read": { "ubus": { "luci": [ "getBuiltinEthernetPorts" ] } } }, "luci-mod-status-index-wifi": { "description": "Grant access to wireless status display", "read": { "ubus": { "iwinfo": [ "assoclist" ] } }, "write": { "ubus": { "hostapd.*": [ "del_client", "wps_start", "wps_cancel", "wps_status" ] } } } } 07070101AE2426000081A40000000000000000000000016A426C280000019B000000FE0000000000000000000000000000002C00000000usr/share/rpcd/acl.d/luci-app-firewall.json{ "luci-app-firewall": { "description": "Grant access to firewall configuration", "read": { "file": { "/etc/firewall.user": [ "read" ] }, "ubus": { "file": [ "read" ], "luci": [ "getConntrackHelpers" ] }, "uci": [ "firewall" ] }, "write": { "file": { "/etc/firewall.user": [ "write" ] }, "ubus": { "file": [ "write" ] }, "uci": [ "firewall" ] } } } 07070101AE2439000081A40000000000000000000000016A426C2800000861000000FE0000000000000000000000000000002B00000000usr/share/rpcd/acl.d/luci-mod-network.json{ "luci-mod-network-config": { "description": "Grant access to network configuration", "read": { "cgi-io": [ "exec" ], "file": { "/etc/iproute2/rt_tables": [ "read" ], "/proc/sys/net/ipv6/conf/*/mtu": [ "read" ], "/proc/sys/net/ipv6/conf/*/hop_limit": [ "read" ], "/usr/libexec/luci-peeraddr": [ "exec" ], "/proc/sys/net/ipv[46]/conf/*": [ "read" ], "/sys/class/net/*/brport/*": [ "read" ] }, "ubus": { "file": [ "exec" ], "iwinfo": [ "assoclist", "countrylist", "freqlist", "txpowerlist" ], "luci": [ "getSwconfigFeatures", "getSwconfigPortState" ] }, "uci": [ "dhcp", "firewall", "network", "wireless", "system" ] }, "write": { "cgi-io": [ "exec" ], "file": { "/sbin/ifup": [ "exec" ], "/sbin/ifdown": [ "exec" ], "/sbin/wifi": [ "exec" ] }, "ubus": { "file": [ "exec" ], "hostapd.*": [ "del_client" ], "iwinfo": [ "scan" ] }, "uci": [ "dhcp", "firewall", "network", "wireless" ] } }, "luci-mod-network-dns": { "description": "Grant access to DNS configuration", "read": { "ubus": { "luci-rpc": [ "getHostHints" ] }, "uci": [ "dhcp" ] }, "write": { "uci": [ "dhcp" ] } }, "luci-mod-network-dhcp": { "description": "Grant access to DHCP configuration", "read": { "ubus": { "luci-rpc": [ "getDHCPLeases", "getDUIDHints", "getHostHints", "getNetworkDevices" ], "fingerprint": [ "fingerprint" ], "service": [ "list" ] }, "uci": [ "dhcp" ] }, "write": { "uci": [ "dhcp" ] } }, "luci-mod-network-diagnostics": { "description": "Grant access to network diagnostic tools", "read": { "file": { "/bin/ping": [ "exec" ], "/bin/ping6": [ "exec", "list" ], "/bin/traceroute": [ "exec" ], "/bin/traceroute6": [ "exec", "list" ], "/usr/bin/nslookup": [ "exec" ], "/usr/bin/ping": [ "exec" ], "/usr/bin/ping6": [ "exec", "list" ], "/usr/bin/traceroute": [ "exec" ], "/usr/bin/traceroute6": [ "exec", "list" ], "/usr/bin/arp-scan": [ "exec", "list" ] }, "ubus": { "file": [ "exec", "stat" ] }, "uci": [ "luci" ] } } } 07070101AE24C8000081A40000000000000000000000016A426C280000021A000000FE0000000000000000000000000000003600000000usr/share/rpcd/acl.d/luci-app-attendedsysupgrade.json{ "luci-app-attendedsysupgrade": { "description": "Grant UCI access to LuCI app attendedsysupgrade", "read": { "ubus": { "rpc-sys": [ "upgrade_start", "packagelist" ], "system": [ "board", "info" ], "uci": [ "get" ] }, "file": { "/sys/firmware/efi": [ "list" ] }, "uci": [ "attendedsysupgrade" ] }, "write": { "cgi-io": [ "upload" ], "ubus": { "uci": [ "set", "commit" ] }, "uci": [ "attendedsysupgrade" ] } } } 07070101AE244D000081A40000000000000000000000016A426C28000009CF000000FE0000000000000000000000000000002A00000000usr/share/rpcd/acl.d/luci-mod-status.json{ "luci-mod-status-realtime": { "description": "Grant access to realtime statistics", "read": { "file": { "/etc/services": [ "read" ] }, "ubus": { "luci": [ "getConntrackList", "getRealtimeStats" ], "luci-rpc": [ "getHostHints", "getNetworkDevices", "getDHCPLeases" ], "network.rrdns": [ "lookup" ] } } }, "luci-mod-status-processes": { "description": "Grant access to process status", "read": { "ubus": { "luci": [ "getProcessList" ] } }, "write": { "file": { "/bin/kill": [ "exec" ] }, "ubus": { "file": [ "exec" ] } } }, "luci-mod-status-logs": { "description": "Grant access to system logs", "read": { "cgi-io": [ "exec" ], "file": { "/bin/dmesg -r": [ "exec" ], "/usr/libexec/syslog-wrapper": [ "exec" ] }, "ubus": { "log": [ "read" ], "file": [ "stat" ] } } }, "luci-mod-status-routes": { "description": "Grant access to routing status", "read": { "file": { "/sbin/ip -[46] neigh show": [ "exec" ], "/sbin/ip -[46] route show table all": [ "exec" ], "/sbin/ip -[46] rule show": [ "exec" ] }, "ubus": { "file": [ "exec" ], "fingerprint": [ "fingerprint" ] } } }, "luci-mod-status-routes-json": { "description": "Grant access to routing status", "read": { "file": { "/sbin/ip -[46] -j neigh show": [ "exec" ], "/sbin/ip -[46] -j route show table all": [ "exec" ], "/sbin/ip -[46] -j rule show": [ "exec" ] }, "ubus": { "file": [ "exec" ], "fingerprint": [ "fingerprint" ] } } }, "luci-mod-status-channel_analysis": { "description": "Grant access to wireless channel status", "read": { "ubus": { "iwinfo": [ "info", "freqlist", "scan" ] } } }, "luci-mod-status-firewall": { "description": "Grant access to firewall status", "read": { "cgi-io": [ "exec" ], "file": { "/usr/sbin/nft --terse --json list ruleset": [ "exec" ], "/usr/sbin/iptables --line-numbers -w -nvxL -t *": [ "exec" ], "/usr/sbin/ip6tables --line-numbers -w -nvxL -t *": [ "exec" ], "/usr/sbin/ip6tables": [ "list" ], "/usr/sbin/iptables-save": [ "exec" ], "/usr/sbin/ip6tables-save": [ "exec" ] }, "ubus": { "file": [ "stat" ] } }, "write": { "cgi-io": [ "exec" ], "file": { "/etc/init.d/firewall restart": [ "exec" ], "/usr/sbin/iptables -Z": [ "exec" ], "/usr/sbin/ip6tables -Z": [ "exec" ] }, "ubus": { "file": [ "exec" ] } } } } 07070101AE2421000081A40000000000000000000000016A426C28000004FF000000FE0000000000000000000000000000003300000000usr/share/rpcd/acl.d/luci-app-package-manager.json{ "luci-app-package-manager": { "description": "Grant access to package management", "read": { "cgi-io": [ "exec" ], "file": { "/usr/libexec/package-manager-call list-installed": [ "exec" ], "/usr/libexec/package-manager-call list-available": [ "exec" ], "/etc/opkg.conf": [ "read" ], "/etc/opkg/*.conf": [ "read" ], "/etc/apk/repositories": [ "read" ], "/etc/apk/repositories.d/distfeeds.list": [ "read" ], "/etc/apk/repositories.d/customfeeds.list": [ "read" ] }, "ubus": { "luci": [ "getMountPoints" ] } }, "write": { "file": { "/usr/libexec/package-manager-call install": [ "exec" ], "/usr/libexec/package-manager-call install *": [ "exec" ], "/usr/libexec/package-manager-call remove *": [ "exec" ], "/usr/libexec/package-manager-call update": [ "exec" ], "/usr/libexec/package-manager-call upgrade": [ "exec" ], "/usr/libexec/package-manager-call upgrade *": [ "exec" ], "/etc/opkg.conf": [ "write" ], "/etc/opkg/*.conf": [ "write" ], "/etc/apk/repositories": [ "write" ], "/etc/apk/repositories.d/distfeeds.list": [ "write" ], "/etc/apk/repositories.d/customfeeds.list": [ "write" ], "/tmp/upload.ipk": [ "write" ], "/tmp/upload.apk": [ "write" ] } } } } 07070101AE23CD000081A40000000000000000000000016A426C28000003F6000000FE0000000000000000000000000000002400000000usr/share/rpcd/acl.d/luci-base.json{ "unauthenticated": { "description": "Allow system feature probing", "read": { "ubus": { "luci": [ "getFeatures" ] } } }, "luci-base": { "description": "Grant access to basic LuCI procedures", "read": { "file": { "/": [ "list" ], "/*": [ "list" ] }, "ubus": { "file": [ "list" ], "uci": [ "changes", "get" ] }, "uci": [ "system", "luci" ] }, "write": { "cgi-io": [ "upload" ], "file": { "/etc/luci-uploads/*": [ "write" ] }, "ubus": { "file": [ "remove" ], "uci": [ "add", "apply", "confirm", "delete", "order", "rename", "set" ] } } }, "luci-base-network-status": { "description": "Grant access to network status information", "read": { "ubus": { "luci-rpc": [ "getBoardJSON", "getHostHints", "getNetworkDevices", "getWirelessDevices" ], "network": [ "get_proto_handlers" ], "network.device": [ "status" ], "network.interface": [ "dump" ] }, "uci": [ "luci", "network", "wireless" ] } } } 07070101AE2472000081A40000000000000000000000016A426C2800001248000000FE0000000000000000000000000000002A00000000usr/share/rpcd/acl.d/luci-mod-system.json{ "luci-mod-system-config": { "description": "Grant access to system configuration", "read": { "ubus": { "luci": [ "getLEDs", "getTimezones", "getUSBDevices", "getUnixtime" ], "rc": [ "list" ] }, "uci": [ "luci", "system" ] }, "write": { "ubus": { "luci": [ "setLocaltime", "setPassword" ], "rc": [ "init" ] }, "uci": [ "luci", "system" ] } }, "luci-mod-system-ssh": { "description": "Grant access to SSH configuration", "read": { "file": { "/etc/dropbear/authorized_keys": [ "read" ] }, "ubus": { "file": [ "read" ] }, "uci": [ "dropbear" ] }, "write": { "file": { "/etc/dropbear/authorized_keys": [ "write" ] }, "ubus": { "file": [ "write" ], "luci": [ "setLocaltime" ] }, "uci": [ "dropbear" ] } }, "luci-mod-system-repokeys": { "description": "Grant access to Software Repository Public Key management", "read": { "file": { "/etc/opkg/keys/*": [ "read" ], "/etc/apk/keys/*": [ "read" ] } }, "write": { "file": { "/etc/opkg/keys/*": [ "write" ], "/etc/apk/keys/*": [ "write" ] } } }, "luci-mod-system-uhttpd": { "description": "Grant access to uHTTPd configuration", "read": { "uci": [ "uhttpd" ] }, "write": { "uci": [ "uhttpd" ] } }, "luci-mod-system-init": { "description": "Grant access to startup configuration", "read": { "file": { "/etc/rc.local": [ "read" ] }, "ubus": { "file": [ "read" ], "rc": [ "list" ] } }, "write": { "file": { "/etc/rc.local": [ "write" ] }, "ubus": { "file": [ "write" ], "rc": [ "init" ] } } }, "luci-mod-system-cron": { "description": "Grant access to crontab configuration", "read": { "file": { "/etc/crontabs/root": [ "read" ] }, "ubus": { "file": [ "read" ] } }, "write": { "file": { "/etc/crontabs/root": [ "write" ], "/etc/init.d/cron reload": [ "exec" ] }, "ubus": { "file": [ "write" ] } } }, "luci-mod-system-mounts": { "description": "Grant access to mount configuration", "read": { "file": { "/etc/filesystems": [ "read" ], "/proc/filesystems": [ "read" ], "/usr/bin/btrfsck": [ "list" ], "/usr/bin/ntfsfix": [ "list" ], "/usr/sbin/e2fsck": [ "list" ], "/usr/sbin/fsck.f2fs": [ "list" ], "/usr/sbin/fsck.fat": [ "list" ] }, "ubus": { "file": [ "read", "stat" ], "luci": [ "getBlockDevices", "getMountPoints" ] }, "uci": [ "fstab" ] }, "write": { "file": { "/etc/crontabs/root": [ "write" ], "/bin/umount": [ "exec" ], "/sbin/block": [ "exec" ] }, "ubus": { "file": [ "exec", "write" ], "luci": [ "setBlockDetect" ] }, "uci": [ "fstab" ] } }, "luci-mod-system-flash": { "description": "Grant access to flash operations", "read": { "cgi-io": [ "backup", "download" ], "file": { "/dev/mtdblock[0-9]*": [ "read" ], "/etc/sysupgrade.conf": [ "read" ], "/lib/upgrade/platform.sh": [ "list" ], "/proc/mounts": [ "read" ], "/proc/mtd": [ "read" ], "/proc/partitions": [ "read" ], "/proc/sys/kernel/hostname": [ "read" ], "/sbin/sysupgrade --list-backup": [ "exec" ] }, "ubus": { "file": [ "exec", "read", "stat" ] } }, "write": { "cgi-io": [ "upload" ], "file": { "/bin/tar -tzf /tmp/backup.tar.gz": [ "exec" ], "/etc/sysupgrade.conf": [ "write" ], "/sbin/firstboot -r -y": [ "exec" ], "/sbin/reboot": [ "exec" ], "/sbin/sysupgrade --force /tmp/firmware.bin": [ "exec" ], "/sbin/sysupgrade -n --force /tmp/firmware.bin": [ "exec" ], "/sbin/sysupgrade --force -k /tmp/firmware.bin": [ "exec" ], "/sbin/sysupgrade --force -u /tmp/firmware.bin": [ "exec" ], "/sbin/sysupgrade --force -u -k /tmp/firmware.bin": [ "exec" ], "/sbin/sysupgrade -n /tmp/firmware.bin": [ "exec" ], "/sbin/sysupgrade -k /tmp/firmware.bin": [ "exec" ], "/sbin/sysupgrade -u /tmp/firmware.bin": [ "exec" ], "/sbin/sysupgrade -u -k /tmp/firmware.bin": [ "exec" ], "/sbin/sysupgrade --restore-backup /tmp/backup.tar.gz": [ "exec" ], "/sbin/sysupgrade --test /tmp/firmware.bin": [ "exec" ], "/sbin/sysupgrade /tmp/firmware.bin": [ "exec" ], "/tmp/backup.tar.gz": [ "write" ], "/tmp/firmware.bin": [ "write" ] }, "ubus": { "file": [ "exec", "remove", "write" ], "system": [ "validate_firmware_image" ] } } }, "luci-mod-system-reboot": { "description": "Allow rebooting the device", "write": { "file": { "/sbin/reboot": [ "exec" ] }, "ubus": { "file": [ "exec" ], "system": [ "reboot" ] } } } } 07070101AE204A000081A40000000000000000000000016A426C28000000B3000000FE0000000000000000000000000000002A00000000usr/share/rpcd/acl.d/unauthenticated.json{ "unauthenticated": { "description": "Access controls for unauthenticated requests", "read": { "ubus": { "session": [ "access", "login" ] } } } } 07070101AE23CE000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001500000000usr/share/rpcd/ucode07070101AE23CF000081A40000000000000000000000016A426C2800003F21000000FE0000000000000000000000000000001A00000000usr/share/rpcd/ucode/luci// Copyright 2022 Jo-Philipp Wich // Licensed to the public under the Apache License 2.0. 'use strict'; import { stdin, access, dirname, basename, open, popen, glob, lsdir, readfile, readlink, realpath, error } from 'fs'; import { cursor } from 'uci'; import { init_list, init_index, init_enabled, init_action, conntrack_list, process_list } from 'luci.sys'; import { revision, branch } from 'luci.version'; import { statvfs, uname } from 'luci.core'; import { connect } from 'ubus'; import timezones from 'luci.zoneinfo'; function shellquote(s) { return `'${replace(s, "'", "'\\''")}'`; } function callPackageVersionCheck(pkg) { let version = ""; if ( access('/bin/opkg') ) { // <= v24.10 let fd = popen('opkg list-installed ' + shellquote(pkg) + ' 2>/dev/null'); if (fd) { const re = regexp('^' + pkg + ' - (.+)$', 's'); const m = match(fd.read('all'), re); version = m?.[1]; fd.close(); } } else if ( access('/usr/bin/apk') ) { // > v24.10 let fd = popen('apk list -I ' + shellquote(pkg) + ' 2>/dev/null'); if (fd) { const re = regexp('^' + pkg + '-(.+)$', 's'); const m = match(fd.read('all'), re); version = m?.[1]; fd.close(); } } return version; } const methods = { getVersion: { call: function(request) { return { revision, branch }; } }, getInitList: { args: { name: 'name' }, call: function(request) { let scripts = {}; for (let name in filter(init_list(), i => !request.args.name || i == request.args.name)) { let idx = init_index(name); scripts[name] = { index: idx?.[0], stop: idx?.[1], enabled: init_enabled(name) }; } return length(scripts) ? scripts : { error: 'No such init script' }; } }, setInitAction: { args: { name: 'name', action: 'action' }, call: function(request) { switch (request.args.action) { case 'enable': case 'disable': case 'start': case 'stop': case 'restart': case 'reload': const rc = init_action(request.args.name, request.args.action); if (rc === false) return { error: 'No such init script' }; return { result: rc == 0 }; default: return { error: 'Invalid action' }; } } }, getUnixtime: { call: function(request) { // time() ; Returns the current UNIX epoch. return { result: time() }; } }, setLocaltime: { args: { localtime: 0 }, call: function(request) { let t = localtime(request.args.localtime); if (t) { system(sprintf('date -s "%04d-%02d-%02d %02d:%02d:%02d" >/dev/null', t.year, t.mon, t.mday, t.hour, t.min, t.sec)); system('/etc/init.d/sysfixtime restart >/dev/null'); } return { result: request.args.localtime }; } }, getTimezones: { call: function(request) { let tz = trim(readfile('/etc/TZ')); let zn = cursor()?.get?.('system', '@system[0]', 'zonename'); let result = {}; for (let zone, tzstring in timezones) { result[zone] = { tzstring }; if (zn == zone) result[zone].active = true; }; return result; } }, getLEDs: { call: function() { let result = {}; for (let led in lsdir('/sys/class/leds')) { let s; result[led] = { triggers: [] }; s = trim(readfile(`/sys/class/leds/${led}/trigger`)); for (let trigger in split(s, ' ')) { push(result[led].triggers, trim(trigger, '[]')); if (trigger != result[led].triggers[-1]) result[led].active_trigger = result[led].triggers[-1]; } s = readfile(`/sys/class/leds/${led}/brightness`); result[led].brightness = +s; s = readfile(`/sys/class/leds/${led}/max_brightness`); result[led].max_brightness = +s; } return result; } }, getUSBDevices: { call: function() { let result = { devices: [], ports: [] }; for (let path in glob('/sys/bus/usb/devices/[0-9]*/manufacturer')) { let id = basename(dirname(path)); push(result.devices, { id, vid: trim(readfile(`/sys/bus/usb/devices/${id}/idVendor`)), pid: trim(readfile(`/sys/bus/usb/devices/${id}/idProduct`)), vendor: trim(readfile(path)), product: trim(readfile(`/sys/bus/usb/devices/${id}/product`)), speed: +readfile(`/sys/bus/usb/devices/${id}/speed`) }); } for (let path in glob('/sys/bus/usb/devices/*/*-port[0-9]*')) { let port = basename(path); let link = readlink(`${path}/device`); push(result.ports, { port, device: basename(link) }); } return result; } }, getConntrackHelpers: { call: function() { const uci = cursor(); let helpers = []; let package; if (uci.load('/usr/share/firewall4/helpers')) package = 'helpers'; else if (uci.load('/usr/share/fw3/helpers.conf')) package = 'helpers.conf'; if (package) { uci.foreach(package, 'helper', (s) => { push(helpers, { name: s.name, description: s.description, module: s.module, family: s.family, proto: s.proto, port: s.port }); }); } return { result: helpers }; } }, getFeatures: { call: function() { let result = { firewall: access('/sbin/fw3') == true, firewall4: access('/sbin/fw4') == true, opkg: access('/bin/opkg') == true, bonding: access('/sys/module/bonding'), mii_tool: access('/usr/sbin/mii-tool'), offloading: access('/sys/module/xt_FLOWOFFLOAD/refcnt') == true || access('/sys/module/nft_flow_offload/refcnt') == true, br2684ctl: access('/usr/sbin/br2684ctl') == true, swconfig: access('/sbin/swconfig') == true, zram: access('/sys/class/zram-control') == true, sysntpd: readlink('/usr/sbin/ntpd') != null, ipv6: access('/proc/net/ipv6_route') == true, dropbear: access('/usr/sbin/dropbear') == true, cabundle: access('/etc/ssl/certs/ca-certificates.crt') == true, relayd: access('/usr/sbin/relayd') == true, apk: access('/usr/bin/apk') == true, wifi: access('/sbin/wifi') == true, ufpd: access('/usr/sbin/ufpd') == true, vrf: access('/sys/module/vrf/refcnt') == true, // vrf.ko is loaded netifd_vrf: false, mptcp: access('/proc/sys/net/mptcp/enabled'), }; const wifi_features = [ '11ac', '11ax', '11be', '11r', 'acs', 'eap', 'mesh', 'ocv', 'owe', 'sae', 'suiteb192', 'wep', 'wps', ]; if (access('/usr/sbin/hostapd')) { result.hostapd = { cli: access('/usr/sbin/hostapd_cli') == true }; for (let feature in wifi_features) result.hostapd[feature] = system(`/usr/sbin/hostapd -v${feature} >/dev/null 2>/dev/null`) == 0; } if (access('/usr/sbin/wpa_supplicant')) { result.wpasupplicant = { cli: access('/usr/sbin/wpa_cli') == true }; for (let feature in wifi_features) result.wpasupplicant[feature] = system(`/usr/sbin/wpa_supplicant -v${feature} >/dev/null 2>/dev/null`) == 0; } let fd = popen('dnsmasq --version 2>/dev/null'); if (fd) { const m = match(fd.read('all'), /^Compile time options: (.+)$/s); for (let opt in split(m?.[1], ' ')) { let f = replace(opt, 'no-', '', 1); result.dnsmasq ??= {}; result.dnsmasq[lc(f)] = (f == opt); } fd.close(); } result.odhcpd = false; fd = popen('odhcpd -h 2>/dev/null'); if (fd) { const output = fd.read('all'); if (output) { result.odhcpd = {}; const m = match(output, /^Features: (.+)$/s); for (let opt in split(m?.[1], ' ')) { let f = replace(opt, 'no-', '', 1); result.odhcpd[lc(f)] = (f == opt); } } fd.close(); } // This check can be removed after v25 release result.netifd_vrf = match(callPackageVersionCheck('netifd'), /^20[0-9][0-9]/s)?.[0] >= 2025; fd = popen('ipset --help 2>/dev/null'); if (fd) { for (let line = fd.read('line'), flag = false; length(line); line = fd.read('line')) { if (line == 'Supported set types:\n') { flag = true; } else if (flag) { const m = match(line, /^ +([\w:,]+)\t+([0-9]+)\t/); if (m) { result.ipset ??= {}; result.ipset[m[1]] ??= +m[2]; } } } fd.close(); } return result; } }, getSwconfigFeatures: { args: { switch: 'switch0' }, call: function(request) { // Parse some common switch properties from swconfig help output. const swc = popen(`swconfig dev ${shellquote(request.args.switch)} help 2>/dev/null`); if (swc) { let is_port_attr = false; let is_vlan_attr = false; let result = {}; for (let line = swc.read('line'); length(line); line = swc.read('line')) { if (match(line, /^\s+--vlan/)) { is_vlan_attr = true; } else if (match(line, /^\s+--port/)) { is_vlan_attr = false; is_port_attr = true; } else if (match(line, /cpu @/)) { result.switch_title = match(line, /^switch[0-9]+: \w+\((.+)\)/)?.[1]; result.num_vlans = match(line, /vlans: ([0-9]+)/)?.[1] ?? 16; result.min_vid = 1; } else if (match(line, /: (pvid|tag|vid)/)) { if (is_vlan_attr) result.vid_option = match(line, /: (\w+)/)?.[1]; } else if (match(line, /: enable_vlan4k/)) { result.vlan4k_option = 'enable_vlan4k'; } else if (match(line, /: enable_vlan/)) { result.vlan_option = 'enable_vlan'; } else if (match(line, /: enable_learning/)) { result.learning_option = 'enable_learning'; } else if (match(line, /: enable_mirror_rx/)) { result.mirror_option = 'enable_mirror_rx'; } else if (match(line, /: max_length/)) { result.jumbo_option = 'max_length'; } } swc.close(); if (!length(result)) return { error: 'No such switch' }; return result; } else { return { error: error() }; } } }, getSwconfigPortState: { args: { switch: 'switch0' }, call: function(request) { const swc = popen(`swconfig dev ${shellquote(request.args.switch)} show 2>/dev/null`); if (swc) { let ports = [], port; for (let line = swc.read('line'); length(line); line = swc.read('line')) { if (match(line, /^VLAN [0-9]+:/) && length(ports)) break; let pnum = match(line, /^Port ([0-9]+):/)?.[1]; if (pnum) { port = { port: +pnum, duplex: false, speed: 0, link: false, auto: false, rxflow: false, txflow: false }; push(ports, port); } if (port) { let m; if (match(line, /full[ -]duplex/)) port.duplex = true; if ((m = match(line, / speed:([0-9]+)/)) != null) port.speed = +m[1]; if ((m = match(line, /([0-9]+) Mbps/)) != null && !port.speed) port.speed = +m[1]; if ((m = match(line, /link: ([0-9]+)/)) != null && !port.speed) port.speed = +m[1]; if (match(line, /(link|status): ?up/)) port.link = true; if (match(line, /auto-negotiate|link:.*auto/)) port.auto = true; if (match(line, /link:.*rxflow/)) port.rxflow = true; if (match(line, /link:.*txflow/)) port.txflow = true; } } swc.close(); if (!length(ports)) return { error: 'No such switch' }; return { result: ports }; } else { return { error: error() }; } } }, setPassword: { args: { username: 'root', password: 'password' }, call: function(request) { const u = shellquote(request.args.username); const p = shellquote(request.args.password); return { result: system(`(echo ${p}; sleep 1; echo ${p}) | /bin/busybox passwd ${u} >/dev/null 2>&1`) == 0 }; } }, getBlockDevices: { call: function() { const block = popen('/sbin/block info 2>/dev/null'); if (block) { let result = {}; for (let line = block.read('line'); length(line); line = block.read('line')) { let dev = match(line, /^\/dev\/([^:]+):/)?.[1]; if (dev) { let e = result[dev] = { dev: `/dev/${dev}`, size: +readfile(`/sys/class/block/${dev}/size`) * 512 }; for (let m in match(line, / (\w+)="([^"]+)"/g)) e[lc(m[1])] = m[2]; } } block.close(); const swaps = open('/proc/swaps', 'r'); if (swaps) { for (let line = swaps.read('line'); length(line); line = swaps.read('line')) { let m = match(line, /^(\/\S+)\s+\S+\s+(\d+)/); if (m) { let dev = replace(m[1], /\\(\d\d\d)/g, (_, n) => chr(int(n, 8))); result[`swap:${m[1]}`] = { dev, type: 'swap', size: +m[2] * 1024 }; } } swaps.close(); } return result; } else { return { error: 'Unable to execute block utility' }; } } }, setBlockDetect: { call: function() { return { result: system('/sbin/block detect > /etc/config/fstab') == 0 }; } }, getMountPoints: { call: function() { const fd = open('/proc/mounts', 'r'); if (fd) { let result = []; for (let line = fd.read('line'); length(line); line = fd.read('line')) { const m = split(line, ' '); const device = replace(m[0], /\\([0-9][0-9][0-9])/g, (m, n) => chr(int(n, 8))); const mount = replace(m[1], /\\([0-9][0-9][0-9])/g, (m, n) => chr(int(n, 8))); const stat = statvfs(mount); if (stat?.blocks > 0) { push(result, { device, mount, size: stat.bsize * stat.blocks, avail: stat.bsize * stat.bavail, free: stat.bsize * stat.bfree }); } } fd.close(); return { result }; } else { return { error: error() }; } } }, getRealtimeStats: { args: { mode: 'interface', device: 'eth0' }, call: function(request) { let flags; if (request.args.mode == 'interface') flags = `-i ${shellquote(request.args.device)}`; else if (request.args.mode == 'wireless') flags = `-r ${shellquote(request.args.device)}`; else if (request.args.mode == 'conntrack') flags = '-c'; else if (request.args.mode == 'load') flags = '-l'; else return { error: 'Invalid mode' }; const fd = popen(`luci-bwc ${flags}`, 'r'); if (fd) { let result; try { result = { result: json(`[${fd.read('all')}]`) }; } catch (err) { result = { error: err }; } return result; } else { return { error: error() }; } } }, getConntrackList: { call: function() { return { result: conntrack_list() }; } }, getProcessList: { call: function() { return { result: process_list() }; } }, getBuiltinEthernetPorts: { call: function() { let fd = open('/etc/board.json', 'r'); let board = fd ? json(fd) : {}; let ports = []; for (let k in [ 'lan', 'wan' ]) { if (!board?.network?.[k]) continue; if (type(board.network[k].ports) == 'array') { for (let ifname in board.network[k].ports) { push(ports, { role: k, device: ifname }); } } else if (type(board.network[k].device) == 'string') { push(ports, { role: k, device: board.network[k].device }); } } /* Workaround for targets that do not enumerate all netdevs in board.json */ if (uname().machine in [ 'x86_64' ] && match(ports[0]?.device, /^eth\d+$/)) { let bus = realpath(`/sys/class/net/${ports[0].device}/device/subsystem`); for (let netdev in lsdir('/sys/class/net')) { if (!match(netdev, /^eth\d+$/)) continue; if (length(filter(ports, port => port.device == netdev))) continue; if (realpath(`/sys/class/net/${netdev}/device/subsystem`) != bus) continue; push(ports, { role: 'unknown', device: netdev }); } } return { result: ports }; } }, getOdhcp6cStats: { call: function() { const ubus = connect(); const devs = ubus.call('network.device', 'status'); if (!devs) return false; const dev_stats = {}; for (let dev in devs) { const m = ubus.call(`odhcp6c.${dev}`, 'get_statistics'); // not all interfaces are exposed unless odhcp6c runs on it if (!m) continue; push(dev_stats, dev); dev_stats[dev] = m; } return { result: dev_stats }; } } }; return { luci: methods }; 07070101AE231D000041ED0000000000000000000000056A426C2800000000000000FE0000000000000000000000000000001000000000usr/share/ucode07070101AE231E000081A40000000000000000000000016A426C280001380E000000FE0000000000000000000000000000001700000000usr/share/ucode/fw4.ucconst fs = require("fs"); const uci = require("uci"); const ubus = require("ubus"); const STATEFILE = "/var/run/fw4.state"; const PARSE_LIST = 0x01; const FLATTEN_LIST = 0x02; const NO_INVERT = 0x04; const UNSUPPORTED = 0x08; const REQUIRED = 0x10; const DEPRECATED = 0x20; const ipv4_icmptypes = { "any": [ 0xFF, 0, 0xFF ], "echo-reply": [ 0, 0, 0xFF ], "pong": [ 0, 0, 0xFF ], /* Alias */ "destination-unreachable": [ 3, 0, 0xFF ], "network-unreachable": [ 3, 0, 0 ], "host-unreachable": [ 3, 1, 1 ], "protocol-unreachable": [ 3, 2, 2 ], "port-unreachable": [ 3, 3, 3 ], "fragmentation-needed": [ 3, 4, 4 ], "source-route-failed": [ 3, 5, 5 ], "network-unknown": [ 3, 6, 6 ], "host-unknown": [ 3, 7, 7 ], "network-prohibited": [ 3, 9, 9 ], "host-prohibited": [ 3, 10, 10 ], "TOS-network-unreachable": [ 3, 11, 11 ], "TOS-host-unreachable": [ 3, 12, 12 ], "communication-prohibited": [ 3, 13, 13 ], "host-precedence-violation": [ 3, 14, 14 ], "precedence-cutoff": [ 3, 15, 15 ], "source-quench": [ 4, 0, 0xFF ], "redirect": [ 5, 0, 0xFF ], "network-redirect": [ 5, 0, 0 ], "host-redirect": [ 5, 1, 1 ], "TOS-network-redirect": [ 5, 2, 2 ], "TOS-host-redirect": [ 5, 3, 3 ], "echo-request": [ 8, 0, 0xFF ], "ping": [ 8, 0, 0xFF ], /* Alias */ "router-advertisement": [ 9, 0, 0xFF ], "router-solicitation": [ 10, 0, 0xFF ], "time-exceeded": [ 11, 0, 0xFF ], "ttl-exceeded": [ 11, 0, 0xFF ], /* Alias */ "ttl-zero-during-transit": [ 11, 0, 0 ], "ttl-zero-during-reassembly": [ 11, 1, 1 ], "parameter-problem": [ 12, 0, 0xFF ], "ip-header-bad": [ 12, 0, 0 ], "required-option-missing": [ 12, 1, 1 ], "timestamp-request": [ 13, 0, 0xFF ], "timestamp-reply": [ 14, 0, 0xFF ], "address-mask-request": [ 17, 0, 0xFF ], "address-mask-reply": [ 18, 0, 0xFF ] }; const ipv6_icmptypes = { /* "name": [ type-code, code-min, code-max ] */ "destination-unreachable": [ 1, 0, 0xFF ], "no-route": [ 1, 0, 0 ], "communication-prohibited": [ 1, 1, 1 ], "address-unreachable": [ 1, 3, 3 ], "port-unreachable": [ 1, 4, 4 ], "packet-too-big": [ 2, 0, 0xFF ], "time-exceeded": [ 3, 0, 0xFF ], "ttl-exceeded": [ 3, 0, 0xFF ], /* Alias */ "ttl-zero-during-transit": [ 3, 0, 0 ], "ttl-zero-during-reassembly": [ 3, 1, 1 ], "parameter-problem": [ 4, 0, 0xFF ], "bad-header": [ 4, 0, 0 ], "unknown-header-type": [ 4, 1, 1 ], "unknown-option": [ 4, 2, 2 ], "echo-request": [ 128, 0, 0xFF ], "ping": [ 128, 0, 0xFF ], /* Alias */ "echo-reply": [ 129, 0, 0xFF ], "pong": [ 129, 0, 0xFF ], /* Alias */ /* only code zero (0) */ "multicast-listener-query": [ 130, 0, 0xFF ], "multicast-listener-report": [ 131, 0, 0xFF ], "multicast-listener-done": [ 132, 0, 0xFF ], "router-solicitation": [ 133, 0, 0xFF ], "router-advertisement": [ 134, 0, 0xFF ], "neighbour-solicitation": [ 135, 0, 0xFF ], "neighbor-solicitation": [ 135, 0, 0xFF ], /* Alias */ "neighbour-advertisement": [ 136, 0, 0xFF ], "neighbor-advertisement": [ 136, 0, 0xFF ], /* Alias */ "redirect": [ 137, 0, 0xFF ], /* codes 0, 1, 255 */ "router-renumbering": [ 138, 0, 0xFF ], /* codes 0, 1, 2 */ "node-info-query": [ 139, 0, 0xFF ], /* codes 0, 1, 2 */ "node-info-response": [ 140, 0, 0xFF ], "inverse-neighbour-discovery-solicitation-message": [ 141, 0, 0xFF ], "inverse-neighbor-discovery-solicitation-message": [ 141, 0, 0xFF ], /* Alias */ "inverse-neighbour-discovery-advertisement-message": [ 142, 0, 0xFF ], "inverse-neighbor-discovery-advertisement-message": [ 142, 0, 0xFF ], /* Alias */ "v2-multicast-listener-report": [ 143, 0, 0xFF ], "home-agent-address-discovery-request-message": [ 144, 0, 0xFF ], "home-agent-address-discovery-reply-message": [ 145, 0, 0xFF ], "mobile-prefix-solicitation": [ 146, 0, 0xFF ], "mobile-prefix-advertisement": [ 147, 0, 0xFF ], /* SEND */ "certification-path-solicitation-message": [ 148, 0, 0xFF ], "certification-path-advertisement-message": [ 149, 0, 0xFF ], "seamoby-protocol-message": [ 150, 0, 0xFF ], /* IPv6 multicast: FF02:0:0:0:0:0:0:6A, no code fields */ "multicast-router-advertisement": [ 151, 0, 0xFF ], "multicast-router-solicitation": [ 152, 0, 0xFF ], "multicast-router-termination": [ 153, 0, 0xFF ], /* codes 0-5, 6-255 */ "fmipv6-message": [ 154, 0, 0xFF ], "rpl-control-message": [ 155, 0, 0xFF ], "ilnpv6-locator-update-message": [ 156, 0, 0xFF ], /* codes 0-4, 5-15 */ "duplicate-address-request": [ 157, 0, 0xFF ], /* codes 0-4, 5-15 */ "duplicate-address-confirmation": [ 158, 0, 0xFF ], /* Multicast Protocol for Low-Power */ "mpl-control-message": [ 159, 0, 0xFF ], /* codes 0, 1-255 */ "extended-echo-request": [ 160, 0, 0xFF ], "extended-ping": [ 160, 0, 0xFF ], /* Alias */ /* codes 0-4, 5-255 */ "extended-echo-reply": [ 161, 0, 0xFF ], "extended-pong": [ 161, 0, 0xFF ] /* Alias */ }; const dscp_classes = { "CS0": 0x00, "CS1": 0x08, "CS2": 0x10, "CS3": 0x18, "CS4": 0x20, "CS5": 0x28, "CS6": 0x30, "CS7": 0x38, "BE": 0x00, "LE": 0x01, "AF11": 0x0a, "AF12": 0x0c, "AF13": 0x0e, "AF21": 0x12, "AF22": 0x14, "AF23": 0x16, "AF31": 0x1a, "AF32": 0x1c, "AF33": 0x1e, "AF41": 0x22, "AF42": 0x24, "AF43": 0x26, "EF": 0x2e }; function to_mask(bits, v6) { let m = [], n = false; if (bits < 0) { n = true; bits = -bits; } if (bits > (v6 ? 128 : 32)) return null; for (let i = 0; i < (v6 ? 16 : 4); i++) { let b = (bits < 8) ? bits : 8; m[i] = (n ? ~(0xff << (8 - b)) : (0xff << (8 - b))) & 0xff; bits -= b; } return arrtoip(m); } function to_bits(mask) { let a = iptoarr(mask); if (!a) return null; let bits = 0; for (let i = 0, z = false; i < length(a); i++) { z ||= !a[i]; while (!z && (a[i] & 0x80)) { a[i] = (a[i] << 1) & 0xff; bits++; } if (a[i]) return null; } return bits; } function apply_mask(addr, mask) { let a = iptoarr(addr); if (!a) return null; if (type(mask) == "int") { for (let i = 0; i < length(a); i++) { let b = (mask < 8) ? mask : 8; a[i] &= (0xff << (8 - b)) & 0xff; mask -= b; } } else { let m = iptoarr(mask); if (!m || length(a) != length(m)) return null; for (let i = 0; i < length(a); i++) a[i] &= m[i]; } return arrtoip(a); } function to_array(x) { if (type(x) == "array") return x; if (x == null) return []; if (type(x) == "object") return [ x ]; x = trim("" + x); return (x == "") ? [] : split(x, /[ \t]+/); } function filter_pos(x) { let rv = filter(x, e => !e.invert); return length(rv) ? rv : null; } function filter_neg(x) { let rv = filter(x, e => e.invert); return length(rv) ? rv : null; } function null_if_empty(x) { return length(x) ? x : null; } function subnets_split_af(x) { let rv = {}; for (let ag in to_array(x)) { for (let a in filter(ag.addrs, a => (a.family == 4))) push(rv[0] ||= [], { ...a, invert: ag.invert }); for (let a in filter(ag.addrs, a => (a.family == 6))) push(rv[1] ||= [], { ...a, invert: ag.invert }); } if (rv[0] || rv[1]) rv.family = (!rv[0] ^ !rv[1]) ? (rv[0] ? 4 : 6) : 0; return rv; } function subnets_group_by_masking(x) { let groups = [], plain = [], nc = [], invert_plain = [], invert_masked = []; for (let a in to_array(x)) { if (a.bits == -1 && !a.invert) push(nc, a); else if (!a.invert) push(plain, a); else if (a.bits == -1) push(invert_masked, a); else push(invert_plain, a); } for (let a in nc) push(groups, [ null, null_if_empty(invert_plain), [ a, ...invert_masked ] ]); if (length(plain)) { push(groups, [ plain, null_if_empty(invert_plain), null_if_empty(invert_masked) ]); } else if (!length(groups)) { push(groups, [ null, null_if_empty(invert_plain), null_if_empty(invert_masked) ]); } return groups; } function ensure_tcpudp(x) { if (length(filter(x, p => (p.name == "tcp" || p.name == "udp")))) return true; let rest = filter(x, p => !p.any), any = filter(x, p => p.any); if (length(any) && !length(rest)) { splice(x, 0); push(x, { name: "tcp" }, { name: "udp" }); return true; } return false; } let is_family = (x, v) => (!x.family || x.family == v); let family_is_ipv4 = (x) => (!x.family || x.family == 4); let family_is_ipv6 = (x) => (!x.family || x.family == 6); function infer_family(f, objects) { let res = f; let by = null; for (let i = 0; i < length(objects); i += 2) { let objs = to_array(objects[i]), desc = objects[i + 1]; for (let obj in objs) { if (!obj || !obj.family || obj.family == res) continue; if (!res) { res = obj.family; by = obj.desc; continue; } return by ? `references IPv${obj.family} only ${desc} but is restricted to IPv${res} by ${by}` : `is restricted to IPv${res} but referenced ${desc} is IPv${obj.family} only`; } } return res; } function map_setmatch(set, match, proto) { if (!set || (('inet_service' in set.types) && proto != 'tcp' && proto != 'udp')) return null; let fields = []; for (let i, t in set.types) { let dir = ((match.dir?.[i] || set.directions[i] || 'src') == 'src' ? 's' : 'd'); switch (t) { case 'ipv4_addr': fields[i] = `ip ${dir}addr`; break; case 'ipv6_addr': fields[i] = `ip6 ${dir}addr`; break; case 'ether_addr': if (dir != 's') return NaN; fields[i] = 'ether saddr'; break; case 'inet_service': fields[i] = `${proto} ${dir}port`; break; } } return fields; } function resolve_lower_devices(devstatus, devname) { let dir = fs.opendir(`/sys/class/net/${devname}`); let devs = []; if (dir) { switch (devstatus[devname]?.devtype) { case 'vlan': case 'bridge': let e; while ((e = dir.read()) != null) if (index(e, "lower_") === 0) push(devs, ...resolve_lower_devices(devstatus, substr(e, 6))); break; default: push(devs, devname); break; } dir.close(); } return devs; } function nft_json_command(...args) { let cmd = [ "/usr/sbin/nft", "--terse", "--json", ...args ]; let nft = fs.popen(join(" ", cmd), "r"); let info; if (nft) { try { info = filter(json(nft.read("all"))?.nftables, item => (type(item) == "object" && !item.metainfo)); } catch (e) { warn(`Unable to parse nftables JSON output: ${e}\n`); } nft.close(); } else { warn(`Unable to popen() ${cmd}: ${fs.error()}\n`); } return info || []; } function nft_try_hw_offload(devices) { let nft_test = ` add table inet fw4-hw-offload-test; add flowtable inet fw4-hw-offload-test ft { hook ingress priority 0; devices = { "${join('", "', devices)}" }; flags offload; } `; let rc = system(`/usr/sbin/nft -c '${replace(nft_test, "'", "'\\''")}' 2>/dev/null`); return (rc == 0); } return { read_kernel_version: function() { let fd = fs.open("/proc/version", "r"), v = 0; if (fd) { let m = match(fd.read("line"), /^Linux version ([0-9]+)\.([0-9]+)(\.([0-9]+))?/); v = m ? (+m[1] << 24) | (+m[2] << 16) | (+m[4]) : 0; fd.close(); } return v; }, resolve_hw_offload_devices: function() { if (!this.default_option("flow_offloading_hw")) return null; let devstatus = null; let devices = null; let bus = ubus.connect(); if (bus) { devstatus = bus.call("network.device", "status") || {}; bus.disconnect(); } for (let zone in this.zones()) for (let device in zone.related_physdevs) push(devices ||= [], ...resolve_lower_devices(devstatus, device)); if (!devices) return null; devices = sort(uniq(devices)); if (!nft_try_hw_offload(devices)) { this.warn('Hardware flow offloading unavailable, falling back to software offloading'); this.state.defaults.flow_offloading_hw = false; return null; } return devices; }, resolve_offload_devices: function() { if (!this.default_option("flow_offloading")) return []; let devices = this.resolve_hw_offload_devices(); if (!devices) { devices = []; for (let zone in this.zones()) for (let device in zone.related_physdevs) if (fs.access(`/sys/class/net/${device}`)) push(devices, device); devices = sort(uniq(devices)); } return devices; }, check_set_types: function() { let sets = {}; for (let item in nft_json_command("list", "sets", "inet")) if (item.set?.table == "fw4") sets[item.set.name] = (type(item.set.type) == "array") ? item.set.type : [ item.set.type ]; return sets; }, check_flowtable: function() { for (let item in nft_json_command("list", "flowtables", "inet")) if (item.flowtable?.table == "fw4" && item.flowtable?.name == "ft") return true; return false; }, read_state: function() { let fd = fs.open(STATEFILE, "r"); let state = null; if (fd) { try { state = json(fd.read("all")); } catch (e) { warn(`Unable to parse '${STATEFILE}': ${e}\n`); } fd.close(); } return state; }, read_ubus: function() { let self = this, ifaces, services, rules = [], networks = {}, bus = ubus.connect(); if (bus) { ifaces = bus.call("network.interface", "dump"); services = bus.call("service", "get_data", { "type": "firewall" }); bus.disconnect(); } else { warn(`Unable to connect to ubus: ${ubus.error()}\n`); } // // Gather logical network information from ubus // if (type(ifaces?.interface) == "array") { for (let ifc in ifaces.interface) { let net = { up: ifc.up, device: ifc.l3_device ?? ifc.device, physdev: ifc.device, zone: ifc.data?.zone }; if (type(ifc["ipv4-address"]) == "array") { for (let addr in ifc["ipv4-address"]) { push(net.ipaddrs ||= [], { family: 4, addr: addr.address, mask: to_mask(addr.mask, false), bits: addr.mask }); } } if (type(ifc["ipv6-address"]) == "array") { for (let addr in ifc["ipv6-address"]) { push(net.ipaddrs ||= [], { family: 6, addr: addr.address, mask: to_mask(addr.mask, true), bits: addr.mask }); } } if (type(ifc["ipv6-prefix-assignment"]) == "array") { for (let addr in ifc["ipv6-prefix-assignment"]) { if (addr["local-address"]) { push(net.ipaddrs ||= [], { family: 6, addr: addr["local-address"].address, mask: to_mask(addr["local-address"].mask, true), bits: addr["local-address"].mask }); } } } if (type(ifc.data?.firewall) == "array") { let n = 0; for (let rulespec in ifc.data.firewall) { push(rules, { ...rulespec, name: (rulespec.type != 'ipset') ? `ubus:${ifc.interface}[${ifc.proto}] ${rulespec.type || 'rule'} ${n}` : rulespec.name, device: rulespec.device ?? ifc.l3_device ?? ifc.device }); n++; } } networks[ifc.interface] = net; } } // // Gather firewall rule definitions from ubus services // if (type(services) == "object") { for (let svcname, service in services) { if (type(service?.firewall) == "array") { let n = 0; for (let rulespec in services[svcname].firewall) { push(rules, { ...rulespec, name: (rulespec.type != 'ipset') ? `ubus:${svcname} ${rulespec.type || 'rule'} ${n}` : rulespec.name }); n++; } } for (let svcinst, instance in service) { if (type(instance?.firewall) == "array") { let n = 0; for (let rulespec in instance.firewall) { push(rules, { ...rulespec, name: (rulespec.type != 'ipset') ? `ubus:${svcname}[${svcinst}] ${rulespec.type || 'rule'} ${n}` : rulespec.name }); n++; } } } } } return { networks: networks, ubus_rules: rules }; }, load: function(use_statefile) { let self = this; this.state = use_statefile ? this.read_state() : null; this.cursor = uci.cursor(); this.cursor.load("firewall"); this.cursor.load("/usr/share/firewall4/helpers"); if (!this.state) this.state = this.read_ubus(); this.kernel = this.read_kernel_version(); // // Read helper mapping // this.cursor.foreach("helpers", "helper", h => self.parse_helper(h)); // // Read default policies // this.cursor.foreach("firewall", "defaults", d => self.parse_defaults(d)); if (!this.state.defaults) this.parse_defaults({}); // // Build list of ipsets // if (!this.state.ipsets) { map(filter(this.state.ubus_rules, n => (n.type == "ipset")), s => self.parse_ipset(s)); this.cursor.foreach("firewall", "ipset", s => self.parse_ipset(s)); } // // Build list of logical zones // if (!this.state.zones) this.cursor.foreach("firewall", "zone", z => self.parse_zone(z)); // // Build list of rules // map(filter(this.state.ubus_rules, r => (r.type == "rule")), r => self.parse_rule(r)); this.cursor.foreach("firewall", "rule", r => self.parse_rule(r)); // // Build list of forwardings // this.cursor.foreach("firewall", "forwarding", f => self.parse_forwarding(f)); // // Build list of redirects // map(filter(this.state.ubus_rules, r => (r.type == "redirect")), r => self.parse_redirect(r)); this.cursor.foreach("firewall", "redirect", r => self.parse_redirect(r)); // // Build list of snats // map(filter(this.state.ubus_rules, n => (n.type == "nat")), n => self.parse_nat(n)); this.cursor.foreach("firewall", "nat", n => self.parse_nat(n)); // // Build list of includes // this.cursor.foreach("firewall", "include", i => self.parse_include(i)); // // Discover automatic includes // if (this.default_option("auto_includes")) { for (let position in [ 'ruleset-pre', 'ruleset-post', 'table-pre', 'table-post', 'chain-pre', 'chain-post' ]) for (let chain in (position in [ 'chain-pre', 'chain-post' ]) ? fs.lsdir(`/usr/share/nftables.d/${position}`) : [ null ]) for (let path in fs.glob(`/usr/share/nftables.d/${position}${chain ? `/${chain}` : ''}/*.nft`)) if (fs.access(path)) this.parse_include({ type: 'nftables', position, chain, path }); } if (use_statefile) { let fd = fs.open(STATEFILE, "w"); if (fd) { fd.write({ zones: this.state.zones, ipsets: this.state.ipsets, networks: this.state.networks, ubus_rules: this.state.ubus_rules, includes: this.state.includes }); fd.close(); } else { warn(`Unable to write '${STATEFILE}': ${fs.error()}\n`); } } }, warn: function(fmt, ...args) { if (getenv("QUIET")) return; let msg = sprintf(fmt, ...args); if (getenv("TTY")) warn(`\033[33m${msg}\033[m\n`); else warn(`[!] ${msg}\n`); }, get: function(sid, opt) { return this.cursor.get("firewall", sid, opt); }, get_all: function(sid) { return this.cursor.get_all("firewall", sid); }, parse_options: function(s, spec) { let rv = {}; for (let key, val in spec) { let datatype = `parse_${val[0]}`, defval = val[1], flags = val[2] || 0, parsefn = (flags & PARSE_LIST) ? "parse_list" : "parse_opt"; let res = this[parsefn](s, key, datatype, defval, flags); if (res !== res) return false; if (type(res) == "object" && res.invert && (flags & NO_INVERT)) { this.warn_section(s, `option '${key}' must not be negated`); return false; } if (res != null) { if (flags & DEPRECATED) this.warn_section(s, `option '${key}' is deprecated by fw4`); else if (flags & UNSUPPORTED) this.warn_section(s, `option '${key}' is not supported by fw4`); else rv[key] = res; } } for (let opt in s) { if (index(opt, '.') != 0 && opt != 'type' && !exists(spec, opt)) { this.warn_section(s, `specifies unknown option '${opt}'`); } } return rv; }, parse_subnet: function(subnet) { let parts = split(subnet, "/"); let a, b, m, n; switch (length(parts)) { case 2: a = iptoarr(parts[0]); m = iptoarr(parts[1]); if (!a) return null; if (m) { if (length(a) != length(m)) return null; b = to_bits(parts[1]); /* allow non-contiguous masks such as `::ffff:ffff:ffff:ffff` */ if (b == null) { b = -1; for (let i, x in m) a[i] &= x; } m = arrtoip(m); } else { b = +parts[1]; if (type(b) != "int") return null; m = to_mask(b, length(a) == 16); b = max(-1, b); } return [{ family: (length(a) == 16) ? 6 : 4, addr: arrtoip(a), mask: m, bits: b }]; case 1: parts = split(parts[0], "-"); switch (length(parts)) { case 2: a = iptoarr(parts[0]); b = iptoarr(parts[1]); if (a && b && length(a) == length(b)) { return [{ family: (length(a) == 16) ? 6 : 4, addr: arrtoip(a), addr2: arrtoip(b), range: true }]; } break; case 1: a = iptoarr(parts[0]); if (a) { return [{ family: (length(a) == 16) ? 6 : 4, addr: arrtoip(a), mask: to_mask(length(a) * 8, length(a) == 16), bits: length(a) * 8 }]; } n = this.state.networks[parts[0]]; if (n) return [ ...(n.ipaddrs || []) ]; } } return null; }, parse_enum: function(val, choices) { if (type(val) == "string") { val = lc(val); for (let i = 0; i < length(choices); i++) if (lc(substr(choices[i], 0, length(val))) == val) return choices[i]; } return null; }, section_id: function(sid) { let s = this.get_all(sid); if (!s) return null; if (s[".anonymous"]) { let c = 0; this.cursor.foreach("firewall", s[".type"], function(ss) { if (ss[".name"] == s[".name"]) return false; c++; }); return `@${s['.type']}[${c}]`; } return s[".name"]; }, warn_section: function(s, msg) { if (s[".name"]) { if (s.name) this.warn("Section %s (%s) %s", this.section_id(s[".name"]), s.name, msg); else this.warn("Section %s %s", this.section_id(s[".name"]), msg); } else { if (s.name) this.warn("ubus %s (%s) %s", s.type || "rule", s.name, msg); else this.warn("ubus %s %s", s.type || "rule", msg); } }, parse_policy: function(val) { return this.parse_enum(val, [ "accept", "reject", "drop" ]); }, parse_bool: function(val) { if (val == "1" || val == "on" || val == "true" || val == "yes") return true; else if (val == "0" || val == "off" || val == "false" || val == "no") return false; else return null; }, parse_family: function(val) { if (val == 'any' || val == 'all' || val == '*') return 0; else if (val == 'inet' || index(val, '4') > -1) return 4; else if (index(val, '6') > -1) return 6; return null; }, parse_zone_ref: function(val) { if (val == null) return null; if (val == '*') return { any: true }; for (let zone in this.state.zones) { if (zone.name == val) { return { any: false, zone: zone }; } } return null; }, parse_device: function(val) { let rv = this.parse_invert(val); if (!rv) return null; if (rv.val == '*') rv.any = true; else rv.device = rv.val; return rv; }, parse_direction: function(val) { if (val == 'in' || val == 'ingress') return false; else if (val == 'out' || val == 'egress') return true; return null; }, parse_setmatch: function(val) { let rv = this.parse_invert(val); if (!rv) return null; rv.val = trim(replace(rv.val, /^[^ \t]+/, function(m) { rv.name = m; return ''; })); let dir = split(rv.val, /[ \t,]/); for (let i = 0; i < 3 && i < length(dir); i++) { if (dir[i] == "dst" || dir[i] == "dest") (rv.dir ||= [])[i] = "dst"; else if (dir[i] == "src") (rv.dir ||= [])[i] = "src"; } return length(rv.name) ? rv : null; }, parse_cthelper: function(val) { let rv = this.parse_invert(val); if (!rv) return null; let helper = filter(this.state.helpers, h => (h.name == rv.val))?.[0]; return helper ? { ...rv, ...helper } : null; }, parse_protocol: function(val) { let p = this.parse_invert(val); if (!p) return null; p.val = lc(p.val); switch (p.val) { case 'all': case 'any': case '*': p.any = true; break; case '1': case 'icmp': p.name = 'icmp'; break; case '58': case 'icmpv6': case 'ipv6-icmp': p.name = 'ipv6-icmp'; break; case 'tcpudp': return [ { invert: p.invert, name: 'tcp' }, { invert: p.invert, name: 'udp' } ]; case '6': p.name = 'tcp'; break; case '17': p.name = 'udp'; break; default: p.name = p.val; } return (p.any || length(p.name)) ? p : null; }, parse_mac: function(val) { let mac = this.parse_invert(val); let m = mac ? match(mac.val, /^([0-9a-f]{1,2})[:-]([0-9a-f]{1,2})[:-]([0-9a-f]{1,2})[:-]([0-9a-f]{1,2})[:-]([0-9a-f]{1,2})[:-]([0-9a-f]{1,2})$/i) : null; if (!m) return null; mac.mac = sprintf('%02x:%02x:%02x:%02x:%02x:%02x', hex(m[1]), hex(m[2]), hex(m[3]), hex(m[4]), hex(m[5]), hex(m[6])); return mac; }, parse_port: function(val) { let port = this.parse_invert(val); let m = port ? match(port.val, /^([0-9]{1,5})([-:]([0-9]{1,5}))?$/i) : null; if (!m) return null; if (m[3]) { let min_port = +m[1]; let max_port = +m[3]; if (min_port > max_port || min_port < 0 || max_port < 0 || min_port > 65535 || max_port > 65535) return null; port.min = min_port; port.max = max_port; } else { let pn = +m[1]; if (pn != pn || pn < 0 || pn > 65535) return null; port.min = pn; port.max = pn; } return port; }, parse_network: function(val) { let rv = this.parse_invert(val); if (!rv) return null; let nets = this.parse_subnet(rv.val); if (nets === null) return null; if (length(nets)) rv.addrs = [ ...nets ]; return rv; }, parse_icmptype: function(val) { let rv = {}; if (exists(ipv4_icmptypes, val)) { rv.family = 4; rv.type = ipv4_icmptypes[val][0]; rv.code_min = ipv4_icmptypes[val][1]; rv.code_max = ipv4_icmptypes[val][2]; } if (exists(ipv6_icmptypes, val)) { rv.family = rv.family ? 0 : 6; rv.type6 = ipv6_icmptypes[val][0]; rv.code6_min = ipv6_icmptypes[val][1]; rv.code6_max = ipv6_icmptypes[val][2]; } if (!exists(rv, "family")) { let m = match(val, /^([0-9]+)(\/([0-9]+))?$/); if (!m) return null; if (m[3]) { rv.type = +m[1]; rv.code_min = +m[3]; rv.code_max = rv.code_min; } else { rv.type = +m[1]; rv.code_min = 0; rv.code_max = 0xFF; } if (rv.type > 0xFF || rv.code_min > 0xFF || rv.code_max > 0xFF) return null; rv.family = 0; rv.type6 = rv.type; rv.code6_min = rv.code_min; rv.code6_max = rv.code_max; } return rv; }, parse_invert: function(val) { if (val == null) return null; let rv = { invert: false }; rv.val = trim(replace(val, /^[ \t]*!/, () => (rv.invert = true, ''))); return length(rv.val) ? rv : null; }, parse_limit: function(val) { let rv = this.parse_invert(val); let m = rv ? match(rv.val, /^([0-9]+)(\/([a-z]+))?$/) : null; if (!m) return null; let n = +m[1]; let u = m[3] ? this.parse_enum(m[3], [ "second", "minute", "hour", "day" ]) : "second"; if (!u) return null; rv.rate = n; rv.unit = u; return rv; }, parse_int: function(val) { let n = +val; return (n == n) ? n : null; }, parse_date: function(val) { let d = match(val, /^([0-9]{4})(-([0-9]{1,2})(-([0-9]{1,2})(T([0-9:]+))?)?)?$/); if (d == null || d[1] < 1970 || d[1] > 2038 || d[3] > 12 || d[5] > 31) return null; let t = this.parse_time(d[7] ?? "0"); if (t == null) return null; return { year: +d[1], month: +d[3] || 1, day: +d[5] || 1, ...t }; }, parse_time: function(val) { let t = match(val, /^([0-9]{1,2})(:([0-9]{1,2})(:([0-9]{1,2}))?)?$/); if (t == null || t[1] > 23 || t[3] > 59 || t[5] > 59) return null; return { hour: +t[1], min: +t[3], sec: +t[5] }; }, parse_weekdays: function(val) { let rv = this.parse_invert(val); if (!rv) return null; for (let day in to_array(rv.val)) { day = this.parse_enum(day, [ "Monday", "Tuesday", "Wednesday", "Thursday", "Friday", "Saturday", "Sunday" ]); if (!day) return null; (rv.days ||= {})[day] = true; } rv.days = keys(rv.days); return rv.days ? rv : null; }, parse_monthdays: function(val) { let rv = this.parse_invert(val); if (!rv) return null; for (let day in to_array(rv.val)) { day = +day; if (day < 1 || day > 31) return null; (rv.days ||= [])[day] = true; } return rv.days ? rv : null; }, parse_mark: function(val) { let rv = this.parse_invert(val); let m = rv ? match(rv.val, /^(0?x?[0-9a-f]+)(\/(0?x?[0-9a-f]+))?$/i) : null; if (!m) return null; let n = +m[1]; if (n != n || n > 0xFFFFFFFF) return null; rv.mark = n; rv.mask = 0xFFFFFFFF; if (m[3]) { n = +m[3]; if (n != n || n > 0xFFFFFFFF) return null; rv.mask = n; } return rv; }, parse_dscp: function(val) { let rv = this.parse_invert(val); if (!rv) return null; rv.val = uc(rv.val); if (exists(dscp_classes, rv.val)) { rv.dscp = dscp_classes[rv.val]; } else { let n = +rv.val; if (n != n || n < 0 || n > 0x3F) return null; rv.dscp = n; } return rv; }, parse_target: function(val) { return this.parse_enum(val, [ "accept", "reject", "drop", "notrack", "helper", "mark", "dscp", "dnat", "snat", "masquerade", "accept", "reject", "drop" ]); }, parse_reject_code: function(val) { return this.parse_enum(val, [ "tcp-reset", "port-unreachable", "admin-prohibited", "host-unreachable", "no-route" ]); }, parse_reflection_source: function(val) { return this.parse_enum(val, [ "internal", "external" ]); }, parse_ipsettype: function(val) { let m = match(val, /^(src|dst|dest)_(.+)$/); let t = this.parse_enum(m ? m[2] : val, [ "ip", "port", "mac", "net", "set" ]); return t ? [ (!m || m[1] == 'src') ? 'src' : 'dst', t ] : null; }, parse_ipsetentry: function(val, set) { let values = split(val, /[ \t]+/); if (length(values) != length(set.types)) return null; let rv = []; let ip, mac, port; for (let i, t in set.types) { switch (t) { case 'ipv4_addr': ip = filter(this.parse_subnet(values[i]), a => (a.family == 4)); switch (length(ip) ?? 0) { case 0: return null; case 1: break; default: this.warn("Set entry '%s' resolves to multiple addresses, using first one", values[i]); } rv[i] = ("net" in set.fw4types) ? `${ip[0].addr}/${ip[0].bits}` : ip[0].addr; break; case 'ipv6_addr': ip = filter(this.parse_subnet(values[i]), a => (a.family == 6)); switch (length(ip) ?? 0) { case 0: return null; case 1: break; case 2: this.warn("Set entry '%s' resolves to multiple addresses, using first one", values[i]); } rv[i] = ("net" in set.fw4types) ? `${ip[0].addr}/${ip[0].bits}` : ip[0].addr; break; case 'ether_addr': mac = this.parse_mac(values[i]); if (!mac || mac.invert) return null; rv[i] = mac.mac; break; case 'inet_service': port = this.parse_port(values[i]); if (!port || port.invert || port.min != port.max) return null; rv[i] = port.min; break; default: rv[i] = values[i]; } } return length(rv) ? rv : null; }, parse_includetype: function(val) { return this.parse_enum(val, [ "script", "nftables" ]); }, parse_includeposition: function(val) { return replace(this.parse_enum(val, [ "ruleset-prepend", "ruleset-postpend", "ruleset-append", "table-prepend", "table-postpend", "table-append", "chain-prepend", "chain-postpend", "chain-append" ]), "postpend", "append"); }, parse_identifier: function(val) { return match(val, /^[a-zA-Z_.][a-zA-Z0-9\/_.-]*$/)?.[0]; }, parse_string: function(val) { return "" + val; }, parse_opt: function(s, opt, fn, defval, flags) { let val = s[opt]; if (val === null) { if (flags & REQUIRED) { this.warn_section(s, `option '${opt}' is mandatory but not set`); return NaN; } val = defval; } if (type(val) == "array") { this.warn_section(s, `option '${opt}' must not be a list`); return NaN; } else if (val == null) { return null; } let res = this[fn](val); if (res === null) { this.warn_section(s, `option '${opt}' specifies invalid value '${val}'`); return NaN; } return res; }, parse_list: function(s, opt, fn, defval, flags) { let val = s[opt]; let rv = []; if (val == null) { if (flags & REQUIRED) { this.warn_section(s, `option '${opt}' is mandatory but not set`); return NaN; } val = defval; } for (val in to_array(val)) { let res = this[fn](val); if (res === null) { this.warn_section(s, `option '${opt}' specifies invalid value '${val}'`); return NaN; } if (flags & FLATTEN_LIST) push(rv, ...to_array(res)); else push(rv, res); } return length(rv) ? rv : null; }, quote: function(s, force) { if (force === true || !match(s, /^([0-9A-Fa-f:.\/-]+)( \. [0-9A-Fa-f:.\/-]+)*$/)) return `"${replace(s, '"', "'")}"`; return s; }, cidr: function(a) { if (a.range) return `${a.addr}-${a.addr2}`; if ((a.family == 4 && a.bits == 32) || (a.family == 6 && a.bits == 128)) return a.addr; if (a.bits >= 0) return `${apply_mask(a.addr, a.bits)}/${a.bits}`; return `${a.addr}/${a.mask}`; }, host: function(a, v6brackets) { return a.range ? `${a.addr}-${a.addr2}` : (a.family == 6 && v6brackets) ? `[${apply_mask(a.addr, a.bits)}]` : apply_mask(a.addr, a.bits); }, port: function(p) { if (p.min == p.max) return `${p.min}`; return `${p.min}-${p.max}`; }, set: function(v, force) { let seen = {}; v = filter(to_array(v), item => !seen[item]++); if (force || length(v) != 1) return `{ ${join(', ', map(v, this.quote))} }`; return this.quote(v[0]); }, concat: function(v) { return join(' . ', to_array(v)); }, ipproto: function(family) { switch (family) { case 4: return "ip"; case 6: return "ip6"; } }, nfproto: function(family, human_readable) { switch (family) { case 4: return human_readable ? "IPv4" : "ipv4"; case 6: return human_readable ? "IPv6" : "ipv6"; default: return human_readable ? "IPv4/IPv6" : null; } }, l4proto: function(family, proto) { switch (proto.name) { case 'icmp': switch (family ?? 0) { case 0: return this.set(['icmp', 'ipv6-icmp']); case 6: return 'ipv6-icmp'; } default: return proto.name; } }, datetime: function(stamp) { return sprintf('"%04d-%02d-%02d %02d:%02d:%02d"', stamp.year, stamp.month, stamp.day, stamp.hour, stamp.min, stamp.sec); }, date: function(stamp) { return sprintf('"%04d-%02d-%02d"', stamp.year, stamp.month, stamp.day); }, datestamp: function(stamp) { return exists(stamp, 'hour') ? this.datetime(stamp) : this.date(stamp); }, time: function(stamp) { return sprintf('"%02d:%02d:%02d"', stamp.hour, stamp.min, stamp.sec); }, hex: function(n) { return sprintf('0x%x', n); }, is_loopback_dev: function(dev) { return !!(+fs.readfile(`/sys/class/net/${dev}/flags`) & 0x8); }, is_loopback_addr: function(addr) { return (index(addr, "127.") == 0 || addr == "::1" || addr == "::1/128"); }, filter_loopback_devs: function(devs, invert) { return null_if_empty(filter(devs, d => (this.is_loopback_dev(d) == invert))); }, filter_loopback_addrs: function(addrs, invert) { return null_if_empty(filter(addrs, a => (this.is_loopback_addr(a) == invert))); }, input_policy: function(reject_as_drop) { return (!reject_as_drop || this.state.defaults.input != 'reject') ? this.state.defaults.input : 'drop'; }, output_policy: function(reject_as_drop) { return (!reject_as_drop || this.state.defaults.output != 'reject') ? this.state.defaults.output : 'drop'; }, forward_policy: function(reject_as_drop) { return (!reject_as_drop || this.state.defaults.forward != 'reject') ? this.state.defaults.forward : 'drop'; }, default_option: function(flag) { return this.state.defaults[flag]; }, helpers: function() { return this.state.helpers; }, zones: function() { return this.state.zones; }, rules: function(chain) { return filter(this.state.rules, r => (r.chain == chain)); }, redirects: function(chain) { return filter(this.state.redirects, r => (r.chain == chain)); }, ipsets: function() { return this.state.ipsets; }, includes: function(position, chain) { let stmts = []; let pad = ''; let pre = ''; switch (position) { case 'table-prepend': case 'table-append': pad = '\t'; pre = '\n'; break; case 'chain-prepend': case 'chain-append': pad = '\t\t'; break; default: pre = '\n'; } push(stmts, pre); for (let inc in this.state.includes) if (inc.type == 'nftables' && inc.position == position && (!chain || inc.chain == chain)) push(stmts, `${pad}include "${inc.path}"\n`); print(length(stmts) > 1 ? join('', stmts) : ''); }, parse_setfile: function(set, cb) { let fd = fs.open(set.loadfile, "r"); if (!fd) { warn(`Unable to load file '${set.loadfile}' for set '${set.name}': ${fs.error()}\n`); return; } let count = 0; for (let line = fd.read("line"); length(line); line = fd.read("line")) { line = trim(line); if (length(line) == 0 || ord(line) == 35) continue; let v = this.parse_ipsetentry(line, set); if (!v) { this.warn(`Skipping invalid entry '${line}' in file '${set.loadfile}' for set '${set.name}'`); continue; } cb(v); count++; } fd.close(); return count; }, print_setentries: function(set) { let first = true; let printer = (entry) => { if (first) { print("\t\telements = {\n"); first = false; } print("\t\t\t", join(" . ", entry), ",\n"); }; map(set.entries, printer); if (set.loadfile) this.parse_setfile(set, printer); if (!first) print("\t\t}\n"); }, parse_helper: function(data) { let helper = this.parse_options(data, { name: [ "string", null, REQUIRED ], description: [ "string" ], module: [ "string" ], family: [ "family" ], proto: [ "protocol", null, PARSE_LIST | FLATTEN_LIST | NO_INVERT ], port: [ "port", null, NO_INVERT ] }); if (helper === false) { this.warn("Helper definition '%s' skipped due to invalid options", data.name || data['.name']); return; } else if (helper.proto.any) { this.warn("Helper definition '%s' must not specify wildcard protocol", data.name || data['.name']); return; } else if (length(helper.proto) > 1) { this.warn("Helper definition '%s' must not specify multiple protocols", data.name || data['.name']); return; } helper.available = (fs.stat(`/sys/module/${helper.module}`)?.type == "directory"); push(this.state.helpers ||= [], helper); }, parse_defaults: function(data) { if (this.state.defaults) { this.warn_section(data, ": ignoring duplicate defaults section"); return; } let defs = this.parse_options(data, { input: [ "policy", "drop" ], output: [ "policy", "drop" ], forward: [ "policy", "drop" ], drop_invalid: [ "bool" ], tcp_reject_code: [ "reject_code", "tcp-reset" ], any_reject_code: [ "reject_code", "port-unreachable" ], syn_flood: [ "bool" ], synflood_protect: [ "bool" ], synflood_rate: [ "limit", "25/second" ], synflood_burst: [ "int", "50" ], tcp_syncookies: [ "bool", "1" ], tcp_ecn: [ "int" ], tcp_window_scaling: [ "bool", "1" ], accept_redirects: [ "bool" ], accept_source_route: [ "bool" ], auto_helper: [ "bool", "1" ], custom_chains: [ "bool", null, UNSUPPORTED ], disable_ipv6: [ "bool", null, UNSUPPORTED ], flow_offloading: [ "bool", "0" ], flow_offloading_hw: [ "bool", "0" ], auto_includes: [ "bool", "1" ] }); if (defs.synflood_protect === null) defs.synflood_protect = defs.syn_flood; delete defs.syn_flood; this.state.defaults = defs; }, parse_zone: function(data) { let zone = this.parse_options(data, { enabled: [ "bool", "1" ], name: [ "identifier", null, REQUIRED ], family: [ "family" ], network: [ "device", null, PARSE_LIST ], device: [ "device", null, PARSE_LIST ], subnet: [ "network", null, PARSE_LIST ], input: [ "policy", this.state.defaults ? this.state.defaults.input : "drop" ], output: [ "policy", this.state.defaults ? this.state.defaults.output : "drop" ], forward: [ "policy", this.state.defaults ? this.state.defaults.forward : "drop" ], masq: [ "bool" ], masq_allow_invalid: [ "bool" ], masq_src: [ "network", null, PARSE_LIST ], masq_dest: [ "network", null, PARSE_LIST ], masq6: [ "bool" ], extra: [ "string", null, UNSUPPORTED ], extra_src: [ "string", null, UNSUPPORTED ], extra_dest: [ "string", null, UNSUPPORTED ], mtu_fix: [ "bool" ], custom_chains: [ "bool", null, UNSUPPORTED ], log: [ "int" ], log_limit: [ "limit" ], auto_helper: [ "bool", "1" ], helper: [ "cthelper", null, PARSE_LIST ], counter: [ "bool", "1" ] }); if (zone === false) { this.warn_section(data, "skipped due to invalid options"); return; } else if (!zone.enabled) { this.warn_section(data, "is disabled, ignoring section"); return; } for (let helper in zone.helper) { if (!helper.available) { this.warn_section(data, `uses unavailable ct helper '${zone.helper.name}'`); } } if (zone.mtu_fix && this.kernel < 0x040a0000) { this.warn_section(data, "option 'mtu_fix' requires kernel 4.10 or later"); return; } if (this.state.defaults?.auto_helper === false) zone.auto_helper = false; let match_devices = []; let related_physdevs = []; let related_subnets = []; let related_ubus_networks = []; let match_subnets, masq_src_subnets, masq_dest_subnets; for (let name, net in this.state.networks) { if (net.zone === zone.name) push(related_ubus_networks, { invert: false, device: name }); } zone.network = [ ...to_array(zone.network), ...related_ubus_networks ]; for (let e in zone.network) { if (exists(this.state.networks, e.device)) { let net = this.state.networks[e.device]; if (net.device) { push(match_devices, { invert: e.invert, device: net.device }); } if (net.physdev && !e.invert) push(related_physdevs, net.physdev); push(related_subnets, ...(net.ipaddrs || [])); } } push(match_devices, ...to_array(zone.device)); match_subnets = subnets_split_af(zone.subnet); masq_src_subnets = subnets_split_af(zone.masq_src); masq_dest_subnets = subnets_split_af(zone.masq_dest); push(related_subnets, ...(match_subnets[0] || []), ...(match_subnets[1] || [])); let match_rules = []; let add_rule = (family, devices, subnets, zone) => { let r = {}; r.family = family; r.devices_pos = null_if_empty(devices[0]); r.devices_neg = null_if_empty(devices[1]); r.devices_neg_wildcard = null_if_empty(devices[2]); r.subnets_pos = map(subnets[0], this.cidr); r.subnets_neg = map(subnets[1], this.cidr); r.subnets_masked = subnets[2]; push(match_rules, r); }; let family = infer_family(zone.family, [ match_subnets, "subnet list" ]); if (type(family) == "string") { this.warn_section(data, `${family}, skipping`); return; } // group non-inverted device matches into wildcard and non-wildcard ones let devices = [], plain_devices = [], plain_invert_devices = [], wildcard_invert_devices = []; for (let device in match_devices) { let m = match(device.device, /^([^+]*)(\+)?$/); if (!m) { this.warn_section(data, `skipping invalid wildcard pattern '${device.device}'`); continue; } // filter `+` (match any device) since nftables does not support // wildcard only matches if (!device.invert && m[0] == '+') continue; // replace inverted `+` (match no device) with invalid pattern if (device.invert && m[0] == '+') { device.device = '/never/'; device.invert = false; } // replace "name+" matches with "name*" else if (m[2] == '+') device.device = m[1] + '*'; device.wildcard = !!m[2]; if (!device.invert && device.wildcard) push(devices, [ [ device.device ], plain_invert_devices, wildcard_invert_devices ]); else if (!device.invert) push(plain_devices, device.device); else if (device.wildcard) push(wildcard_invert_devices, device.device); else push(plain_invert_devices, device.device); } if (length(plain_devices)) push(devices, [ plain_devices, plain_invert_devices, wildcard_invert_devices ]); else if (!length(devices)) push(devices, [ null, plain_invert_devices, wildcard_invert_devices ]); // emit zone jump rules for each device group if (length(match_devices) || length(match_subnets[0]) || length(match_subnets[1])) { for (let devgroup in devices) { // check if there's no AF specific bits, in this case we can do AF agnostic matching if (!family && !length(match_subnets[0]) && !length(match_subnets[1])) { add_rule(0, devgroup, [], zone); } // we need to emit one or two AF specific rules else { if (!family || family == 4) for (let subnets in subnets_group_by_masking(match_subnets[0])) add_rule(4, devgroup, subnets, zone); if (!family || family == 6) for (let subnets in subnets_group_by_masking(match_subnets[1])) add_rule(6, devgroup, subnets, zone); } } } zone.family = family; zone.match_rules = match_rules; zone.masq4_src_subnets = subnets_group_by_masking(masq_src_subnets[0]); zone.masq4_dest_subnets = subnets_group_by_masking(masq_dest_subnets[0]); zone.masq6_src_subnets = subnets_group_by_masking(masq_src_subnets[1]); zone.masq6_dest_subnets = subnets_group_by_masking(masq_dest_subnets[1]); zone.sflags = {}; zone.sflags[zone.input] = true; zone.dflags = {}; zone.dflags[zone.output] = true; zone.dflags[zone.forward] = true; zone.match_devices = map(filter(match_devices, d => !d.invert), d => d.device); zone.match_subnets = map(filter(related_subnets, s => !s.invert && s.bits != -1), this.cidr); zone.related_subnets = related_subnets; zone.related_physdevs = related_physdevs; if (zone.masq || zone.masq6) zone.dflags.snat = true; if ((zone.auto_helper && !(zone.masq || zone.masq6)) || length(zone.helper)) { zone.dflags.helper = true; for (let helper in (length(zone.helper) ? zone.helper : this.state.helpers)) { if (!helper.available) continue; for (let proto in helper.proto) { push(this.state.rules ||= [], { chain: `helper_${zone.name}`, family: helper.family, name: helper.description || helper.name, proto: proto, src: zone, dports_pos: [ this.port(helper.port) ], target: "helper", set_helper: helper }); } } } push(this.state.zones ||= [], zone); }, parse_forwarding: function(data) { let fwd = this.parse_options(data, { enabled: [ "bool", "1" ], name: [ "string" ], family: [ "family" ], src: [ "zone_ref", null, REQUIRED ], dest: [ "zone_ref", null, REQUIRED ] }); if (fwd === false) { this.warn_section(data, "skipped due to invalid options"); return; } else if (!fwd.enabled) { this.warn_section(data, "is disabled, ignoring section"); return; } let add_rule = (family, fwd) => { let f = { ...fwd, family: family, proto: { any: true } }; f.name ||= `Accept ${fwd.src.any ? "any" : fwd.src.zone.name} to ${fwd.dest.any ? "any" : fwd.dest.zone.name} ${family ? `${this.nfproto(family, true)} ` : ''}forwarding`; f.chain = fwd.src.any ? "forward" : `forward_${fwd.src.zone.name}`; if (fwd.dest.any) f.target = "accept"; else f.jump_chain = `accept_to_${fwd.dest.zone.name}`; push(this.state.rules ||= [], f); }; /* inherit family restrictions from related zones */ let family = infer_family(fwd.family, [ fwd.src?.zone, "source zone", fwd.dest?.zone, "destination zone" ]); if (type(family) == "string") { this.warn_section(data, `${family}, skipping`); return; } add_rule(family, fwd); if (fwd.dest.zone) fwd.dest.zone.dflags.accept = true; }, parse_rule: function(data) { let rule = this.parse_options(data, { enabled: [ "bool", "1" ], name: [ "string", this.section_id(data[".name"]) ], _name: [ "string", null, DEPRECATED ], family: [ "family" ], src: [ "zone_ref" ], dest: [ "zone_ref" ], device: [ "device", null, NO_INVERT ], direction: [ "direction" ], ipset: [ "setmatch" ], helper: [ "cthelper" ], set_helper: [ "cthelper", null, NO_INVERT ], proto: [ "protocol", "tcpudp", PARSE_LIST | FLATTEN_LIST ], src_ip: [ "network", null, PARSE_LIST ], src_mac: [ "mac", null, PARSE_LIST ], src_port: [ "port", null, PARSE_LIST ], dest_ip: [ "network", null, PARSE_LIST ], dest_port: [ "port", null, PARSE_LIST ], icmp_type: [ "icmptype", null, PARSE_LIST ], extra: [ "string", null, UNSUPPORTED ], limit: [ "limit" ], limit_burst: [ "int" ], utc_time: [ "bool" ], start_date: [ "date" ], stop_date: [ "date" ], start_time: [ "time" ], stop_time: [ "time" ], weekdays: [ "weekdays" ], monthdays: [ "monthdays", null, UNSUPPORTED ], mark: [ "mark" ], set_mark: [ "mark", null, NO_INVERT ], set_xmark: [ "mark", null, NO_INVERT ], dscp: [ "dscp" ], set_dscp: [ "dscp", null, NO_INVERT ], counter: [ "bool", "1" ], log: [ "string" ], log_limit: [ "limit" ], target: [ "target" ] }); if (rule === false) { this.warn_section(data, "skipped due to invalid options"); return; } else if (!rule.enabled) { this.warn_section(data, "is disabled, ignoring section"); return; } if (rule.target in ["helper", "notrack"] && (!rule.src || !rule.src.zone)) { this.warn_section(data, `must specify a source zone for target '${rule.target}'`); return; } else if (rule.target == "dscp" && !rule.set_dscp) { this.warn_section(data, "must specify option 'set_dscp' for target 'dscp'"); return; } else if (rule.target == "mark" && !rule.set_mark && !rule.set_xmark) { this.warn_section(data, "must specify option 'set_mark' or 'set_xmark' for target 'mark'"); return; } else if (rule.target == "helper" && !rule.set_helper) { this.warn_section(data, "must specify option 'set_helper' for target 'helper'"); return; } else if (rule.device?.any) { this.warn_section(data, "must not specify '*' as device"); return; } switch (this.parse_bool(rule.log)) { case true: rule.log = `${rule.name}: `; break; case false: delete rule.log; } let ipset; if (rule.ipset) { ipset = filter(this.state.ipsets, s => (s.name == rule.ipset.name))?.[0]; if (!ipset) { this.warn_section(data, `references unknown set '${rule.ipset.name}'`); return; } if (('inet_service' in ipset.types) && !ensure_tcpudp(rule.proto)) { this.warn_section(data, "references named set with port match but no UDP/TCP protocol, ignoring section"); return; } } let need_src_action_chain = (rule) => (rule.src?.zone?.log && rule.target != "accept"); let add_rule = (family, proto, saddrs, daddrs, sports, dports, icmptypes, icmpcodes, ipset, rule) => { let r = { ...rule, family: family, proto: proto, has_addrs: !!(saddrs[0] || saddrs[1] || saddrs[2] || daddrs[0] || daddrs[1] || daddrs[2]), has_ports: !!(length(sports) || length(dports)), saddrs_pos: map(saddrs[0], this.cidr), saddrs_neg: map(saddrs[1], this.cidr), saddrs_masked: saddrs[2], daddrs_pos: map(daddrs[0], this.cidr), daddrs_neg: map(daddrs[1], this.cidr), daddrs_masked: daddrs[2], sports_pos: map(filter_pos(sports), this.port), sports_neg: map(filter_neg(sports), this.port), dports_pos: map(filter_pos(dports), this.port), dports_neg: map(filter_neg(dports), this.port), smacs_pos: map(filter_pos(rule.src_mac), m => m.mac), smacs_neg: map(filter_neg(rule.src_mac), m => m.mac), icmp_types: map(icmptypes, i => (family == 4 ? i.type : i.type6)), icmp_codes: map(icmpcodes, ic => `${(family == 4) ? ic.type : ic.type6} . ${(family == 4) ? ic.code_min : ic.code6_min}`) }; if (!length(r.icmp_types)) delete r.icmp_types; if (!length(r.icmp_codes)) delete r.icmp_codes; if (r.set_mark) { r.set_xmark = { invert: r.set_mark.invert, mark: r.set_mark.mark, mask: r.set_mark.mark | r.set_mark.mask }; delete r.set_mark; } let set_types = map_setmatch(ipset, rule.ipset, proto.name); if (set_types !== set_types) { this.warn_section(data, "destination MAC address matching not supported"); return; } else if (set_types) { r.ipset = { ...r.ipset, fields: set_types }; } if (r.target == "notrack") { r.chain = `notrack_${r.src.zone.name}`; r.src.zone.dflags.notrack = true; } else if (r.target == "helper") { r.chain = `helper_${r.src.zone.name}`; r.src.zone.dflags.helper = true; } else if (r.target == "mark" || r.target == "dscp") { if ((r.src?.any && r.dest?.any) || (r.src?.zone && r.dest?.zone)) r.chain = "mangle_forward"; else if (r.src?.any && r.dest?.zone) r.chain = "mangle_postrouting"; else if (r.src?.zone && r.dest?.any) r.chain = "mangle_prerouting"; else if (r.src && !r.dest) r.chain = "mangle_input"; else r.chain = "mangle_output"; if (r.src?.zone) { r.src.zone.dflags[r.target] = true; r.iifnames = null_if_empty(r.src.zone.match_devices); } if (r.dest?.zone) { r.dest.zone.dflags[r.target] = true; r.oifnames = null_if_empty(r.dest.zone.match_devices); } } else { r.chain = "output"; if (r.src) { if (!r.src.any) r.chain = `${r.dest ? "forward" : "input"}_${r.src.zone.name}`; else r.chain = r.dest ? "forward" : "input"; } if (r.dest && !r.src) { if (!r.dest.any) r.chain = sprintf("output_%s", r.dest.zone.name); else r.chain = "output"; } if (r.target && r.dest && !r.dest.any) { r.jump_chain = `${r.target}_to_${r.dest.zone.name}`; r.dest.zone.dflags[r.target] = true; } else if (r.target && need_src_action_chain(r)) { r.jump_chain = `${r.target}_from_${r.src.zone.name}`; r.src.zone.sflags[r.target] = true; } else if (r.target == "reject") r.jump_chain = "handle_reject"; } if (r.device) r[r.direction ? "oifnames" : "iifnames"] = [ r.device.device ]; push(this.state.rules ||= [], r); }; for (let proto in rule.proto) { let sip, dip, sports, dports, itypes4, itypes6; let family = rule.family; switch (proto.name) { case "icmp": itypes4 = filter(rule.icmp_type || [], family_is_ipv4); itypes6 = filter(rule.icmp_type || [], family_is_ipv6); break; case "ipv6-icmp": family = 6; itypes6 = filter(rule.icmp_type || [], family_is_ipv6); break; case "tcp": case "udp": sports = rule.src_port; dports = rule.dest_port; break; } sip = subnets_split_af(rule.src_ip); dip = subnets_split_af(rule.dest_ip); family = infer_family(family, [ ipset, "set match", sip, "source IP", dip, "destination IP", rule.src?.zone, "source zone", rule.dest?.zone, "destination zone", rule.helper, "helper match", rule.set_helper, "helper to set" ]); if (type(family) == "string") { this.warn_section(data, `${family}, skipping`); continue; } let has_ipv4_specifics = (length(sip[0]) || length(dip[0]) || length(itypes4) || rule.dscp !== null); let has_ipv6_specifics = (length(sip[1]) || length(dip[1]) || length(itypes6) || rule.dscp !== null); /* if no family was configured, infer target family from IP addresses */ if (family === null) { if (has_ipv4_specifics && !has_ipv6_specifics) family = 4; else if (has_ipv6_specifics && !has_ipv4_specifics) family = 6; else family = 0; } /* check if there's no AF specific bits, in this case we can do an AF agnostic rule */ if (!family && rule.target != "dscp" && !has_ipv4_specifics && !has_ipv6_specifics) { add_rule(0, proto, [], [], sports, dports, null, null, ipset, rule); } /* we need to emit one or two AF specific rules */ else { if (family == 0 || family == 4) { let icmp_types = filter(itypes4, i => (i.code_min == 0 && i.code_max == 0xFF)); let icmp_codes = filter(itypes4, i => (i.code_min != 0 || i.code_max != 0xFF)); for (let saddrs in subnets_group_by_masking(sip[0])) { for (let daddrs in subnets_group_by_masking(dip[0])) { if (length(icmp_types) || (!length(icmp_types) && !length(icmp_codes))) add_rule(4, proto, saddrs, daddrs, sports, dports, icmp_types, null, ipset, rule); if (length(icmp_codes)) add_rule(4, proto, saddrs, daddrs, sports, dports, null, icmp_codes, ipset, rule); } } } if (family == 0 || family == 6) { let icmp_types = filter(itypes6, i => (i.code_min == 0 && i.code_max == 0xFF)); let icmp_codes = filter(itypes6, i => (i.code_min != 0 || i.code_max != 0xFF)); for (let saddrs in subnets_group_by_masking(sip[1])) { for (let daddrs in subnets_group_by_masking(dip[1])) { if (length(icmp_types) || (!length(icmp_types) && !length(icmp_codes))) add_rule(6, proto, saddrs, daddrs, sports, dports, icmp_types, null, ipset, rule); if (length(icmp_codes)) add_rule(6, proto, saddrs, daddrs, sports, dports, null, icmp_codes, ipset, rule); } } } } } }, parse_redirect: function(data) { let redir = this.parse_options(data, { enabled: [ "bool", "1" ], name: [ "string", this.section_id(data[".name"]) ], _name: [ "string", null, DEPRECATED ], family: [ "family" ], src: [ "zone_ref" ], dest: [ "zone_ref" ], ipset: [ "setmatch" ], helper: [ "cthelper", null, NO_INVERT ], proto: [ "protocol", "tcpudp", PARSE_LIST | FLATTEN_LIST ], src_ip: [ "network" ], src_mac: [ "mac", null, PARSE_LIST ], src_port: [ "port" ], src_dip: [ "network" ], src_dport: [ "port" ], dest_ip: [ "network" ], dest_port: [ "port" ], extra: [ "string", null, UNSUPPORTED ], limit: [ "limit" ], limit_burst: [ "int" ], utc_time: [ "bool" ], start_date: [ "date" ], stop_date: [ "date" ], start_time: [ "time" ], stop_time: [ "time" ], weekdays: [ "weekdays" ], monthdays: [ "monthdays", null, UNSUPPORTED ], mark: [ "mark" ], reflection: [ "bool", "1" ], reflection_src: [ "reflection_source", "internal" ], reflection_zone: [ "zone_ref", null, PARSE_LIST ], counter: [ "bool", "1" ], log: [ "string" ], log_limit: [ "limit" ], target: [ "target", "dnat" ] }); if (redir === false) { this.warn_section(data, "skipped due to invalid options"); return; } else if (!redir.enabled) { this.warn_section(data, "is disabled, ignoring section"); return; } if (!(redir.target in ["dnat", "snat"])) { this.warn_section(data, "has invalid target specified, defaulting to dnat"); redir.target = "dnat"; } switch (this.parse_bool(redir.log)) { case true: redir.log = `${redir.name}: `; break; case false: delete redir.log; } let ipset; if (redir.ipset) { ipset = filter(this.state.ipsets, s => (s.name == redir.ipset.name))?.[0]; if (!ipset) { this.warn_section(data, `references unknown set '${redir.ipset.name}'`); return; } if (('inet_service' in ipset.types) && !ensure_tcpudp(redir.proto)) { this.warn_section(data, "references named set with port match but no UDP/TCP protocol, ignoring section"); return; } } let resolve_dest = (redir) => { for (let zone in this.state.zones) { for (let zone_addr in zone.related_subnets) { for (let dest_addr in redir.dest_ip.addrs) { if (dest_addr.family != zone_addr.family) continue; let a = apply_mask(dest_addr.addr, zone_addr.mask); let b = apply_mask(zone_addr.addr, zone_addr.mask); if (a != b) continue; redir.dest = { any: false, zone: zone }; return true; } } } return false; }; if (redir.target == "dnat") { if (!redir.src) return this.warn_section(data, "has no source specified"); else if (redir.src.any) return this.warn_section(data, "must not have source '*' for dnat target"); else if (redir.dest_ip && redir.dest_ip.invert) return this.warn_section(data, "must not specify a negated 'dest_ip' value"); else if (redir.dest_ip && length(filter(redir.dest_ip.addrs, a => a.bits == -1))) return this.warn_section(data, "must not use non-contiguous masks in 'dest_ip'"); if (!redir.dest && redir.dest_ip && resolve_dest(redir)) this.warn_section(data, `does not specify a destination, assuming '${redir.dest.zone.name}'`); if (!redir.dest_port) redir.dest_port = redir.src_dport; if (redir.reflection && redir.dest?.zone && redir.src.zone.masq) { redir.dest.zone.dflags.accept = true; redir.dest.zone.dflags.dnat = true; redir.dest.zone.dflags.snat = true; } if (redir.helper) redir.src.zone.dflags.helper = true; redir.src.zone.dflags[redir.target] = true; } else { if (!redir.dest) return this.warn_section(data, "has no destination specified"); else if (redir.dest.any) return this.warn_section(data, "must not have destination '*' for snat target"); else if (!redir.src_dip) return this.warn_section(data, "has no 'src_dip' option specified"); else if (redir.src_dip.invert) return this.warn_section(data, "must not specify a negated 'src_dip' value"); else if (length(filter(redir.src_dip.addrs, a => a.bits == -1))) return this.warn_section(data, "must not use non-contiguous masks in 'src_dip'"); else if (redir.src_mac) return this.warn_section(data, "must not use 'src_mac' option for snat target"); else if (redir.helper) return this.warn_section(data, "must not use 'helper' option for snat target"); redir.dest.zone.dflags[redir.target] = true; } let add_rule = (family, proto, saddrs, daddrs, raddrs, sport, dport, rport, ipset, redir) => { let r = { ...redir, family: family, proto: proto, has_addrs: !!(saddrs[0] || saddrs[1] || saddrs[2] || daddrs[0] || daddrs[1] || daddrs[2]), has_ports: !!(sport || dport || rport), saddrs_pos: map(saddrs[0], this.cidr), saddrs_neg: map(saddrs[1], this.cidr), saddrs_masked: saddrs[2], daddrs_pos: map(daddrs[0], this.cidr), daddrs_neg: map(daddrs[1], this.cidr), daddrs_masked: daddrs[2], sports_pos: map(filter_pos(to_array(sport)), this.port), sports_neg: map(filter_neg(to_array(sport)), this.port), dports_pos: map(filter_pos(to_array(dport)), this.port), dports_neg: map(filter_neg(to_array(dport)), this.port), smacs_pos: map(filter_pos(redir.src_mac), m => m.mac), smacs_neg: map(filter_neg(redir.src_mac), m => m.mac), raddr: raddrs ? raddrs[0] : null, rport: rport }; let set_types = map_setmatch(ipset, redir.ipset, proto.name); if (set_types !== set_types) { this.warn_section(data, "destination MAC address matching not supported"); return; } else if (set_types) { r.ipset = { ...r.ipset, fields: set_types }; } switch (r.target) { case "dnat": r.chain = `dstnat_${r.src.zone.name}`; r.src.zone.dflags.dnat = true; if (!r.raddr) r.target = "redirect"; break; case "snat": r.chain = `srcnat_${r.dest.zone.name}`; r.dest.zone.dflags.snat = true; break; } push(this.state.redirects ||= [], r); }; let to_hostaddr = (a) => { let bits = (a.family == 4) ? 32 : 128; return { family: a.family, addr: apply_mask(a.addr, bits), bits: bits }; }; for (let proto in redir.proto) { let sip, dip, rip, iip, eip, refip, sport, dport, rport; let family = redir.family; if (proto.name == "ipv6-icmp") family = 6; switch (redir.target) { case "dnat": sip = subnets_split_af(redir.src_ip); dip = subnets_split_af(redir.src_dip); rip = subnets_split_af(redir.dest_ip); switch (proto.name) { case "tcp": case "udp": sport = redir.src_port; dport = redir.src_dport; rport = redir.dest_port; break; } break; case "snat": sip = subnets_split_af(redir.src_ip); dip = subnets_split_af(redir.dest_ip); rip = subnets_split_af(redir.src_dip); switch (proto.name) { case "tcp": case "udp": sport = redir.src_port; dport = redir.dest_port; rport = redir.src_dport; break; } break; } family = infer_family(family, [ ipset, "set match", sip, "source IP", dip, "destination IP", rip, "rewrite IP", redir.src?.zone, "source zone", redir.dest?.zone, "destination zone", redir.helper, "helper match" ]); if (type(family) == "string") { this.warn_section(data, `${family}, skipping`); continue; } /* build reflection rules */ if (redir.target == "dnat" && redir.reflection && (length(rip[0]) || length(rip[1])) && redir.src?.zone && redir.dest?.zone) { let refredir = { name: `${redir.name} (reflection)`, helper: redir.helper, // XXX: this likely makes no sense for reflection rules //src_mac: redir.src_mac, limit: redir.limit, limit_burst: redir.limit_burst, start_date: redir.start_date, stop_date: redir.stop_date, start_time: redir.start_time, stop_time: redir.stop_time, weekdays: redir.weekdays, mark: redir.mark }; let eaddrs = length(dip) ? dip : subnets_split_af({ addrs: map(redir.src.zone.related_subnets, to_hostaddr) }); let rzones = length(redir.reflection_zone) ? redir.reflection_zone : [ redir.dest ]; for (let rzone in rzones) { if (!is_family(rzone, family)) { this.warn_section(data, `is restricted to IPv${family} but referenced reflection zone is IPv${rzone.family} only, skipping`); continue; } let iaddrs = subnets_split_af({ addrs: rzone.zone.related_subnets }); let refaddrs = (redir.reflection_src == "internal") ? iaddrs : eaddrs; for (let i = 0; i <= 1; i++) { if (redir.src.zone[i ? "masq6" : "masq"] && length(rip[i])) { let snat_addr = refaddrs[i]?.[0]; /* For internal reflection sources try to find a suitable candiate IP * among the reflection zone subnets which is within the same subnet * as the original DNAT destination. If we can't find any matching * one then simply take the first candidate. */ if (redir.reflection_src == "internal") { for (let zone_addr in rzone.zone.related_subnets) { if (zone_addr.family != rip[i][0].family) continue; let r = apply_mask(rip[i][0].addr, zone_addr.mask); let a = apply_mask(zone_addr.addr, zone_addr.mask); if (r != a) continue; snat_addr = zone_addr; break; } } if (!snat_addr) { this.warn_section(data, `${redir.reflection_src || "external"} rewrite IP cannot be determined, disabling reflection`); } else if (!length(iaddrs[i])) { this.warn_section(data, "internal address range cannot be determined, disabling reflection"); } else if (!length(eaddrs[i])) { this.warn_section(data, "external address range cannot be determined, disabling reflection"); } else { refredir.src = rzone; refredir.dest = null; refredir.target = "dnat"; for (let saddrs in subnets_group_by_masking(iaddrs[i])) for (let daddrs in subnets_group_by_masking(eaddrs[i])) add_rule(i ? 6 : 4, proto, saddrs, daddrs, rip[i], sport, dport, rport, null, refredir); refredir.src = null; refredir.dest = rzone; refredir.target = "snat"; for (let daddrs in subnets_group_by_masking(rip[i])) for (let saddrs in subnets_group_by_masking(iaddrs[i])) add_rule(i ? 6 : 4, proto, saddrs, daddrs, [ to_hostaddr(snat_addr) ], null, rport, null, null, refredir); } } } } } if (length(rip[0]) > 1 || length(rip[1]) > 1) this.warn_section(data, "specifies multiple rewrite addresses, using only first one"); let has_ip4_addr = length(sip[0]) || length(dip[0]) || length(rip[0]), has_ip6_addr = length(sip[1]) || length(dip[1]) || length(rip[1]), has_any_addr = has_ip4_addr || has_ip6_addr; /* check if there's no AF specific bits, in this case we can do an AF agnostic rule */ if (!family && !has_any_addr) { /* for backwards compatibility, treat unspecified family as IPv4 unless user explicitly requested any (0) */ if (family == null) family = 4; add_rule(family, proto, [], [], null, sport, dport, rport, ipset, redir); } /* we need to emit one or two AF specific rules */ else { if ((!family || family == 4) && (!has_any_addr || has_ip4_addr)) { for (let saddrs in subnets_group_by_masking(sip[0])) for (let daddrs in subnets_group_by_masking(dip[0])) add_rule(4, proto, saddrs, daddrs, rip[0], sport, dport, rport, ipset, redir); } if ((!family || family == 6) && (!has_any_addr || has_ip6_addr)) { for (let saddrs in subnets_group_by_masking(sip[1])) for (let daddrs in subnets_group_by_masking(dip[1])) add_rule(6, proto, saddrs, daddrs, rip[1], sport, dport, rport, ipset, redir); } } } }, parse_nat: function(data) { let snat = this.parse_options(data, { enabled: [ "bool", "1" ], name: [ "string", this.section_id(data[".name"]) ], family: [ "family" ], src: [ "zone_ref" ], device: [ "string" ], ipset: [ "setmatch", null, UNSUPPORTED ], proto: [ "protocol", "all", PARSE_LIST | FLATTEN_LIST ], src_ip: [ "network" ], src_port: [ "port" ], snat_ip: [ "network", null, NO_INVERT ], snat_port: [ "port", null, NO_INVERT ], dest_ip: [ "network" ], dest_port: [ "port" ], extra: [ "string", null, UNSUPPORTED ], limit: [ "limit" ], limit_burst: [ "int" ], connlimit_ports: [ "bool" ], utc_time: [ "bool" ], start_date: [ "date" ], stop_date: [ "date" ], start_time: [ "time" ], stop_time: [ "time" ], weekdays: [ "weekdays" ], monthdays: [ "monthdays", null, UNSUPPORTED ], mark: [ "mark" ], counter: [ "bool", "1" ], log: [ "string" ], target: [ "target", "masquerade" ] }); if (snat === false) { this.warn_section(data, "skipped due to invalid options"); return; } else if (!snat.enabled) { this.warn_section(data, "is disabled, ignoring section"); return; } if (!(snat.target in ["accept", "snat", "masquerade"])) { this.warn_section(data, "has invalid target specified, defaulting to masquerade"); snat.target = "masquerade"; } if (snat.target == "snat" && !snat.snat_ip && !snat.snat_port) { this.warn_section(data, "needs either 'snat_ip' or 'snat_port' for target snat, ignoring section"); return; } else if (snat.target != "snat" && snat.snat_ip) { this.warn_section(data, "must not use 'snat_ip' for non-snat target, ignoring section"); return; } else if (snat.target != "snat" && snat.snat_port) { this.warn_section(data, "must not use 'snat_port' for non-snat target, ignoring section"); return; } if ((snat.snat_port || snat.src_port || snat.dest_port) && !ensure_tcpudp(snat.proto)) { this.warn_section(data, "specifies ports but no UDP/TCP protocol, ignoring section"); return; } if (snat.snat_ip && length(filter(snat.snat_ip.addrs, a => a.bits == -1 || a.invert))) { this.warn_section(data, "must not use inversion or non-contiguous masks in 'snat_ip', ignoring section"); return; } switch (this.parse_bool(snat.log)) { case true: snat.log = `${snat.name}: `; break; case false: delete snat.log; } let add_rule = (family, proto, saddrs, daddrs, raddrs, sport, dport, rport, snat) => { let n = { ...snat, family: family, proto: proto, has_addrs: !!(saddrs[0] || saddrs[1] || saddrs[2] || daddrs[0] || daddrs[1] || daddrs[2]), has_ports: !!(sport || dport), saddrs_pos: map(saddrs[0], this.cidr), saddrs_neg: map(saddrs[1], this.cidr), saddrs_masked: saddrs[2], daddrs_pos: map(daddrs[0], this.cidr), daddrs_neg: map(daddrs[1], this.cidr), daddrs_masked: daddrs[2], sports_pos: map(filter_pos(to_array(sport)), this.port), sports_neg: map(filter_neg(to_array(sport)), this.port), dports_pos: map(filter_pos(to_array(dport)), this.port), dports_neg: map(filter_neg(to_array(dport)), this.port), raddr: raddrs ? raddrs[0] : null, rport: rport, chain: snat.src?.zone ? `srcnat_${snat.src.zone.name}` : "srcnat" }; push(this.state.redirects ||= [], n); }; for (let proto in snat.proto) { let sip, dip, rip, sport, dport, rport; let family = snat.family; sip = subnets_split_af(snat.src_ip); dip = subnets_split_af(snat.dest_ip); rip = subnets_split_af(snat.snat_ip); switch (proto.name) { case "tcp": case "udp": sport = snat.src_port; dport = snat.dest_port; rport = snat.snat_port; break; } if (length(rip[0]) > 1 || length(rip[1]) > 1) this.warn_section(data, "specifies multiple rewrite addresses, using only first one"); family = infer_family(family, [ sip, "source IP", dip, "destination IP", rip, "rewrite IP", snat.src?.zone, "source zone" ]); if (type(family) == "string") { this.warn_section(data, `${family}, skipping`); continue; } if (snat.src?.zone) snat.src.zone.dflags.snat = true; /* if no family was configured, infer target family from IP addresses */ if (family === null) { if ((length(sip[0]) || length(dip[0]) || length(rip[0])) && !length(sip[1]) && !length(dip[1]) && !length(rip[1])) family = 4; else if ((length(sip[1]) || length(dip[1]) || length(rip[1])) && !length(sip[0]) && !length(dip[0]) && !length(rip[0])) family = 6; else family = 4; /* default to IPv4 only for backwards compatibility, unless an explict family any was configured */ } /* check if there's no AF specific bits, in this case we can do an AF agnostic rule */ if (!family && !length(sip[0]) && !length(sip[1]) && !length(dip[0]) && !length(dip[1]) && !length(rip[0]) && !length(rip[1])) { add_rule(0, proto, [], [], null, sport, dport, rport, snat); } /* we need to emit one or two AF specific rules */ else { if (family == 0 || family == 4) for (let saddr in subnets_group_by_masking(sip[0])) for (let daddr in subnets_group_by_masking(dip[0])) add_rule(4, proto, saddr, daddr, rip[0], sport, dport, rport, snat); if (family == 0 || family == 6) for (let saddr in subnets_group_by_masking(sip[1])) for (let daddr in subnets_group_by_masking(dip[1])) add_rule(6, proto, saddr, daddr, rip[1], sport, dport, rport, snat); } } }, parse_include: function(data) { let inc = this.parse_options(data, { enabled: [ "bool", "1" ], path: [ "string", null, REQUIRED ], type: [ "includetype", "script" ], fw4_compatible: [ "bool", data.path != "/etc/firewall.user" ], family: [ "family", null, UNSUPPORTED ], reload: [ "bool", null, UNSUPPORTED ], position: [ "includeposition" ], chain: [ "identifier" ] }); if (!inc.enabled) { this.warn_section(data, "is disabled, ignoring section"); return; } if (inc.type == "script" && !inc.fw4_compatible) { this.warn_section(data, "is not marked as compatible with fw4, ignoring section"); this.warn_section(data, "requires 'option fw4_compatible 1' to be considered compatible"); return; } for (let opt in [ "table", "chain", "position" ]) { if (inc.type != "nftables" && inc[opt]) { this.warn_section(data, `must not specify '${opt}' for non-nftables includes, ignoring section`); return; } } switch (inc.position ??= 'table-append') { case 'ruleset-prepend': case 'ruleset-append': case 'table-prepend': case 'table-append': if (inc.chain) this.warn_section(data, `specifies 'chain' which has no effect for position ${inc.position}`); delete inc.chain; break; case 'chain-prepend': case 'chain-append': if (!inc.chain) { this.warn_section(data, `must specify 'chain' for position ${inc.position}, ignoring section`); return; } break; } let path = fs.readlink(inc.path) ?? inc.path; if (!fs.access(path)) { this.warn_section(data, `specifies unreachable path '${path}', ignoring section`); return; } if (!data['.name']) this.warn(`Automatically including '${path}'`); push(this.state.includes ||= [], { ...inc, path }); }, parse_ipset: function(data) { let ipset = this.parse_options(data, { enabled: [ "bool", "1" ], reload_set: [ "bool" ], counters: [ "bool" ], comment: [ "string" ], name: [ "identifier", null, REQUIRED ], family: [ "family", "4" ], storage: [ "string", null, UNSUPPORTED ], match: [ "ipsettype", null, PARSE_LIST ], iprange: [ "string", null, UNSUPPORTED ], portrange: [ "string", null, UNSUPPORTED ], netmask: [ "int", null, UNSUPPORTED ], maxelem: [ "int" ], hashsize: [ "int", null, UNSUPPORTED ], timeout: [ "int", "-1" ], external: [ "string", null, UNSUPPORTED ], entry: [ "string", null, PARSE_LIST ], loadfile: [ "string" ] }); if (ipset === false) { this.warn_section(data, "skipped due to invalid options"); return; } else if (!ipset.enabled) { this.warn_section(data, "is disabled, ignoring section"); return; } if (!length(ipset.match)) { this.warn_section(data, "has no datatypes assigned"); return; } let dirs = map(ipset.match, m => m[0]), types = map(ipset.match, m => m[1]), interval = false; if (("ip" in types || "net" in types) && ipset.family == 0) { this.warn_section(data, "must not specify family 'any' when matching type 'ip' or 'net'"); return; } if ("set" in types) { this.warn_section(data, "match type 'set' is not supported"); return; } if ("net" in types) { if (this.kernel < 0x05060000) { this.warn_section(data, "match type 'net' requires kernel 5.6 or later"); return; } interval = true; } let s = { ...ipset, fw4types: types, types: map(types, (t) => { switch (t) { case 'ip': case 'net': return (ipset.family == 4) ? 'ipv4_addr' : 'ipv6_addr'; case 'mac': return 'ether_addr'; case 'port': return 'inet_service'; } }), directions: dirs, interval: interval }; if (s.interval) push(s.flags ??= [], 'interval'); if (s.timeout >= 0) push(s.flags ??= [], 'timeout'); s.entries = filter(map(ipset.entry, (e) => { let v = this.parse_ipsetentry(e, s); if (!v) this.warn_section(data, `ignoring invalid ipset entry '${e}'`); return v; }), (e) => (e != null)); push(this.state.ipsets ||= [], s); } }; 07070101AE24EE000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001600000000usr/share/ucode/utils07070101AE24EF000081ED0000000000000000000000016A426C2800002941000000FE0000000000000000000000000000002200000000usr/share/ucode/utils/argparse.uc//------------------------------------------------------------------------------ // argparse.uc - Argument Parser for ucode // Copyright (c) 2024-2025 Eric Fahlgren // SPDX-License-Identifier: GPL-2.0-only // vim: set noexpandtab softtabstop=8 shiftwidth=8 syntax=javascript: //------------------------------------------------------------------------------ // All uses of 'assert' in the argparse module indicate programming errors, // and never user input errors. If you define an argument incorrectly, // an assertion will be raised, whereas if a user enters an incorrect // command line, then 'usage' or 'usage_short' is called. // // To dump the list of actions, try this: // $ ucode -p 'import { ArgActions } from "utils.argparse"; keys(ArgActions);' const VERSION = "2026.04.09~5d6760b5-r1"; import { cursor } from 'uci'; import { basename, dirname, realpath } from 'fs'; const isnan = (x) => x != x; export const ArgActions = { // Static class of standard actions for arguments. // All functions have the prototype: // fn(self, params) // where // self = an ArgParser object // params = object with optional parameters, typically, but not restricted // to: // name = option name // value = option value // msg = any associated output message store: function(self, params) { // We don't flag multiple stores, last one wins. assert(params.name, "'store' action requires an option name"); assert(params.value, "'store' action requires a value"); self.options[params.name] = params.value; }, storex: function(self, params) { // Exclusive version of store, multiple stores generates an error. if (self.options[params.name]) { let p = this.long || this.short; this.usage_short(self, {exit: 1, prefix: `ERROR: '${p}' may only be used once per invocation:\n ${this.help}`}); } this.store(self, params); }, store_int: function(self, params) { assert(params.name, "'store_int' action requires an option name"); assert(params.value, "'store_int' action requires a value"); let value = int(params.value); let error = null; if (isnan(value)) error = `invalid integer '${params.value}'`; else if ("lower" in this && value < this.lower) error = `${value} below lower bound ${this.lower}`; else if ("upper" in this && value > this.upper) error = `${value} above upper bound ${this.upper}`; if (error) this.usage_short(self, {exit: 1, prefix: `ERROR: ${error}`}); self.options[params.name] = value; }, file: function(self, params) { assert(params.name, "'file' action requires an option name"); assert(params.value, "'file' action requires a value"); if (params.value) { let dir = realpath(dirname(params.value)); if (! dir) { let msg = `'${params.name}' value '${params.value}' must contain a valid directory path.`; this.usage_short(self, {exit: 1, prefix: `ERROR: ${msg}`}); } let file = dir + "/" + basename(params.value); self.options[params.name] = file; } }, enum: function(self, params) { assert(params.name, "'enum' action requires an option name"); assert(params.value, "'enum' action requires a value"); assert(this.one_of, "'enum' requires a 'one_of' list of values"); if (! (params.value in this.one_of)) { let msg = `'${params.name}' must be one of ${join(", ", this.one_of)}, not '${params.value}'`; this.usage_short(self, {exit: 1, prefix: `ERROR: ${msg}`}); } self.options[params.name] = params.value; }, set: function(self, params) { assert(params.name, "'set' action requires an option name"); assert(type(self.options[params.name]) == "bool", `missing default value for '${params.name}'?`); let value = exists(params, "value") ? params.value : true; self.options[params.name] = value in [true, "true", 1, "1", "yes", "on"]; }, inc: function(self, params) { assert(params.name, "'inc' action requires an option name"); assert(type(self.options[params.name]) == "int", `missing default value for '${params.name}'?`); let value = exists(params, "value") ? int(params.value) : (self.options[params.name] + 1); self.options[params.name] = value; }, dec: function(self, params) { assert(params.name, "'dec' action requires an option name"); assert(type(self.options[params.name]) == "int", `missing default value for '${params.name}'?`); let value = exists(params, "value") ? int(params.value) : (self.options[params.name] - 1); self.options[params.name] = value; }, version: function(self, params) { self.show_version(); }, usage_short: function(self, params) { // Produce a short usage message. 'params' may contain 'prefix' // or 'suffix'. let shorts = []; for (let arg in self) { if (! arg.name || ! arg.help) continue; if ("position" in arg) { push(shorts, uc(arg.name)); } else { let name = arg.short || arg.long; // deal with "nargs" ... let v = arg.nargs > 0 ? ` ${uc(arg.name)}` : ""; push(shorts, `[${name}${v}]`); } } if ("prefix" in params) printf("%s\n", params.prefix); printf(`Usage: ${self.program_string} %s\n`, join(" ", shorts)); if ("suffix" in params) printf("%s\n", params.suffix); if ("exit" in params) exit(params.exit); }, usage: function(self, params) { self.show_version(); // params: optional {msg} if (params?.msg) printf("\n%s\n", params.msg); if (self.prologue) print(self.prologue); this.usage_short(self, {prefix: ""}); for (let arg in self) { if (! arg.help) continue; // Explicitly ignore items without help. if ("position" in arg) { printf("\n %s - %s, must be one of:\n", uc(arg.name), arg.help); for (let n,v in arg.one_of) { if (v.help) { printf(" %-8s - %s\n", n, v.help); } } printf("\n"); } else { let out = ""; if (arg.short) out += arg.short; if (arg.long) { if (length(out)) out += "/"; out += arg.long; } if (arg.nargs > 0) out += " " + uc(arg.name); printf(" %-20s - %s\n", out, arg.help); } } if (self.epilogue) print(self.epilogue); if ("exit" in params) exit(params.exit); }, }; export const ArgParser = { // Singleton class for a program's command line argument parsing. program_string: null, // User-defined name of program. version_string: null, // User-defined version string. prologue: null, // Text to put before argument list in usage. epilogue: null, // Text to put after argument list in usage. options: null, // Collected results from parsing. has_required: false, // Did the user specify any required arguments? show_version: function() { printf("%s\n", this.version_string ?? "no version string set"); }, set_prog_info: function(ver, prog) { // Allow user to set the version string, and optionally the // program string. proto(this).version_string = ver; proto(this).program_string = prog ?? split(sourcepath(1), "/")[-1]; }, set_bookends: function(prologue, epilogue) { proto(this).prologue = prologue; proto(this).epilogue = epilogue; }, init: function() { // Build initial options table. // Could use a bunch of error checking added to verify // non-duplicate short and long, etc. proto(this).options = {}; // Build the result cache, populate with defaults. for (let i = 0, arg = this[i]; i < length(this); i++, arg = this[i]) { assert(arg.short || arg.long || "position" in arg, `arg definition must contain at least one of 'short', 'long' or 'position'\n ${arg}`); arg = this[i] = proto(arg, ArgActions); // Cast each arg to actions type. if (arg.name) { this.options[arg.name] = "default" in arg ? arg.default : null; } if (type(arg.action) == "string") { // Look up our canned actions. assert(arg.action in ArgActions, `action '${arg.action}' is not defined`); arg.action = ArgActions[arg.action]; } if ("position" in arg) { // Positional arguments are required. proto(this).has_required = true; } } }, get_arg: function(arg, position) { for (let opt in this) { if (position == opt.position) { if (arg in opt.one_of) return opt; ArgActions.usage_short(this, {exit: 1, prefix: `ERROR: '${arg}' is not valid here, expected ${uc(opt.name)}`}); } if (arg in [opt.short, opt.long]) { return opt; } } return null; }, get_by_name: function(name) { for (let opt in this) { if (opt.name == name) return opt; } return null; }, add_config: function(uci_section) { let uci = cursor(); for (let file, section in uci_section) { let cfg = uci.get_all(file, section); for (let name, value in cfg) { let opt = this.get_by_name(name); if (opt) { opt.action(this, {name: name, value: value}); } } } }, parse: function(argv, uci_section) { // Parse the argument vector. If no value for 'argv' is // supplied, then use global ARGV. // // uci_section is an object with file and section names to // be used to override default values. argv ??= ARGV; this.init(); if (uci_section) { this.add_config(uci_section); } if (this.has_required && length(argv) == 0) { ArgActions.usage_short(this, {exit: 1, suffix: "Try '-h' for full help."}); } let iarg = 0; let narg = length(argv); while (iarg < narg) { let arg = argv[iarg]; let opt = this.get_arg(arg, iarg); iarg++; if (! opt) { ArgActions.usage(this, {exit: 1, msg: `ERROR: '${arg}' is not a valid command or option`}); } let action_args = {}; if ("name" in opt) { action_args.name = opt.name; } if ("position" in opt) { action_args.value = arg; } if ("nargs" in opt && opt.nargs > 0) { if (opt.nargs > narg-iarg) { ArgActions.usage(this, {exit: 1, msg: `ERROR: '${arg}' requires ${opt.nargs} values`}); } if (opt.nargs == 1) { action_args.value = argv[iarg]; } else { action_args.value = slice(argv, iarg, iarg+opt.nargs); } iarg += opt.nargs; } opt.action(this, action_args); if ("auto_exit" in opt) { // The auto_exit parameter value is the exit status code. exit(opt.auto_exit); } } return this.options; }, }; // argparse module provides a few canned option definitions. export let DEFAULT_HELP = { short: "-h", long: "--help", action: "usage", auto_exit: 1, help: "Show this message and quit." }; export let DEFAULT_VERSION = { long: "--version", action: "version", auto_exit: 0, help: "Show the program version and terminate." }; 07070101AE23D0000041ED0000000000000000000000046A426C2800000000000000FE0000000000000000000000000000001500000000usr/share/ucode/luci07070101AE23D5000081A40000000000000000000000016A426C28000000CC000000FE0000000000000000000000000000001F00000000usr/share/ucode/luci/uhttpd.uc{% import dispatch from 'luci.dispatcher'; import request from 'luci.http'; global.handle_request = function(env) { let req = request(env, uhttpd.recv, uhttpd.send); dispatch(req); req.close(); }; 07070101AE23D6000081A40000000000000000000000016A426C2800000064000000FE0000000000000000000000000000002000000000usr/share/ucode/luci/version.ucexport const revision = '26.180.75667~128a781', branch = 'LuCI (HEAD detached at 128a7812) branch'; 07070101AE23D7000081A40000000000000000000000016A426C2800003E42000000FE0000000000000000000000000000002100000000usr/share/ucode/luci/zoneinfo.uc// Autogenerated by zoneinfo2ucode.pl export default { 'Africa/Abidjan': 'GMT0', 'Africa/Accra': 'GMT0', 'Africa/Addis_Ababa': 'EAT-3', 'Africa/Algiers': 'CET-1', 'Africa/Asmara': 'EAT-3', 'Africa/Bamako': 'GMT0', 'Africa/Bangui': 'WAT-1', 'Africa/Banjul': 'GMT0', 'Africa/Bissau': 'GMT0', 'Africa/Blantyre': 'CAT-2', 'Africa/Brazzaville': 'WAT-1', 'Africa/Bujumbura': 'CAT-2', 'Africa/Cairo': 'EET-2EEST,M4.5.5/0,M10.5.4/24', 'Africa/Casablanca': '<+01>-1', 'Africa/Ceuta': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Africa/Conakry': 'GMT0', 'Africa/Dakar': 'GMT0', 'Africa/Dar_es_Salaam': 'EAT-3', 'Africa/Djibouti': 'EAT-3', 'Africa/Douala': 'WAT-1', 'Africa/El_Aaiun': '<+01>-1', 'Africa/Freetown': 'GMT0', 'Africa/Gaborone': 'CAT-2', 'Africa/Harare': 'CAT-2', 'Africa/Johannesburg': 'SAST-2', 'Africa/Juba': 'CAT-2', 'Africa/Kampala': 'EAT-3', 'Africa/Khartoum': 'CAT-2', 'Africa/Kigali': 'CAT-2', 'Africa/Kinshasa': 'WAT-1', 'Africa/Lagos': 'WAT-1', 'Africa/Libreville': 'WAT-1', 'Africa/Lome': 'GMT0', 'Africa/Luanda': 'WAT-1', 'Africa/Lubumbashi': 'CAT-2', 'Africa/Lusaka': 'CAT-2', 'Africa/Malabo': 'WAT-1', 'Africa/Maputo': 'CAT-2', 'Africa/Maseru': 'SAST-2', 'Africa/Mbabane': 'SAST-2', 'Africa/Mogadishu': 'EAT-3', 'Africa/Monrovia': 'GMT0', 'Africa/Nairobi': 'EAT-3', 'Africa/Ndjamena': 'WAT-1', 'Africa/Niamey': 'WAT-1', 'Africa/Nouakchott': 'GMT0', 'Africa/Ouagadougou': 'GMT0', 'Africa/Porto-Novo': 'WAT-1', 'Africa/Sao_Tome': 'GMT0', 'Africa/Tripoli': 'EET-2', 'Africa/Tunis': 'CET-1', 'Africa/Windhoek': 'CAT-2', 'America/Adak': 'HST10HDT,M3.2.0,M11.1.0', 'America/Anchorage': 'AKST9AKDT,M3.2.0,M11.1.0', 'America/Anguilla': 'AST4', 'America/Antigua': 'AST4', 'America/Araguaina': '<-03>3', 'America/Argentina/Buenos_Aires': '<-03>3', 'America/Argentina/Catamarca': '<-03>3', 'America/Argentina/Cordoba': '<-03>3', 'America/Argentina/Jujuy': '<-03>3', 'America/Argentina/La_Rioja': '<-03>3', 'America/Argentina/Mendoza': '<-03>3', 'America/Argentina/Rio_Gallegos': '<-03>3', 'America/Argentina/Salta': '<-03>3', 'America/Argentina/San_Juan': '<-03>3', 'America/Argentina/San_Luis': '<-03>3', 'America/Argentina/Tucuman': '<-03>3', 'America/Argentina/Ushuaia': '<-03>3', 'America/Aruba': 'AST4', 'America/Asuncion': '<-03>3', 'America/Atikokan': 'EST5', 'America/Bahia': '<-03>3', 'America/Bahia_Banderas': 'CST6', 'America/Barbados': 'AST4', 'America/Belem': '<-03>3', 'America/Belize': 'CST6', 'America/Blanc-Sablon': 'AST4', 'America/Boa_Vista': '<-04>4', 'America/Bogota': '<-05>5', 'America/Boise': 'MST7MDT,M3.2.0,M11.1.0', 'America/Cambridge_Bay': 'MST7MDT,M3.2.0,M11.1.0', 'America/Campo_Grande': '<-04>4', 'America/Cancun': 'EST5', 'America/Caracas': '<-04>4', 'America/Cayenne': '<-03>3', 'America/Cayman': 'EST5', 'America/Chicago': 'CST6CDT,M3.2.0,M11.1.0', 'America/Chihuahua': 'CST6', 'America/Ciudad_Juarez': 'MST7MDT,M3.2.0,M11.1.0', 'America/Costa_Rica': 'CST6', 'America/Coyhaique': '<-03>3', 'America/Creston': 'MST7', 'America/Cuiaba': '<-04>4', 'America/Curacao': 'AST4', 'America/Danmarkshavn': 'GMT0', 'America/Dawson': 'MST7', 'America/Dawson_Creek': 'MST7', 'America/Denver': 'MST7MDT,M3.2.0,M11.1.0', 'America/Detroit': 'EST5EDT,M3.2.0,M11.1.0', 'America/Dominica': 'AST4', 'America/Edmonton': 'MST7MDT,M3.2.0,M11.1.0', 'America/Eirunepe': '<-05>5', 'America/El_Salvador': 'CST6', 'America/Fort_Nelson': 'MST7', 'America/Fortaleza': '<-03>3', 'America/Glace_Bay': 'AST4ADT,M3.2.0,M11.1.0', 'America/Goose_Bay': 'AST4ADT,M3.2.0,M11.1.0', 'America/Grand_Turk': 'EST5EDT,M3.2.0,M11.1.0', 'America/Grenada': 'AST4', 'America/Guadeloupe': 'AST4', 'America/Guatemala': 'CST6', 'America/Guayaquil': '<-05>5', 'America/Guyana': '<-04>4', 'America/Halifax': 'AST4ADT,M3.2.0,M11.1.0', 'America/Havana': 'CST5CDT,M3.2.0/0,M11.1.0/1', 'America/Hermosillo': 'MST7', 'America/Indiana/Indianapolis': 'EST5EDT,M3.2.0,M11.1.0', 'America/Indiana/Knox': 'CST6CDT,M3.2.0,M11.1.0', 'America/Indiana/Marengo': 'EST5EDT,M3.2.0,M11.1.0', 'America/Indiana/Petersburg': 'EST5EDT,M3.2.0,M11.1.0', 'America/Indiana/Tell_City': 'CST6CDT,M3.2.0,M11.1.0', 'America/Indiana/Vevay': 'EST5EDT,M3.2.0,M11.1.0', 'America/Indiana/Vincennes': 'EST5EDT,M3.2.0,M11.1.0', 'America/Indiana/Winamac': 'EST5EDT,M3.2.0,M11.1.0', 'America/Inuvik': 'MST7MDT,M3.2.0,M11.1.0', 'America/Iqaluit': 'EST5EDT,M3.2.0,M11.1.0', 'America/Jamaica': 'EST5', 'America/Juneau': 'AKST9AKDT,M3.2.0,M11.1.0', 'America/Kentucky/Louisville': 'EST5EDT,M3.2.0,M11.1.0', 'America/Kentucky/Monticello': 'EST5EDT,M3.2.0,M11.1.0', 'America/Kralendijk': 'AST4', 'America/La_Paz': '<-04>4', 'America/Lima': '<-05>5', 'America/Los_Angeles': 'PST8PDT,M3.2.0,M11.1.0', 'America/Lower_Princes': 'AST4', 'America/Maceio': '<-03>3', 'America/Managua': 'CST6', 'America/Manaus': '<-04>4', 'America/Marigot': 'AST4', 'America/Martinique': 'AST4', 'America/Matamoros': 'CST6CDT,M3.2.0,M11.1.0', 'America/Mazatlan': 'MST7', 'America/Menominee': 'CST6CDT,M3.2.0,M11.1.0', 'America/Merida': 'CST6', 'America/Metlakatla': 'AKST9AKDT,M3.2.0,M11.1.0', 'America/Mexico_City': 'CST6', 'America/Miquelon': '<-03>3<-02>,M3.2.0,M11.1.0', 'America/Moncton': 'AST4ADT,M3.2.0,M11.1.0', 'America/Monterrey': 'CST6', 'America/Montevideo': '<-03>3', 'America/Montserrat': 'AST4', 'America/Nassau': 'EST5EDT,M3.2.0,M11.1.0', 'America/New_York': 'EST5EDT,M3.2.0,M11.1.0', 'America/Nome': 'AKST9AKDT,M3.2.0,M11.1.0', 'America/Noronha': '<-02>2', 'America/North_Dakota/Beulah': 'CST6CDT,M3.2.0,M11.1.0', 'America/North_Dakota/Center': 'CST6CDT,M3.2.0,M11.1.0', 'America/North_Dakota/New_Salem': 'CST6CDT,M3.2.0,M11.1.0', 'America/Nuuk': '<-02>2<-01>,M3.5.0/-1,M10.5.0/0', 'America/Ojinaga': 'CST6CDT,M3.2.0,M11.1.0', 'America/Panama': 'EST5', 'America/Paramaribo': '<-03>3', 'America/Phoenix': 'MST7', 'America/Port-au-Prince': 'EST5EDT,M3.2.0,M11.1.0', 'America/Port_of_Spain': 'AST4', 'America/Porto_Velho': '<-04>4', 'America/Puerto_Rico': 'AST4', 'America/Punta_Arenas': '<-03>3', 'America/Rankin_Inlet': 'CST6CDT,M3.2.0,M11.1.0', 'America/Recife': '<-03>3', 'America/Regina': 'CST6', 'America/Resolute': 'CST6CDT,M3.2.0,M11.1.0', 'America/Rio_Branco': '<-05>5', 'America/Santarem': '<-03>3', 'America/Santiago': '<-04>4<-03>,M9.1.6/24,M4.1.6/24', 'America/Santo_Domingo': 'AST4', 'America/Sao_Paulo': '<-03>3', 'America/Scoresbysund': '<-02>2<-01>,M3.5.0/-1,M10.5.0/0', 'America/Sitka': 'AKST9AKDT,M3.2.0,M11.1.0', 'America/St_Barthelemy': 'AST4', 'America/St_Johns': 'NST3:30NDT,M3.2.0,M11.1.0', 'America/St_Kitts': 'AST4', 'America/St_Lucia': 'AST4', 'America/St_Thomas': 'AST4', 'America/St_Vincent': 'AST4', 'America/Swift_Current': 'CST6', 'America/Tegucigalpa': 'CST6', 'America/Thule': 'AST4ADT,M3.2.0,M11.1.0', 'America/Tijuana': 'PST8PDT,M3.2.0,M11.1.0', 'America/Toronto': 'EST5EDT,M3.2.0,M11.1.0', 'America/Tortola': 'AST4', 'America/Vancouver': 'MST7', 'America/Whitehorse': 'MST7', 'America/Winnipeg': 'CST6CDT,M3.2.0,M11.1.0', 'America/Yakutat': 'AKST9AKDT,M3.2.0,M11.1.0', 'Antarctica/Casey': '<+08>-8', 'Antarctica/Davis': '<+07>-7', 'Antarctica/DumontDUrville': '<+10>-10', 'Antarctica/Macquarie': 'AEST-10AEDT,M10.1.0,M4.1.0/3', 'Antarctica/Mawson': '<+05>-5', 'Antarctica/McMurdo': 'NZST-12NZDT,M9.5.0,M4.1.0/3', 'Antarctica/Palmer': '<-03>3', 'Antarctica/Rothera': '<-03>3', 'Antarctica/Syowa': '<+03>-3', 'Antarctica/Troll': '<+00>0<+02>-2,M3.5.0/1,M10.5.0/3', 'Antarctica/Vostok': '<+05>-5', 'Arctic/Longyearbyen': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Asia/Aden': '<+03>-3', 'Asia/Almaty': '<+05>-5', 'Asia/Amman': '<+03>-3', 'Asia/Anadyr': '<+12>-12', 'Asia/Aqtau': '<+05>-5', 'Asia/Aqtobe': '<+05>-5', 'Asia/Ashgabat': '<+05>-5', 'Asia/Atyrau': '<+05>-5', 'Asia/Baghdad': '<+03>-3', 'Asia/Bahrain': '<+03>-3', 'Asia/Baku': '<+04>-4', 'Asia/Bangkok': '<+07>-7', 'Asia/Barnaul': '<+07>-7', 'Asia/Beirut': 'EET-2EEST,M3.5.0/0,M10.5.0/0', 'Asia/Bishkek': '<+06>-6', 'Asia/Brunei': '<+08>-8', 'Asia/Chita': '<+09>-9', 'Asia/Colombo': '<+0530>-5:30', 'Asia/Damascus': '<+03>-3', 'Asia/Dhaka': '<+06>-6', 'Asia/Dili': '<+09>-9', 'Asia/Dubai': '<+04>-4', 'Asia/Dushanbe': '<+05>-5', 'Asia/Famagusta': 'EET-2EEST,M3.5.0/3,M10.5.0/4', 'Asia/Gaza': 'EET-2EEST,M3.4.4/50,M10.4.4/50', 'Asia/Hebron': 'EET-2EEST,M3.4.4/50,M10.4.4/50', 'Asia/Ho_Chi_Minh': '<+07>-7', 'Asia/Hong_Kong': 'HKT-8', 'Asia/Hovd': '<+07>-7', 'Asia/Irkutsk': '<+08>-8', 'Asia/Jakarta': 'WIB-7', 'Asia/Jayapura': 'WIT-9', 'Asia/Jerusalem': 'IST-2IDT,M3.4.4/26,M10.5.0', 'Asia/Kabul': '<+0430>-4:30', 'Asia/Kamchatka': '<+12>-12', 'Asia/Karachi': 'PKT-5', 'Asia/Kathmandu': '<+0545>-5:45', 'Asia/Khandyga': '<+09>-9', 'Asia/Kolkata': 'IST-5:30', 'Asia/Krasnoyarsk': '<+07>-7', 'Asia/Kuala_Lumpur': '<+08>-8', 'Asia/Kuching': '<+08>-8', 'Asia/Kuwait': '<+03>-3', 'Asia/Macau': 'CST-8', 'Asia/Magadan': '<+11>-11', 'Asia/Makassar': 'WITA-8', 'Asia/Manila': 'PST-8', 'Asia/Muscat': '<+04>-4', 'Asia/Nicosia': 'EET-2EEST,M3.5.0/3,M10.5.0/4', 'Asia/Novokuznetsk': '<+07>-7', 'Asia/Novosibirsk': '<+07>-7', 'Asia/Omsk': '<+06>-6', 'Asia/Oral': '<+05>-5', 'Asia/Phnom_Penh': '<+07>-7', 'Asia/Pontianak': 'WIB-7', 'Asia/Pyongyang': 'KST-9', 'Asia/Qatar': '<+03>-3', 'Asia/Qostanay': '<+05>-5', 'Asia/Qyzylorda': '<+05>-5', 'Asia/Riyadh': '<+03>-3', 'Asia/Sakhalin': '<+11>-11', 'Asia/Samarkand': '<+05>-5', 'Asia/Seoul': 'KST-9', 'Asia/Shanghai': 'CST-8', 'Asia/Singapore': '<+08>-8', 'Asia/Srednekolymsk': '<+11>-11', 'Asia/Taipei': 'CST-8', 'Asia/Tashkent': '<+05>-5', 'Asia/Tbilisi': '<+04>-4', 'Asia/Tehran': '<+0330>-3:30', 'Asia/Thimphu': '<+06>-6', 'Asia/Tokyo': 'JST-9', 'Asia/Tomsk': '<+07>-7', 'Asia/Ulaanbaatar': '<+08>-8', 'Asia/Urumqi': '<+06>-6', 'Asia/Ust-Nera': '<+10>-10', 'Asia/Vientiane': '<+07>-7', 'Asia/Vladivostok': '<+10>-10', 'Asia/Yakutsk': '<+09>-9', 'Asia/Yangon': '<+0630>-6:30', 'Asia/Yekaterinburg': '<+05>-5', 'Asia/Yerevan': '<+04>-4', 'Atlantic/Azores': '<-01>1<+00>,M3.5.0/0,M10.5.0/1', 'Atlantic/Bermuda': 'AST4ADT,M3.2.0,M11.1.0', 'Atlantic/Canary': 'WET0WEST,M3.5.0/1,M10.5.0', 'Atlantic/Cape_Verde': '<-01>1', 'Atlantic/Faroe': 'WET0WEST,M3.5.0/1,M10.5.0', 'Atlantic/Madeira': 'WET0WEST,M3.5.0/1,M10.5.0', 'Atlantic/Reykjavik': 'GMT0', 'Atlantic/South_Georgia': '<-02>2', 'Atlantic/St_Helena': 'GMT0', 'Atlantic/Stanley': '<-03>3', 'Australia/Adelaide': 'ACST-9:30ACDT,M10.1.0,M4.1.0/3', 'Australia/Brisbane': 'AEST-10', 'Australia/Broken_Hill': 'ACST-9:30ACDT,M10.1.0,M4.1.0/3', 'Australia/Darwin': 'ACST-9:30', 'Australia/Eucla': '<+0845>-8:45', 'Australia/Hobart': 'AEST-10AEDT,M10.1.0,M4.1.0/3', 'Australia/Lindeman': 'AEST-10', 'Australia/Lord_Howe': '<+1030>-10:30<+11>-11,M10.1.0,M4.1.0', 'Australia/Melbourne': 'AEST-10AEDT,M10.1.0,M4.1.0/3', 'Australia/Perth': 'AWST-8', 'Australia/Sydney': 'AEST-10AEDT,M10.1.0,M4.1.0/3', 'Etc/GMT': 'GMT0', 'Etc/GMT+1': '<-01>1', 'Etc/GMT+10': '<-10>10', 'Etc/GMT+11': '<-11>11', 'Etc/GMT+12': '<-12>12', 'Etc/GMT+2': '<-02>2', 'Etc/GMT+3': '<-03>3', 'Etc/GMT+4': '<-04>4', 'Etc/GMT+5': '<-05>5', 'Etc/GMT+6': '<-06>6', 'Etc/GMT+7': '<-07>7', 'Etc/GMT+8': '<-08>8', 'Etc/GMT+9': '<-09>9', 'Etc/GMT-1': '<+01>-1', 'Etc/GMT-10': '<+10>-10', 'Etc/GMT-11': '<+11>-11', 'Etc/GMT-12': '<+12>-12', 'Etc/GMT-13': '<+13>-13', 'Etc/GMT-14': '<+14>-14', 'Etc/GMT-2': '<+02>-2', 'Etc/GMT-3': '<+03>-3', 'Etc/GMT-4': '<+04>-4', 'Etc/GMT-5': '<+05>-5', 'Etc/GMT-6': '<+06>-6', 'Etc/GMT-7': '<+07>-7', 'Etc/GMT-8': '<+08>-8', 'Etc/GMT-9': '<+09>-9', 'Europe/Amsterdam': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Andorra': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Astrakhan': '<+04>-4', 'Europe/Athens': 'EET-2EEST,M3.5.0/3,M10.5.0/4', 'Europe/Belgrade': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Berlin': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Bratislava': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Brussels': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Bucharest': 'EET-2EEST,M3.5.0/3,M10.5.0/4', 'Europe/Budapest': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Busingen': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Chisinau': 'EET-2EEST,M3.5.0/3,M10.5.0/4', 'Europe/Copenhagen': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Dublin': 'IST-1GMT0,M10.5.0,M3.5.0/1', 'Europe/Gibraltar': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Guernsey': 'GMT0BST,M3.5.0/1,M10.5.0', 'Europe/Helsinki': 'EET-2EEST,M3.5.0/3,M10.5.0/4', 'Europe/Isle_of_Man': 'GMT0BST,M3.5.0/1,M10.5.0', 'Europe/Istanbul': '<+03>-3', 'Europe/Jersey': 'GMT0BST,M3.5.0/1,M10.5.0', 'Europe/Kaliningrad': 'EET-2', 'Europe/Kirov': 'MSK-3', 'Europe/Kyiv': 'EET-2EEST,M3.5.0/3,M10.5.0/4', 'Europe/Lisbon': 'WET0WEST,M3.5.0/1,M10.5.0', 'Europe/Ljubljana': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/London': 'GMT0BST,M3.5.0/1,M10.5.0', 'Europe/Luxembourg': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Madrid': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Malta': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Mariehamn': 'EET-2EEST,M3.5.0/3,M10.5.0/4', 'Europe/Minsk': '<+03>-3', 'Europe/Monaco': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Moscow': 'MSK-3', 'Europe/Oslo': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Paris': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Podgorica': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Prague': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Riga': 'EET-2EEST,M3.5.0/3,M10.5.0/4', 'Europe/Rome': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Samara': '<+04>-4', 'Europe/San_Marino': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Sarajevo': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Saratov': '<+04>-4', 'Europe/Simferopol': 'MSK-3', 'Europe/Skopje': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Sofia': 'EET-2EEST,M3.5.0/3,M10.5.0/4', 'Europe/Stockholm': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Tallinn': 'EET-2EEST,M3.5.0/3,M10.5.0/4', 'Europe/Tirane': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Ulyanovsk': '<+04>-4', 'Europe/Vaduz': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Vatican': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Vienna': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Vilnius': 'EET-2EEST,M3.5.0/3,M10.5.0/4', 'Europe/Volgograd': 'MSK-3', 'Europe/Warsaw': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Zagreb': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Europe/Zurich': 'CET-1CEST,M3.5.0,M10.5.0/3', 'Indian/Antananarivo': 'EAT-3', 'Indian/Chagos': '<+06>-6', 'Indian/Christmas': '<+07>-7', 'Indian/Cocos': '<+0630>-6:30', 'Indian/Comoro': 'EAT-3', 'Indian/Kerguelen': '<+05>-5', 'Indian/Mahe': '<+04>-4', 'Indian/Maldives': '<+05>-5', 'Indian/Mauritius': '<+04>-4', 'Indian/Mayotte': 'EAT-3', 'Indian/Reunion': '<+04>-4', 'Pacific/Apia': '<+13>-13', 'Pacific/Auckland': 'NZST-12NZDT,M9.5.0,M4.1.0/3', 'Pacific/Bougainville': '<+11>-11', 'Pacific/Chatham': '<+1245>-12:45<+1345>,M9.5.0/2:45,M4.1.0/3:45', 'Pacific/Chuuk': '<+10>-10', 'Pacific/Easter': '<-06>6<-05>,M9.1.6/22,M4.1.6/22', 'Pacific/Efate': '<+11>-11', 'Pacific/Fakaofo': '<+13>-13', 'Pacific/Fiji': '<+12>-12', 'Pacific/Funafuti': '<+12>-12', 'Pacific/Galapagos': '<-06>6', 'Pacific/Gambier': '<-09>9', 'Pacific/Guadalcanal': '<+11>-11', 'Pacific/Guam': 'ChST-10', 'Pacific/Honolulu': 'HST10', 'Pacific/Kanton': '<+13>-13', 'Pacific/Kiritimati': '<+14>-14', 'Pacific/Kosrae': '<+11>-11', 'Pacific/Kwajalein': '<+12>-12', 'Pacific/Majuro': '<+12>-12', 'Pacific/Marquesas': '<-0930>9:30', 'Pacific/Midway': 'SST11', 'Pacific/Nauru': '<+12>-12', 'Pacific/Niue': '<-11>11', 'Pacific/Norfolk': '<+11>-11<+12>,M10.1.0,M4.1.0/3', 'Pacific/Noumea': '<+11>-11', 'Pacific/Pago_Pago': 'SST11', 'Pacific/Palau': '<+09>-9', 'Pacific/Pitcairn': '<-08>8', 'Pacific/Pohnpei': '<+11>-11', 'Pacific/Port_Moresby': '<+10>-10', 'Pacific/Rarotonga': '<-10>10', 'Pacific/Saipan': 'ChST-10', 'Pacific/Tahiti': '<-10>10', 'Pacific/Tarawa': '<+12>-12', 'Pacific/Tongatapu': '<+13>-13', 'Pacific/Wake': '<+12>-12', 'Pacific/Wallis': '<+12>-12', }; 07070101AE23D4000081A40000000000000000000000016A426C2800000D73000000FE0000000000000000000000000000001C00000000usr/share/ucode/luci/sys.uc// Copyright 2022 Jo-Philipp Wich // Licensed to the public under the Apache License 2.0. import { basename, readlink, readfile, open, popen, stat, glob } from 'fs'; export function process_list() { const top = popen('/bin/busybox top -bn1'); let line, list = []; for (let line = top.read('line'); length(line); line = top.read('line')) { let m = match(trim(line), /^([0-9]+) +([0-9]+) +(.+) +([RSDZTWI][ { const s = stat(path); return s?.type == 'file' && s?.perm?.user_exec; }), basename); }; export function init_index(name) { const src = readfile(`/etc/init.d/${basename(name)}`, 2048); const idx = []; for (let m in match(src, /^[[:space:]]*(START|STOP)=('[0-9][0-9]'|"[0-9][0-9]"|[0-9][0-9])[[:space:]]*$/gs)) { switch (m[1]) { case 'START': idx[0] = +trim(m[2], '"\''); break; case 'STOP': idx[1] = +trim(m[2], '"\''); break; } } return length(idx) ? idx : null; }; export function init_enabled(name) { for (let path in glob(`/etc/rc.d/[SK][0-9][0-9]${basename(name)}`)) { const ln = readlink(path); const s1 = stat(index(ln, '/') == 0 ? ln : `/etc/rc.d/${ln}`); const s2 = stat(`/etc/init.d/${basename(name)}`); if (s1?.inode == s2?.inode && s1?.type == 'file' && s1?.perm?.user_exec) return true; } return false; }; export function init_action(name, action) { const s = stat(`/etc/init.d/${basename(name)}`); if (s?.type != 'file' || s?.user_exec == false) return false; return system(`env -i /etc/init.d/${basename(name)} ${action} >/dev/null`); }; 07070101AE23D2000081A40000000000000000000000016A426C2800003392000000FE0000000000000000000000000000001D00000000usr/share/ucode/luci/http.uc// Copyright 2022 Jo-Philipp Wich // Licensed to the public under the Apache License 2.0. import { urlencode as _urlencode, urldecode as _urldecode, urlencoded_parser, multipart_parser, header_attribute, ENCODE_IF_NEEDED, ENCODE_FULL, DECODE_IF_NEEDED, DECODE_PLUS } from 'lucihttp'; import { error as fserror, stdin, stdout, mkstemp } from 'fs'; // luci.http module scope export let HTTP_MAX_CONTENT = 1024*100; // 100 kB maximum content size // Decode a mime encoded http message body with multipart/form-data // Content-Type. Stores all extracted data associated with its parameter name // in the params table within the given message object. Multiple parameter // values are stored as tables, ordinary ones as strings. // If an optional file callback function is given then it is fed with the // file contents chunk by chunk and only the extracted file name is stored // within the params table. The callback function will be called subsequently // with three arguments: // o Table containing decoded (name, file) and raw (headers) mime header data // o String value containing a chunk of the file data // o Boolean which indicates whether the current chunk is the last one (eof) export function mimedecode_message_body(src, msg, file_cb) { let len = 0, maxlen = +msg.env.CONTENT_LENGTH; let err, header, field, parser; parser = multipart_parser(msg.env.CONTENT_TYPE, function(what, buffer, length) { if (what == parser.PART_INIT) { field = {}; } else if (what == parser.HEADER_NAME) { header = lc(buffer); } else if (what == parser.HEADER_VALUE && header) { if (lc(header) == 'content-disposition' && header_attribute(buffer, null) == 'form-data') { field.name = header_attribute(buffer, 'name'); field.file = header_attribute(buffer, 'filename'); field[1] = field.file; } field.headers = field.headers || {}; field.headers[header] = buffer; } else if (what == parser.PART_BEGIN) { return !field.file; } else if (what == parser.PART_DATA && field.name && length > 0) { if (field.file) { if (file_cb) { file_cb(field, buffer, false); msg.params[field.name] = msg.params[field.name] || field; } else { if (!field.fd) field.fd = mkstemp(field.name); if (field.fd) { field.fd.write(buffer); msg.params[field.name] = msg.params[field.name] || field; } } } else { field.value = buffer; } } else if (what == parser.PART_END && field.name) { if (field.file && msg.params[field.name]) { if (file_cb) file_cb(field, '', true); else if (field.fd) field.fd.seek(0); } else { let val = msg.params[field.name]; if (type(val) == 'array') push(val, field.value || ''); else if (val != null) msg.params[field.name] = [ val, field.value || '' ]; else msg.params[field.name] = field.value || ''; } field = null; } else if (what == parser.ERROR) { err = buffer; } return true; }, HTTP_MAX_CONTENT); while (true) { let chunk = src(); len += length(chunk); if (maxlen && len > maxlen + 2) die('Message body size exceeds Content-Length'); if (!parser.parse(chunk)) die(err); if (chunk == null) break; } }; // Decode an urlencoded http message body with application/x-www-urlencoded // Content-Type. Stores all extracted data associated with its parameter name // in the params table within the given message object. Multiple parameter // values are stored as tables, ordinary ones as strings. export function urldecode_message_body(src, msg) { let len = 0, maxlen = +msg.env.CONTENT_LENGTH; let err, name, value, parser; parser = urlencoded_parser(function (what, buffer, length) { if (what == parser.TUPLE) { name = null; value = null; } else if (what == parser.NAME) { name = _urldecode(buffer, DECODE_PLUS); } else if (what == parser.VALUE && name) { let val = msg.params[name]; if (type(val) == 'array') push(val, _urldecode(buffer, DECODE_PLUS) || ''); else if (val != null) msg.params[name] = [ val, _urldecode(buffer, DECODE_PLUS) || '' ]; else msg.params[name] = _urldecode(buffer, DECODE_PLUS) || ''; } else if (what == parser.ERROR) { err = buffer; } return true; }, HTTP_MAX_CONTENT); while (true) { let chunk = src(); len += length(chunk); if (maxlen && len > maxlen + 2) die('Message body size exceeds Content-Length'); if (!parser.parse(chunk)) die(err); if (chunk == null) break; } }; // This function will examine the Content-Type within the given message object // to select the appropriate content decoder. // Currently the application/x-www-urlencoded and application/form-data // mime types are supported. If the encountered content encoding can't be // handled then the whole message body will be stored unaltered as 'content' // property within the given message object. export function parse_message_body(src, msg, filecb) { if (msg.env.CONTENT_LENGTH || msg.env.REQUEST_METHOD == 'POST') { let ctype = header_attribute(msg.env.CONTENT_TYPE, null); // Is it multipart/mime ? if (ctype == 'multipart/form-data') return mimedecode_message_body(src, msg, filecb); // Is it application/x-www-form-urlencoded ? else if (ctype == 'application/x-www-form-urlencoded') return urldecode_message_body(src, msg); // Unhandled encoding // If a file callback is given then feed it chunk by chunk, else // store whole buffer in message.content let sink; // If we have a file callback then feed it if (type(filecb) == 'function') { let meta = { name: 'raw', encoding: msg.env.CONTENT_TYPE }; sink = (chunk) => { if (chunk != null) return filecb(meta, chunk, false); else return filecb(meta, null, true); }; } // ... else append to .content else { let chunks = [], len = 0; sink = (chunk) => { len += length(chunk); if (len > HTTP_MAX_CONTENT) die('POST data exceeds maximum allowed length'); if (chunk != null) { push(chunks, chunk); } else { msg.content = join('', chunks); msg.content_length = len; } }; } // Pump data... while (true) { let chunk = src(); sink(chunk); if (chunk == null) break; } return true; } return false; }; export function build_querystring(q) { let s = []; for (let k, v in q) { push(s, length(s) ? '&' : '?', _urlencode(k, ENCODE_IF_NEEDED | ENCODE_FULL) || k, '=', _urlencode(v, ENCODE_IF_NEEDED | ENCODE_FULL) || v ); } return join('', s); }; export function urlencode(value) { if (value == null) return null; value = '' + value; return _urlencode(value, ENCODE_IF_NEEDED | ENCODE_FULL) || value; }; export function urldecode(value, decode_plus) { if (value == null) return null; value = '' + value; return _urldecode(value, DECODE_IF_NEEDED | (decode_plus ? DECODE_PLUS : 0)) || value; }; // Extract and split urlencoded data pairs, separated bei either "&" or ";" // from given url or string. Returns a table with urldecoded values. // Simple parameters are stored as string values associated with the parameter // name within the table. Parameters with multiple values are stored as array // containing the corresponding values. export function urldecode_params(url, tbl) { let parser, name, value; let params = tbl || {}; parser = urlencoded_parser(function(what, buffer, length) { if (what == parser.TUPLE) { name = null; value = null; } else if (what == parser.NAME) { name = _urldecode(buffer); } else if (what == parser.VALUE && name) { params[name] = _urldecode(buffer) || ''; } return true; }); if (parser) { let m = match(('' + (url || '')), /[^?]*$/); parser.parse(m ? m[0] : ''); parser.parse(null); } return params; }; // Encode each key-value-pair in given table to x-www-urlencoded format, // separated by '&'. Tables are encoded as parameters with multiple values by // repeating the parameter name with each value. export function urlencode_params(tbl) { let enc = []; for (let k, v in tbl) { if (type(v) == 'array') { for (let v2 in v) { if (length(enc)) push(enc, '&'); push(enc, _urlencode(k), '=', _urlencode('' + v2)); } } else { if (length(enc)) push(enc, '&'); push(enc, _urlencode(k), '=', _urlencode('' + v)); } } return join(enc, ''); }; // Default IO routines suitable for CGI invocation let avail_len = +getenv('CONTENT_LENGTH'); const default_source = () => { let rlen = min(avail_len, 4096); if (rlen == 0) { stdin.close(); return null; } let chunk = stdin.read(rlen); if (chunk == null) die(`Input read error: ${fserror()}`); avail_len -= length(chunk); return chunk; }; const default_sink = (...chunks) => { for (let chunk in chunks) stdout.write(chunk); stdout.flush(); }; const Class = { formvalue: function(name, noparse) { if (!noparse && !this.parsed_input) this._parse_input(); if (name != null) return this.message.params[name]; else return this.message.params; }, formvaluetable: function(prefix) { let vals = {}; prefix = (prefix || '') + '.'; if (!this.parsed_input) this._parse_input(); for (let k, v in this.message.params) if (index(k, prefix) == 0) vals[substr(k, length(prefix))] = '' + v; return vals; }, content: function() { if (!this.parsed_input) this._parse_input(); return this.message.content; }, getcookie: function(name) { return header_attribute(`cookie; ${this.getenv('HTTP_COOKIE') ?? ''}`, name); }, getenv: function(name) { if (name != null) return this.message.env[name]; else return this.message.env; }, setfilehandler: function(callback) { if (type(callback) == 'resource' && type(callback.call) == 'function') this.filehandler = (...args) => callback.call(...args); else if (type(callback) == 'function') this.filehandler = callback; else die('Invalid callback argument for setfilehandler()'); if (!this.parsed_input) return; // If input has already been parsed then uploads are stored as unlinked // temporary files pointed to by open file handles in the parameter // value table. Loop all params, and invoke the file callback for any // param with an open file handle. for (let name, value in this.message.params) { while (value?.fd) { let data = value.fd.read(1024); let eof = (length(data) == 0); this.filehandler(value, data, eof); if (eof) { value.fd.close(); value.fd = null; } } } }, _parse_input: function() { parse_message_body( this.input, this.message, this.filehandler ); this.parsed_input = true; }, close: function() { this.write_headers(); this.closed = true; }, header: function(key, value) { this.headers ??= {}; this.headers[lc(key)] = value; }, prepare_content: function(mime) { if (!this.headers?.['content-type']) { if (mime == 'application/xhtml+xml') { if (index(this.getenv('HTTP_ACCEPT'), mime) == -1) { mime = 'text/html; charset=UTF-8'; this.header('Vary', 'Accept'); } } this.header('Content-Type', mime); } }, status: function(code, message) { this.status_code = code ?? 200; this.status_message = message ?? 'OK'; }, write_headers: function() { if (this.eoh) return; if (!this.status_code) this.status(); if (!this.headers?.['content-type']) this.header('Content-Type', 'text/html; charset=UTF-8'); if (!this.headers?.['cache-control']) { this.header('Cache-Control', 'no-cache'); this.header('Expires', '0'); } if (!this.headers?.['x-frame-options']) this.header('X-Frame-Options', 'SAMEORIGIN'); if (!this.headers?.['x-xss-protection']) this.header('X-XSS-Protection', '1; mode=block'); if (!this.headers?.['x-content-type-options']) this.header('X-Content-Type-Options', 'nosniff'); this.output('Status: '); this.output(this.status_code); this.output(' '); this.output(this.status_message); this.output('\r\n'); for (let k, v in this.headers) { this.output(k); this.output(': '); this.output(v); this.output('\r\n'); } this.output('\r\n'); this.eoh = true; }, // If the content chunk is nil this function will automatically invoke close. write: function(content) { if (content != null && !this.closed) { this.write_headers(); this.output(content); return true; } else { this.close(); } }, redirect: function(url) { this.status(302, 'Found'); this.header('Location', url ?? '/'); this.close(); }, write_json: function(value) { this.write(sprintf('%.J', value)); }, urlencode, urlencode_params, urldecode, urldecode_params, build_querystring }; export default function(env, sourcein, sinkout) { return proto({ input: sourcein ?? default_source, output: sinkout ?? default_sink, // File handler nil by default to let .content() work file: null, // HTTP-Message table message: { env, headers: {}, params: urldecode_params(env?.QUERY_STRING ?? '') }, parsed_input: false }, Class); }; 07070101AE23D8000041ED0000000000000000000000036A426C2800000000000000FE0000000000000000000000000000002000000000usr/share/ucode/luci/controller07070101AE23D9000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000002600000000usr/share/ucode/luci/controller/admin07070101AE23DB000081A40000000000000000000000016A426C2800000CE8000000FE0000000000000000000000000000002D00000000usr/share/ucode/luci/controller/admin/uci.uc// Copyright 2022 Jo-Philipp Wich // Licensed to the public under the Apache License 2.0. import { STATUS_NO_DATA, STATUS_PERMISSION_DENIED } from 'ubus'; let last_ubus_error; const ubus_error_map = [ 200, 'OK', 400, 'Invalid command', 400, 'Invalid argument', 404, 'Method not found', 404, 'Not found', 204, 'No data', 403, 'Permission denied', 504, 'Timeout', 500, 'Not supported', 500, 'Unknown error', 503, 'Connection failed', 500, 'Out of memory', 400, 'Parse error', 500, 'System error', ]; function ubus_call(object, method, args) { ubus.error(); // clear previous error let res = ubus.call(object, method, args); last_ubus_error = ubus.error(true); return res ?? !last_ubus_error; } function ubus_state_to_http(err) { let code = ubus_error_map[(err << 1) + 0] ?? 200; let msg = ubus_error_map[(err << 1) + 1] ?? 'OK'; http.status(code, msg); if (code != 204) { http.prepare_content('text/plain'); http.write(msg); } } function uci_apply(rollback) { if (rollback) { const timeout = +(config?.apply?.rollback ?? 90) || 0; const success = ubus_call('uci', 'apply', { ubus_rpc_session: ctx.authsession, timeout: max(timeout, 90), rollback: true }); if (success) { const token = dispatcher.randomid(16); ubus.call('session', 'set', { ubus_rpc_session: '00000000000000000000000000000000', values: { rollback: { token, session: ctx.authsession, timeout: time() + timeout } } }); return token; } return null; } else { let changes = ubus_call('uci', 'changes', { ubus_rpc_session: ctx.authsession })?.changes; for (let config in changes) if (!ubus_call('uci', 'commit', { ubus_rpc_session: ctx.authsession, config })) return false; return ubus_call('uci', 'apply', { ubus_rpc_session: ctx.authsession, rollback: false }); } } function uci_confirm(token) { const data = ubus.call('session', 'get', { ubus_rpc_session: '00000000000000000000000000000000', keys: [ 'rollback' ] })?.values?.rollback; if (type(data?.token) != 'string' || type(data?.session) != 'string' || type(data?.timeout) != 'int' || data.timeout < time()) { last_ubus_error = STATUS_NO_DATA; return false; } if (token != data.token) { last_ubus_error = STATUS_PERMISSION_DENIED; return false; } if (!ubus_call('uci', 'confirm', { ubus_rpc_session: data.session })) return false; ubus_call('session', 'set', { ubus_rpc_session: '00000000000000000000000000000000', values: { rollback: {} } }); return true; } return { action_apply_rollback: function() { const token = uci_apply(true); if (token) { http.prepare_content('application/json; charset=UTF-8'); http.write_json({ token }); } else { ubus_state_to_http(last_ubus_error); } }, action_apply_unchecked: function() { uci_apply(false); ubus_state_to_http(last_ubus_error); }, action_confirm: function() { uci_confirm(http.formvalue('token')); ubus_state_to_http(last_ubus_error); }, action_revert: function() { for (let config in ubus_call('uci', 'changes', { ubus_rpc_session: ctx.authsession })?.changes) if (!ubus_call('uci', 'revert', { ubus_rpc_session: ctx.authsession, config })) break; ubus_state_to_http(last_ubus_error); } }; 07070101AE23DA000081A40000000000000000000000016A426C2800000FC1000000FE0000000000000000000000000000002F00000000usr/share/ucode/luci/controller/admin/index.uc// Copyright 2022 Jo-Philipp Wich // Licensed to the public under the Apache License 2.0. import { load_catalog, change_catalog, get_translations } from 'luci.core'; const ubus_types = [ null, 'array', 'object', 'string', null, // INT64 'number', null, // INT16, 'boolean', 'double' ]; function ubus_reply(id, data, code, errmsg) { const reply = { jsonrpc: '2.0', id }; if (errmsg) reply.error = { code, message: errmsg }; else if (type(code) == 'object') reply.result = code; else if (data != null) reply.result = [ code, data ]; else reply.result = [ code ]; return reply; } function ubus_access(sid, obj, fun) { return (ubus.call('session', 'access', { ubus_rpc_session: sid, scope: 'ubus', object: obj, function: fun })?.access == true); } function ubus_request(req) { if (type(req?.method) != 'string' || req?.jsonrpc != '2.0' || req?.id == null) return ubus_reply(null, null, -32600, 'Invalid request'); if (req.method == 'call') { if (type(req?.params) != 'array' || length(req.params) < 3) return ubus_reply(null, null, -32600, 'Invalid parameters'); let sid = req.params[0], obj = req.params[1], fun = req.params[2], arg = req.params[3] ?? {}; if (type(arg) != 'object' || exists(arg, 'ubus_rpc_session')) return ubus_reply(req.id, null, -32602, 'Invalid parameters'); if (sid == '00000000000000000000000000000000' && ctx.authsession) sid = ctx.authsession; if (!ubus_access(sid, obj, fun)) return ubus_reply(req.id, null, -32002, 'Access denied'); arg.ubus_rpc_session = sid; // clear error ubus.error(); const res = ubus.call(obj, fun, arg); return ubus_reply(req.id, res, ubus.error(true) ?? 0); } if (req.method == 'list') { if (req?.params == null || (type(req.params) == 'array' && length(req.params) == 0)) { return ubus_reply(req.id, null, ubus.list()); } else if (type(req.params) == 'array') { const rv = {}; for (let param in req.params) { if (type(param) != 'string') return ubus_reply(req.id, null, -32602, 'Invalid parameters'); for (let m, p in ubus.list(param)?.[0]) { for (let pn, pt in p) { rv[param] ??= {}; rv[param][m] ??= {}; rv[param][m][pn] = ubus_types[pt] ?? 'unknown'; } } } return ubus_reply(req.id, null, rv); } else { return ubus_reply(req.id, null, -32602, 'Invalid parameters') } } return ubus_reply(req.id, null, -32601, 'Method not found') } return { action_ubus: function() { let request; try { request = json(http.content()); } catch { request = null; } http.prepare_content('application/json; charset=UTF-8'); if (type(request) == 'object') http.write_json(ubus_request(request)); else if (type(request) == 'array') http.write_json(map(request, ubus_request)); else http.write_json(ubus_reply(null, null, -32700, 'Parse error')) }, action_translations: function(reqlang) { if (reqlang != null && reqlang != dispatcher.lang) { load_catalog(reqlang, '/usr/lib/lua/luci/i18n'); change_catalog(reqlang); } http.prepare_content('application/javascript; charset=UTF-8'); http.write('window.TR={'); get_translations((key, val) => http.write(sprintf('"%08x":%J,', key, val))); http.write('};'); }, action_logout: function() { const url = dispatcher.build_url(); if (ctx.authsession) { ubus.call('session', 'destroy', { ubus_rpc_session: ctx.authsession }); if (http.getenv('HTTPS') == 'on') http.header('Set-Cookie', `sysauth_https=; expires=Thu, 01 Jan 1970 01:00:00 GMT; path=${url}`); else http.header('Set-Cookie', `sysauth_http=; expires=Thu, 01 Jan 1970 01:00:00 GMT; path=${url}`); } http.redirect(url); }, action_menu: function() { const session = dispatcher.is_authenticated({ methods: [ 'cookie:sysauth_https', 'cookie:sysauth_http' ] }); const menu = dispatcher.menu_json(session?.acls ?? {}) ?? {}; http.prepare_content('application/json; charset=UTF-8'); http.write_json(menu); } }; 07070101AE23D1000081A40000000000000000000000016A426C2800005A0A000000FE0000000000000000000000000000002300000000usr/share/ucode/luci/dispatcher.uc// Copyright 2022 Jo-Philipp Wich // Licensed to the public under the Apache License 2.0. import { open, stat, glob, lsdir, unlink, basename } from 'fs'; import { striptags, entityencode } from 'html'; import { connect } from 'ubus'; import { cursor } from 'uci'; import { rand } from 'math'; import { openlog, syslog, closelog, LOG_INFO, LOG_WARNING, LOG_AUTHPRIV } from 'log'; import { hash, load_catalog, change_catalog, translate, ntranslate, getuid } from 'luci.core'; import { revision as luciversion, branch as luciname } from 'luci.version'; import { default as LuCIRuntime } from 'luci.runtime'; import { urldecode } from 'luci.http'; let ubus = connect(); let uci = cursor(); let indexcache = "/tmp/luci-indexcache"; let http, runtime, tree, luabridge; function error404(msg) { http.status(404, 'Not Found'); try { runtime.render('error404', { message: msg ?? 'Not found' }); } catch { http.header('Content-Type', 'text/plain; charset=UTF-8'); http.write(msg ?? 'Not found'); } return false; } function error500(msg, ex) { if (!http.eoh) { http.status(500, 'Internal Server Error'); http.header('Content-Type', 'text/html; charset=UTF-8'); } try { runtime.render('error500', { title: ex?.type ?? 'Runtime exception', message: replace( msg, /(\s)((\/[A-Za-z0-9_.-]+)+:\d+|\[string "[^"]+"\]:\d+)/g, '$1$2' ), exception: ex }); } catch { http.write('\n'); http.write(`

${trim(msg)}

\n`); if (ex) { http.write(`

${trim(ex.message)}

\n`); http.write(`
${trim(ex.stacktrace[0].context)}
\n`); } } exit(0); } function load_luabridge(optional) { if (luabridge == null) { try { luabridge = require('lua'); } catch (ex) { luabridge = false; if (!optional) error500('No Lua runtime installed'); } } return luabridge; } function determine_request_language() { let lang = uci.get('luci', 'main', 'lang') || 'auto'; if (lang == 'auto') { for (let tag in split(http.getenv('HTTP_ACCEPT_LANGUAGE'), ',')) { tag = split(trim(split(tag, ';')?.[0]), '-'); if (tag) { let cc = tag[1] ? `${tag[0]}_${lc(tag[1])}` : null; if (cc && uci.get('luci', 'languages', cc)) { lang = cc; break; } else if (uci.get('luci', 'languages', tag[0])) { lang = tag[0]; break; } } } } if (lang == 'auto') lang = 'en'; else lang = replace(lang, '_', '-'); if (load_catalog(lang, '/usr/lib/lua/luci/i18n')) change_catalog(lang); return lang; } function determine_version() { let res = { luciname, luciversion }; for (let f = open("/etc/os-release"), l = f?.read?.("line"); l; l = f.read?.("line")) { let kv = split(l, '=', 2); switch (kv[0]) { case 'NAME': res.distname = trim(kv[1], '"\' \n'); break; case 'VERSION': res.distversion = trim(kv[1], '"\' \n'); break; case 'HOME_URL': res.disturl = trim(kv[1], '"\' \n'); break; case 'BUILD_ID': res.distrevision = trim(kv[1], '"\' \n'); break; } } return res; } function read_jsonfile(path, defval) { let rv; try { rv = json(open(path, "r")); } catch (e) { rv = defval; } return rv; } function read_cachefile(file, reader) { let euid = getuid(), fstat = stat(file), fuid = fstat?.uid, perm = fstat?.perm; if (euid != fuid || perm?.group_read || perm?.group_write || perm?.group_exec || perm?.other_read || perm?.other_write || perm?.other_exec) return null; return reader(file); } function check_fs_depends(spec) { for (let path, kind in spec) { if (kind == 'directory') { if (!length(lsdir(path))) return false; } else if (kind == 'executable') { let fstat = stat(path); if (fstat?.type != 'file' || fstat?.user_exec == false) return false; } else if (kind == 'file') { let fstat = stat(path); if (fstat?.type != 'file') return false; } else if (kind == 'absent') { if (stat(path) != null) return false; } } return true; } function check_uci_depends_options(conf, s, opts) { if (type(opts) == 'string') { return (s['.type'] == opts); } else if (opts === true) { for (let option, value in s) if (ord(option) != 46) return true; } else if (type(opts) == 'object') { for (let option, value in opts) { let sval = s[option]; if (type(sval) == 'array') { if (!(value in sval)) return false; } else if (value === true) { if (sval == null) return false; } else { if (sval != value) return false; } } } return true; } function check_uci_depends_section(conf, sect) { for (let section, options in sect) { let stype = match(section, /^@([A-Za-z0-9_-]+)$/); if (stype) { let found = false; uci.load(conf); uci.foreach(conf, stype[1], (s) => { if (check_uci_depends_options(conf, s, options)) { found = true; return false; } }); if (!found) return false; } else { let s = uci.get_all(conf, section); if (!s || !check_uci_depends_options(conf, s, options)) return false; } } return true; } function check_uci_depends(conf) { for (let config, values in conf) { if (values == true) { let found = false; uci.load(config); uci.foreach(config, null, () => { found = true }); if (!found) return false; } else if (type(values) == 'object') { if (!check_uci_depends_section(config, values)) return false; } } return true; } function check_depends(spec) { if (type(spec?.depends?.fs) in ['array', 'object']) { let satisfied = false; let alternatives = (type(spec.depends.fs) == 'array') ? spec.depends.fs : [ spec.depends.fs ]; for (let alternative in alternatives) { if (check_fs_depends(alternative)) { satisfied = true; break; } } if (!satisfied) return false; } if (type(spec?.depends?.uci) in ['array', 'object']) { let satisfied = false; let alternatives = (type(spec.depends.uci) == 'array') ? spec.depends.uci : [ spec.depends.uci ]; for (let alternative in alternatives) { if (check_uci_depends(alternative)) { satisfied = true; break; } } if (!satisfied) return false; } return true; } function check_acl_depends(require_groups, groups) { if (length(require_groups)) { let writable = false; for (let group in require_groups) { let read = ('read' in groups?.[group]); let write = ('write' in groups?.[group]); if (!read && !write) return null; if (write) writable = true; } return writable; } return true; } function hash_filelist(files) { let hashval = 0x1b756362; for (let file in files) { let st = stat(file); if (st) hashval = hash(sprintf("%x|%x|%x", st.ino, st.mtime, st.size), hashval); } return hashval; } function build_pagetree() { let tree = { action: { type: 'firstchild' } }; let schema = { action: 'object', auth: 'object', cors: 'bool', depends: 'object', order: 'int', setgroup: 'string', setuser: 'string', title: 'string', wildcard: 'bool', firstchild_ineligible: 'bool' }; let files = glob('/usr/share/luci/menu.d/*.json', '/usr/lib/lua/luci/controller/*.lua', '/usr/lib/lua/luci/controller/*/*.lua'); let cachefile; if (indexcache) { cachefile = sprintf('%s.%08x.json', indexcache, hash_filelist(files)); let res = read_cachefile(cachefile, read_jsonfile); if (res) return res; for (let path in glob(indexcache + '.*.json')) unlink(path); } for (let file in files) { let data; if (substr(file, -5) == '.json') data = read_jsonfile(file); else if (load_luabridge(true)) data = runtime.call('luci.dispatcher', 'process_lua_controller', file); else warn(`Lua controller ${file} present but no Lua runtime installed.\n`); if (type(data) == 'object') { for (let path, spec in data) { if (type(spec) == 'object') { let node = tree; let has_wildcard = false; for (let s in match(path, /[^\/]+/g)) { if (s[0] == '*') { node.wildcard = true; has_wildcard = true; break; } node.children ??= {}; node.children[s[0]] ??= { satisfied: true }; node = node.children[s[0]]; } if (node !== tree) { for (let k, t in schema) if (type(spec[k]) == t) node[k] = spec[k]; /* Preserve distinct actions for wildcard vs. base path */ if (has_wildcard && type(spec.action) == 'object') node.wildcardaction = spec.action; else if (type(spec.action) == 'object') node.action = spec.action; node.satisfied = check_depends(spec); } } } } } if (cachefile) { let fd = open(cachefile, 'w', 0600); if (fd) { fd.write(tree); fd.close(); } } return tree; } function apply_tree_acls(node, acl) { for (let name, spec in node?.children) apply_tree_acls(spec, acl); if (node?.depends?.acl) { switch (check_acl_depends(node.depends.acl, acl["access-group"])) { case null: node.satisfied = false; break; case false: node.readonly = true; break; } } } function menu_json(acl) { tree ??= build_pagetree(); if (acl) apply_tree_acls(tree, acl); return tree; } function ctx_append(ctx, name, node) { ctx.path ??= []; push(ctx.path, name); ctx.acls ??= []; push(ctx.acls, ...(node?.depends?.acl || [])); ctx.auth = node.auth || ctx.auth; ctx.cors = node.cors || ctx.cors; ctx.suid = node.setuser || ctx.suid; ctx.sgid = node.setgroup || ctx.sgid; return ctx; } function session_retrieve(sid, allowed_users) { let sdat = ubus.call("session", "get", { ubus_rpc_session: sid }); let sacl = ubus.call("session", "access", { ubus_rpc_session: sid }); if (type(sdat?.values?.token) == 'string' && (!length(allowed_users) || sdat?.values?.username in allowed_users)) { // uci:set_session_id(sid) return { sid, data: sdat.values, acls: length(sacl) ? sacl : {} }; } return null; } function randomid(num_bytes) { let bytes = []; while (num_bytes-- > 0) push(bytes, sprintf('%02x', rand() % 256)); return join('', bytes); } function session_setup(user, pass, path) { let timeout = uci.get('luci', 'sauth', 'sessiontime'); let login = ubus.call("session", "login", { username: user, password: pass, timeout: timeout ? +timeout : null }); openlog('dispatcher.uc'); if (type(login?.ubus_rpc_session) == 'string') { ubus.call("session", "set", { ubus_rpc_session: login.ubus_rpc_session, values: { token: randomid(16) } }); syslog(LOG_INFO|LOG_AUTHPRIV, sprintf("luci: accepted login on /%s for %s from %s", join('/', path), user || "?", http.getenv("REMOTE_ADDR") || "?")); return session_retrieve(login.ubus_rpc_session); } syslog(LOG_WARNING|LOG_AUTHPRIV, sprintf("luci: failed login on /%s for %s from %s", join('/', path), user || "?", http.getenv("REMOTE_ADDR") || "?")); closelog(); } function check_authentication(method) { let m = match(method, /^([[:alpha:]]+):(.+)$/); let sid; switch (m?.[1]) { case 'cookie': sid = http.getcookie(m[2]); break; case 'param': sid = http.formvalue(m[2]); break; case 'query': sid = http.formvalue(m[2], true); break; } return sid ? session_retrieve(sid) : null; } function is_authenticated(auth) { for (let method in auth?.methods) { let session = check_authentication(method); if (session) return session; } return null; } function node_weight(node) { let weight = min(node.order ?? 9999, 9999); if (node.auth?.login) weight += 10000; return weight; } function clone(src) { switch (type(src)) { case 'array': return map(src, clone); case 'object': let dest = {}; for (let k, v in src) dest[k] = clone(v); return dest; default: return src; } } function resolve_firstchild(node, session, login_allowed, ctx) { let candidate, candidate_ctx; for (let name, child in node.children) { if (!child.satisfied) continue; if (!session) session = is_authenticated(node.auth); let cacl = child.depends?.acl; let login = !session && (login_allowed || child.auth?.login); if (login || check_acl_depends(cacl, session?.acls?.["access-group"]) != null) { if (child.title && type(child.action) == "object") { let child_ctx = ctx_append(clone(ctx), name, child); if (child.action.type == "firstchild") { if (!candidate || node_weight(candidate) > node_weight(child)) { let have_grandchild = resolve_firstchild(child, session, login, child_ctx); if (have_grandchild) { candidate = child; candidate_ctx = child_ctx; } } } else if (!child.firstchild_ineligible) { if (!candidate || node_weight(candidate) > node_weight(child)) { candidate = child; candidate_ctx = child_ctx; } } } } } if (!candidate) return false; for (let k, v in candidate_ctx) ctx[k] = v; return true; } function resolve_page(tree, request_path) { let node = tree; let login = false; let session = null; let ctx = {}; for (let i, s in request_path) { node = node.children?.[s]; if (!node?.satisfied) break; ctx_append(ctx, s, node); if (!session) session = is_authenticated(node.auth); if (!login && node.auth?.login) login = true; /* If this node is marked as wildcard, check if the next segment * matches a child node. Only apply wildcard behaviour (capturing * remaining segments as args) if no child matches, allowing * deeper routes like foo/bar/* to work alongside * foo/* */ if (node.wildcard) { let next_segment = request_path[i + 1]; let has_matching_child = next_segment && node.children?.[next_segment]?.satisfied; if (!has_matching_child) { ctx.request_args = []; ctx.request_path = ctx.path ? [ ...ctx.path ] : []; while (++i < length(request_path)) { push(ctx.request_path, request_path[i]); push(ctx.request_args, request_path[i]); } break; } } } if (node?.action?.type == 'firstchild') resolve_firstchild(node, session, login, ctx); ctx.acls ??= {}; ctx.path ??= []; ctx.request_args ??= []; ctx.request_path ??= request_path ? [ ...request_path ] : []; ctx.authsession = session?.sid; ctx.authtoken = session?.data?.token; ctx.authuser = session?.data?.username; ctx.authacl = session?.acls; node = tree; for (let s in ctx.path) { node = node.children[s]; assert(node, "Internal node resolve error"); } return { node, ctx, session }; } function require_post_security(target, args) { if (target?.type == 'arcombine') return require_post_security(length(args) ? target?.targets?.[1] : target?.targets?.[0], args); if (type(target?.post) == 'object') { for (let param_name, required_val in target.post) { let request_val = http.formvalue(param_name); if ((type(required_val) == 'string' && request_val != required_val) || (required_val == true && request_val == null)) return false; } return true; } return (target?.post == true); } function test_post_security(authtoken) { if (http.getenv("REQUEST_METHOD") != "POST") { http.status(405, "Method Not Allowed"); http.header("Allow", "POST"); return false; } if (http.formvalue("token") != authtoken) { http.status(403, "Forbidden"); runtime.render("csrftoken"); return false; } return true; } function build_url(...path) { let url = [ http.getenv('SCRIPT_NAME') ?? '' ]; for (let p in path) if (match(p, /^[A-Za-z0-9_%.\/,;-]+$/)) push(url, '/', p); if (length(url) == 1) push(url, '/'); return join('', url); } function lookup(...segments) { let node = menu_json(); let path = []; for (let segment in segments) for (let name in split(segment, '/')) push(path, name); for (let name in path) { node = node.children[name]; if (!node) return null; if (node.leaf) break; } return { node, url: build_url(...path) }; } function rollback_pending() { const now = time(); const rv = ubus.call('session', 'get', { ubus_rpc_session: '00000000000000000000000000000000', keys: [ 'rollback' ] }); if (type(rv?.values?.rollback?.token) != 'string' || type(rv?.values?.rollback?.session) != 'string' || type(rv?.values?.rollback?.timeout) != 'int' || rv.values.rollback.timeout <= now) return false; return { remaining: rv.values.rollback.timeout - now, session: rv.values.rollback.session, token: rv.values.rollback.token }; } let dispatch; function render_action(fn) { const data = render(fn); http.write_headers(); http.output(data); } function run_action(request_path, lang, tree, resolved, action) { switch ((type(action) == 'object') ? action.type : 'none') { case 'template': if (runtime.is_ucode_template(action.path)) runtime.render(action.path, {}); else render_action(() => { runtime.call('luci.dispatcher', 'render_lua_template', action.path); }); break; case 'view': runtime.render('view', { view: action.path }); break; case 'call': render_action(() => { runtime.call(action.module, action.function, ...(action.parameters ?? []), ...resolved.ctx.request_args ); }); break; case 'function': const mod = require(action.module); assert(type(mod[action.function]) == 'function', `Module '${action.module}' does not export function '${action.function}'`); render_action(() => { call(mod[action.function], mod, runtime.env, ...(action.parameters ?? []), ...resolved.ctx.request_args ); }); break; case 'cbi': render_action(() => { runtime.call('luci.dispatcher', 'invoke_cbi_action', action.path, null, ...resolved.ctx.request_args ); }); break; case 'form': render_action(() => { runtime.call('luci.dispatcher', 'invoke_form_action', action.path, ...resolved.ctx.request_args ); }); break; case 'alias': dispatch(http, [ ...split(action.path, '/'), ...resolved.ctx.request_args ]); break; case 'rewrite': dispatch(http, [ ...splice([ ...request_path ], 0, action.remove), ...split(action.path, '/'), ...resolved.ctx.request_args ]); break; case 'firstchild': if (!length(tree.children)) { error404("No root node was registered, this usually happens if no module was installed.\n" + "Install luci-mod-admin-full and retry. " + "If the module is already installed, try removing the /tmp/luci-indexcache file."); break; } /* fall through */ case 'none': error404(`No page is registered at '/${entityencode(join("/", resolved.ctx.request_path))}'.\n` + "If this url belongs to an extension, make sure it is properly installed.\n" + "If the extension was recently installed, try removing the /tmp/luci-indexcache file."); break; default: error500(`Unhandled action type ${action?.type ?? '?'}`); } } dispatch = function(_http, path) { http = _http; let version = determine_version(); let lang = determine_request_language(); runtime = runtime || LuCIRuntime({ http, ubus, uci, ctx: {}, version, config: { main: uci.get_all('luci', 'main') ?? {}, apply: uci.get_all('luci', 'apply') ?? {} }, dispatcher: { rollback_pending, is_authenticated, load_luabridge, lookup, menu_json, build_url, randomid, error404, error500, lang }, striptags, entityencode, _: (...args) => translate(...args) ?? args[0], N_: (...args) => ntranslate(...args) ?? (args[0] == 1 ? args[1] : args[2]), }); try { let menu = menu_json(); path ??= map(match(http.getenv('PATH_INFO'), /[^\/]+/g), m => urldecode(m[0])); let resolved = resolve_page(menu, path); runtime.env.ctx = resolved.ctx; runtime.env.dispatched = resolved.node; runtime.env.requested ??= resolved.node; if (length(resolved.ctx.auth)) { let session = is_authenticated(resolved.ctx.auth); if (!session && resolved.ctx.auth.login) { let user = http.getenv('HTTP_AUTH_USER'); let pass = http.getenv('HTTP_AUTH_PASS'); if (user == null && pass == null) { user = http.formvalue('luci_username'); pass = http.formvalue('luci_password'); } if (user != null && pass != null) session = session_setup(user, pass, resolved.ctx.request_path); if (!session) { resolved.ctx.path = []; http.status(403, 'Forbidden'); http.header('X-LuCI-Login-Required', 'yes'); let scope = { duser: 'root', fuser: user }; let theme_sysauth = `themes/${basename(runtime.env.media)}/sysauth`; if (runtime.is_ucode_template(theme_sysauth) || runtime.is_lua_template(theme_sysauth)) { try { return runtime.render(theme_sysauth, scope); } catch (e) { runtime.env.media_error = `${e}`; } } return runtime.render('sysauth', scope); } let cookie_name = (http.getenv('HTTPS') == 'on') ? 'sysauth_https' : 'sysauth_http', cookie_secure = (http.getenv('HTTPS') == 'on') ? '; secure' : ''; http.header('Set-Cookie', `${cookie_name}=${session.sid}; path=${build_url()}; SameSite=strict; HttpOnly${cookie_secure}`); http.redirect(build_url(...resolved.ctx.request_path)); return; } if (!session) { http.status(403, 'Forbidden'); http.header('X-LuCI-Login-Required', 'yes'); return; } resolved.ctx.authsession ??= session.sid; resolved.ctx.authtoken ??= session.data?.token; resolved.ctx.authuser ??= session.data?.username; resolved.ctx.authacl ??= session.acls; /* In case the Lua runtime was already initialized, e.g. by probing legacy * theme header templates, make sure to update the session ID of the uci * module. */ if (runtime.L) { runtime.L.invoke('require', 'luci.model.uci'); runtime.L.get('luci', 'model', 'uci').invoke('set_session_id', session.sid); } } if (length(resolved.ctx.acls)) { let perm = check_acl_depends(resolved.ctx.acls, resolved.ctx.authacl?.['access-group']); if (perm == null) { http.status(403, 'Forbidden'); return; } if (resolved.node) resolved.node.readonly = !perm; } let action = resolved.node.action; /* If this node matched a wildcard and we have request args, * prefer the wildcard-specific action when defined. */ if (length(resolved.ctx.request_args) && type(resolved.node.wildcardaction) == 'object') action = resolved.node.wildcardaction; if (action?.type == 'arcombine') action = length(resolved.ctx.request_args) ? action.targets?.[1] : action.targets?.[0]; if (resolved.ctx.cors && http.getenv('REQUEST_METHOD') == 'OPTIONS') { http.status(200, 'OK'); http.header('Access-Control-Allow-Origin', http.getenv('HTTP_ORIGIN') ?? '*'); http.header('Access-Control-Allow-Methods', 'GET, POST, OPTIONS'); return; } if (require_post_security(action) && !test_post_security(resolved.ctx.authtoken)) return; run_action(path, lang, menu, resolved, action); } catch (ex) { error500('Unhandled exception during request dispatching', ex); } }; export default dispatch; 07070101AE23D3000081A40000000000000000000000016A426C2800001217000000FE0000000000000000000000000000002000000000usr/share/ucode/luci/runtime.uc// Copyright 2022 Jo-Philipp Wich // Licensed to the public under the Apache License 2.0. import { access, basename, stat } from 'fs'; import { cursor } from 'uci'; const template_directory = '/usr/share/ucode/luci/template'; function cut_message(msg) { return trim(replace(msg, /\n--\n.*$/, '')); } function format_nested_exception(ex) { let msg = replace(cut_message(ex.message), /(\n+( \|[^\n]*(\n|$))+)/, (m, m1) => { m1 = replace(m1, /(^|\n) \| ?/g, '$1'); m = match(m1, /^(.+?)\n(In.*line \d+, byte \d+:.+)$/); return `
${cut_message(m ? m[1] : m1)}
${m ? `
${trim(m[2])}
` : ''}
`; }); return `
${cut_message(msg)}
${trim(ex.stacktrace[0].context)}
`; } function format_lua_exception(ex) { let m = match(ex.message, /^(.+)\nstack traceback:\n(.+)$/); return `
${cut_message(m ? m[1] : ex.message)}
${m ? trim(replace(m[2], /(^|\n)\t/g, '$1')) : ex.stacktrace[0].context}
`; } const Class = { init_lua: function(optional) { if (!this.L) { let bridge = this.env.dispatcher.load_luabridge(optional); if (bridge) { let http = this.env.http; this.L = bridge.create(); this.L.set('L', proto({ write: (...args) => http.closed || print(...args) }, this.env)); this.L.invoke('require', 'luci.ucodebridge'); this.env.lua_active = true; } } return this.L; }, is_ucode_template: function(path) { return access(`${template_directory}/${path}.ut`); }, is_lua_template: function(path) { let vm = this.init_lua(true); return vm && access(`${vm.get('_G', 'luci', 'template', 'viewdir')}/${path}.htm`); }, render_ucode: function(path, scope) { let tmplfunc = loadfile(path, { raw_mode: false }); if (this.env.http.closed) render(call, tmplfunc, null, scope ?? {}); else call(tmplfunc, null, scope ?? {}); }, render_lua: function(path, scope) { let vm = this.init_lua(); let render = vm.get('_G', 'luci', 'ucodebridge', 'render'); render.call(path, scope ?? {}); }, trycompile: function(path) { let ucode_path = `${template_directory}/${path}.ut`; if (access(ucode_path)) { try { loadfile(ucode_path, { raw_mode: false }); } catch (ucode_err) { return `Unable to compile '${path}' as ucode template: ${format_nested_exception(ucode_err)}`; } } else { try { let vm = this.init_lua(true); if (vm) vm.get('_G', 'luci', 'ucodebridge', 'compile').call(path); else return `Unable to compile '${path}' as Lua template: Unable to load Lua runtime`; } catch (lua_err) { return `Unable to compile '${path}' as Lua template: ${format_lua_exception(lua_err)}`; } } return true; }, render_any: function(path, scope) { let ucode_path = `${template_directory}/${path}.ut`; scope = proto(scope ?? {}, this.scopes[-1]); push(this.scopes, scope); try { if (access(ucode_path)) this.render_ucode(ucode_path, scope); else this.render_lua(path, scope); } catch (ex) { pop(this.scopes); die(ex); } pop(this.scopes); }, render: function(path, scope) { let self = this; this.env.http.write(render(() => self.render_any(path, scope))); }, call: function(modname, method, ...args) { let vm = this.init_lua(); let lcall = vm.get('_G', 'luci', 'ucodebridge', 'call'); return lcall.call(modname, method, ...args); } }; export default function(env) { const self = proto({ env: env ??= {}, scopes: [ proto(env, global) ], global }, Class); const uci = cursor(); // determine theme let media = uci.get('luci', 'main', 'mediaurlbase'); let status = self.trycompile(`themes/${basename(media)}/header`); if (status !== true) { media = null; self.env.media_error = status; for (let k, v in uci.get_all('luci', 'themes')) { if (substr(k, 0, 1) != '.') { status = self.trycompile(`themes/${basename(v)}/header`); if (status === true) { media = v; break; } } } if (!media) env.dispatcher.error500(`Unable to render any theme header template, last error was:\n${status}`); } self.env.media = media; self.env.theme = basename(media); self.env.resource = uci.get('luci', 'main', 'resourcebase'); self.env.pkgs_update_time = stat('/lib/apk/db/installed')?.mtime ?? stat('/usr/lib/opkg/status')?.mtime ?? 0; self.env.include = (...args) => self.render_any(...args); return self; }; 07070101AE23DC000041ED0000000000000000000000046A426C2800000000000000FE0000000000000000000000000000001E00000000usr/share/ucode/luci/template07070101AE23E2000081A40000000000000000000000016A426C2800000830000000FE0000000000000000000000000000002900000000usr/share/ucode/luci/template/sysauth.ut{# Copyright 2008 Steven Barth Copyright 2008-2012 Jo-Philipp Wich Licensed to the public under the Apache License 2.0. -#} {% include('header') %}
{% if (fuser): %}

{{ _('Invalid username and/or password! Please try again.') }}

{% endif %}

{{ _('Authorization Required') }}

{{ _('Please enter your username and password.') }}
{% let https_ports = uci.get('uhttpd', 'main', 'listen_https') ?? []; https_ports = uniq(filter( map( (type(https_ports) == 'string') ? split(https_port, /\s+/) : https_ports, e => +match(e, /\d+$/)?.[0] ), p => (p >= 0 && p <= 65535) )); %} {% include('footer') %} 07070101AE23E3000081A40000000000000000000000016A426C28000000E7000000FE0000000000000000000000000000002600000000usr/share/ucode/luci/template/view.ut{% include('header') %}
{{ _('Loading view…') }}
{% include('footer') %} 07070101AE244F000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000002B00000000usr/share/ucode/luci/template/admin_status07070101AE2450000081A40000000000000000000000016A426C280000065A000000FE0000000000000000000000000000003400000000usr/share/ucode/luci/template/admin_status/index.ut{# Copyright 2008 Steven Barth Copyright 2008-2022 Jo-Philipp Wich Licensed to the public under the Apache License 2.0. -#} {% include('header') %}

{{ _('Status') }}

{{ _('Loading view…') }}
{% include('footer') %} 07070101AE23E1000081A40000000000000000000000016A426C280000041F000000FE0000000000000000000000000000002800000000usr/share/ucode/luci/template/header.ut{# Copyright 2022 Jo-Philipp Wich Licensed to the public under the Apache License 2.0. -#} {% include(`themes/${theme}/header`); -%} 07070101AE23DE000081A40000000000000000000000016A426C28000001B3000000FE0000000000000000000000000000002A00000000usr/share/ucode/luci/template/error404.ut{# Copyright 2008 Steven Barth Copyright 2008-2022 Jo-Philipp Wich Licensed to the public under the Apache License 2.0. -#} {% include('header') %}

404 {{ _('Not Found') }}

{{ _('Sorry, the object you requested was not found.') }}

{{ message }}

{{ _('Unable to dispatch') }}: {{ dispatcher.build_url(...ctx.request_path) }} {% include('footer') %} 07070101AE24A5000041ED0000000000000000000000036A426C2800000000000000FE0000000000000000000000000000002500000000usr/share/ucode/luci/template/themes07070101AE24A60000A1FF0000000000000000000000016A426C2800000009000000FE0000000000000000000000000000003400000000usr/share/ucode/luci/template/themes/bootstrap-darkbootstrap07070101AE24A70000A1FF0000000000000000000000016A426C2800000009000000FE0000000000000000000000000000003500000000usr/share/ucode/luci/template/themes/bootstrap-lightbootstrap07070101AE24A8000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000002F00000000usr/share/ucode/luci/template/themes/bootstrap07070101AE24AB000081A40000000000000000000000016A426C2800000541000000FE0000000000000000000000000000003A00000000usr/share/ucode/luci/template/themes/bootstrap/sysauth.ut{# Copyright 2022 Jo-Philipp Wich Licensed to the public under the Apache License 2.0. -#} {% include('header', { blank_page: true }) %}
{{ _('Loading view…') }}
{% include('footer', { blank_page: true }) %} 07070101AE24AA000081A40000000000000000000000016A426C2800000E79000000FE0000000000000000000000000000003900000000usr/share/ucode/luci/template/themes/bootstrap/header.ut{# Copyright 2008 Steven Barth Copyright 2012 David Menting Copyright 2008-2022 Jo-Philipp Wich Licensed to the public under the Apache License 2.0. -#} {% import { getuid, getspnam } from 'luci.core'; const boardinfo = ubus.call('system', 'board'); const darkpref = (theme == 'bootstrap-dark' ? 'true' : (theme == 'bootstrap-light' ? 'false' : null)); http.prepare_content('text/html; charset=UTF-8'); -%} {{ striptags(`${boardinfo.hostname ?? '?'}${dispatched?.title ? ` | ${_(dispatched.title)}` : ''}`) }} {% if (!darkpref): %} {% endif %} {% if (node?.css): %} {% endif %} {% if (css): %} {% endif %} {% if (!blank_page): %}
{{ striptags(boardinfo.hostname ?? '?') }}
{% if (getuid() == 0 && getspnam('root')?.pwdp === ''): %}

{{ _('No password set!') }}

{{ _('There is no password set on this router. Please configure a root password to protect the web interface.') }}

{% if (dispatcher.lookup("admin/system/admin")): %}
{{ _('Go to password configuration...') }}
{% endif %}
{% endif %} {% if (boardinfo.rootfs_type == "initramfs"): %}

{{ _('System running in recovery (initramfs) mode.') }}

{{ _('No changes to settings will be stored and are lost after rebooting. This mode should only be used to install a firmware upgrade') }}

{% if (dispatcher.lookup("admin/system/flash")): %}
{{ _('Go to firmware upgrade...') }}
{% endif %}
{% endif %} {% endif %} 07070101AE24A9000081A40000000000000000000000016A426C280000029F000000FE0000000000000000000000000000003900000000usr/share/ucode/luci/template/themes/bootstrap/footer.ut {% if (!blank_page): %}
{% endif %} 07070101AE23DD000081A40000000000000000000000016A426C280000025B000000FE0000000000000000000000000000002B00000000usr/share/ucode/luci/template/csrftoken.ut{# Copyright 2015-2022 Jo-Philipp Wich Licensed to the public under the Apache License 2.0. -#} {% include('header') %}

{{ _('Form token mismatch') }}


{{ _('The submitted security token is invalid or already expired!') }}

{{ _(` In order to prevent unauthorized access to the system, your request has been blocked. Click "Continue »" below to return to the previous page. `) }}

Continue »

{% include('footer') %} 07070101AE23E0000081A40000000000000000000000016A426C28000004F7000000FE0000000000000000000000000000002800000000usr/share/ucode/luci/template/footer.ut{# Copyright 2022 Jo-Philipp Wich Licensed to the public under the Apache License 2.0. -#} {% const rollback = dispatcher.rollback_pending() %} {% if (rollback || trigger_apply || trigger_revert): %} {% endif %} {% if (media_error): %} {% endif %} {% include(`themes/${theme}/footer`) %} 07070101AE23DF000081A40000000000000000000000016A426C2800000467000000FE0000000000000000000000000000002A00000000usr/share/ucode/luci/template/error500.ut{# Copyright 2022 Jo-Philipp Wich Licensed to the public under the Apache License 2.0. -#}

{{ title }}

{{ message }}
{% if (exception): %}
{{ exception.message }}
{{ exception.stacktrace[0].context }}
{% endif %}
07070101AE234B000081A40000000000000000000000016A426C2800003CDE000000FE0000000000000000000000000000001A00000000usr/share/ucode/iwinfo.uc'use strict'; import * as nl80211 from 'nl80211'; import * as libubus from 'ubus'; import { readfile, stat } from "fs"; let wifi_devices = json(readfile('/usr/share/wifi_devices.json')); let countries = json(readfile('/usr/share/iso3166.json')); let board_data = json(readfile('/etc/board.json')); let ubus = libubus.connect(); export let phys; let interfaces; let wireless_status; function find_phy(wiphy) { for (let k, phy in phys) if (phy && phy.wiphy == wiphy) return phy; return null; } function get_survey(iface) { let channels = nl80211.request(nl80211.const.NL80211_CMD_GET_SURVEY, nl80211.const.NLM_F_DUMP, { dev: iface.ifname }); for (let channel in channels) if (channel.survey_info?.frequency == iface.wiphy_freq) return channel.survey_info; return null; } function get_noise(iface) { return iface.survey?.noise ?? -100; } function get_country(iface) { let reg = nl80211.request(nl80211.const.NL80211_CMD_GET_REG, 0, { dev: iface.ifname }); return reg.reg_alpha2 ?? ''; } function get_max_power(iface) { let phy = find_phy(iface.wiphy); for (let k, band in phy.wiphy_bands) if (band) for (let freq in band.freqs) if (freq.freq == iface.wiphy_freq) return freq.max_tx_power;; return 0; } function get_hardware_id(iface) { let hw = { type: 'nl80211', id: 'Generic MAC80211', power_offset: 0, channel_offset: 0, }; let path = `/sys/class/ieee80211/phy${iface.wiphy}/device/`; if (stat(path + 'vendor')) { let data = []; for (let lookup in [ 'vendor', 'device', 'subsystem_vendor', 'subsystem_device' ]) push(data, trim(readfile(path + lookup), '\n')); for (let device in wifi_devices.pci) { let match = 0; for (let i = 0; i < 4; i++) if (lc(data[i]) == lc(device[i])) match++; if (match == 4) { hw.type = `${data[0]}:${data[1]} ${data[2]}:${data[3]}`; hw.power_offset = device[4]; hw.channel_offset = device[5]; hw.id = `${device[6]} ${device[7]}`; } } } let compatible = trim(readfile(`/sys/class/net/${iface.ifname}/device/of_node/compatible`), '\n'); if (compatible && wifi_devices.compatible[compatible]) { hw.id = wifi_devices.compatible[compatible][0] + ' ' + wifi_devices.compatible[compatible][1]; hw.compatible = compatible; hw.type = 'embedded'; } return hw; } const iftypes = [ 'Unknown', 'Ad-Hoc', 'Client', 'Master', 'Master (VLAN)', 'WDS', 'Monitor', 'Mesh Point', 'P2P Client', 'P2P Go', ]; export let ifaces = {}; export function update() { phys = nl80211.request(nl80211.const.NL80211_CMD_GET_WIPHY, nl80211.const.NLM_F_DUMP, { split_wiphy_dump: true }); interfaces = nl80211.request(nl80211.const.NL80211_CMD_GET_INTERFACE, nl80211.const.NLM_F_DUMP); wireless_status = ubus.call('network.wireless', 'status'); ifaces = {}; for (let k, v in interfaces) { let iface = ifaces[v.ifname] = v; iface.mode = iftypes[iface.iftype] ?? 'unknown', iface.survey = get_survey(iface); iface.noise = get_noise(iface); iface.country = get_country(iface); iface.max_power = get_max_power(iface); iface.assoclist = nl80211.request(nl80211.const.NL80211_CMD_GET_STATION, nl80211.const.NLM_F_DUMP, { dev: v.ifname }) ?? []; iface.hardware = get_hardware_id(iface); iface.bss_info = ubus.call('hostapd', 'bss_info', { iface: v.ifname }); if (!iface.bss_info) iface.bss_info = ubus.call('wpa_supplicant', 'bss_info', { iface: v.ifname }); } for (let radio, data in wireless_status) for (let k, v in data.interfaces) { if (!v.ifname || !ifaces[v.ifname]) continue; ifaces[v.ifname].ssid = v.config.ssid || v.config.mesh_id; ifaces[v.ifname].radio = data.config; let bss_info = ifaces[v.ifname].bss_info; let owe_transition_ifname = bss_info?.owe_transition_ifname; if (v.config.owe_transition && ifaces[owe_transition_ifname]) { ifaces[v.ifname].owe_transition_ifname = owe_transition_ifname; ifaces[owe_transition_ifname].ssid = v.config.ssid; ifaces[owe_transition_ifname].radio = data.config; ifaces[owe_transition_ifname].owe_transition_ifname = v.ifname } } }; function format_channel(freq) { if (freq < 1000) return 0; if (freq == 2484) return 14; if (freq == 5935) return 2; if (freq < 2484) return (freq - 2407) / 5; if (freq >= 4910 && freq <= 4980) return (freq - 4000) / 5; if (freq < 5950) return (freq - 5000) / 5; if (freq <= 45000) return (freq - 5950) / 5; if (freq >= 58320 && freq <= 70200) return (freq - 56160) / 2160; return 'unknown'; } function format_band(freq) { if (freq == 5935) return '6'; if (freq < 2484) return '2.4'; if (freq < 5950) return '5'; if (freq <= 45000) return '6'; return '60'; } function format_frequency(freq) { return freq ? sprintf('%.03f', freq / 1000.0) : 'unknown'; } function format_rate(rate) { return rate ? sprintf('%.01f', rate / 10.0) : 'unknown'; } function format_expected_throughput(rate) { return rate ? sprintf('%.01f', rate / 1000.0) : 'unknown'; } function format_mgmt_key(key) { switch(+key) { case 1: return '802.1x'; case 2: return 'WPA PSK'; case 3: return 'FT 802.1x'; case 4: return 'FT PSK'; case 5: case 11: // deprecated 802.1x-suiteB-SHA256 return '802.1x-SHA256'; case 6: return 'WPA PSK-SHA256'; case 8: // SAE with SHA256 case 24: // SAE using group-dependent hash return 'SAE'; case 9: // FT SAE with SHA256 case 25: // FT SAE using group-dependent hash return 'FT SAE'; case 12: return '802.1x-192bit'; case 13: return 'FT 802.1x-SHA384'; case 14: return 'FILS-SHA256'; case 15: return 'FILS-SHA384'; case 16: return 'FT FILS-SHA256'; case 17: return 'FT FILS-SHA384'; case 18: return 'OWE'; case 19: return 'FT PSK-SHA384'; case 20: return 'WPA PSK-SHA384'; } return null; } function assoc_flags(data) { const assoc_mhz = { width_40: 40, width_80: 80, width_80p80: '80+80', width_160: 160, width_320: 320, width_10: 10, width_5: 5 }; let mhz = 'unknown'; for (let k, v in assoc_mhz) if (data[k]) mhz = v; const assoc_flags = { mcs: { mcs: 'MCS', }, vht_mcs: { vht_mcs: 'VHT-MCS', vht_nss: 'VHT-NSS', }, he_mcs: { he_mcs: 'HE-MCS', he_nss: 'HE-NSS', he_gi: 'HE-GI', he_dcm: 'HE-DCM', }, eht_mcs: { eht_mcs: 'EHT-MCS', eht_nss: 'EHT-NSS', eht_gi: 'EHT-GI', }, }; let flags = []; for (let k, v in assoc_flags) { if (!data[k]) continue; let first = 0; for (let name, flag in v) { if (data[name] == null) continue; push(flags, `${flag} ${data[name]}`); if (!first++) push(flags, `${mhz}MHz`); } } return flags; } function dbm2mw(dbm) { const LOG10_MAGIC = 1.25892541179; let res = 1.0; let ip = dbm / 10; let fp = dbm % 10; for (let k = 0; k < ip; k++) res *= 10; for (let k = 0; k < fp; k++) res *= LOG10_MAGIC; return int(res); } function dbm2quality(dbm) { let quality = dbm; if (quality < -110) quality = -110; else if (quality > -40) quality = -40; quality += 110; return quality; } function hwmodelist(name) { const mode = { 'HT*': 'n', 'VHT*': 'ac', 'HE*': 'ax', 'EHT*': 'be' }; let iface = ifaces[name]; let phy = board_data.wlan?.['phy' + iface.wiphy]; if (!phy || !iface.radio?.band) return ''; let htmodes = phy.info.bands[uc(iface.radio.band)].modes; let list = []; if (iface.radio.band == '2g' && 'NOHT' in htmodes) push(list, 'g/b'); for (let k, v in mode) for (let htmode in htmodes) if (wildcard(htmode, k)) push(list, v); return join('/', reverse(uniq(list))); } export function assoclist(dev) { let stations = ifaces[dev].assoclist; let ret = {}; for (let station in stations) { let sta = { mac: uc(station.mac), signal: station.sta_info.signal_avg, noise: ifaces[dev].noise, snr: station.sta_info.signal_avg - ifaces[dev].noise, inactive_time: station.sta_info.inactive_time, rx: { bitrate: format_rate(station.sta_info.rx_bitrate?.bitrate ?? 0), bitrate_raw: station.sta_info.rx_bitrate?.bitrate ?? 0, packets: station.sta_info.rx_packets ?? 0, flags: assoc_flags(station.sta_info.rx_bitrate ?? {}), }, tx: { bitrate: format_rate(station.sta_info.tx_bitrate?.bitrate ?? 0), bitrate_raw: station.sta_info.tx_bitrate?.bitrate ?? 0, packets: station.sta_info.tx_packets ?? 0, flags: assoc_flags(station.sta_info.tx_bitrate ?? {}), }, expected_throughput: format_expected_throughput(station.sta_info.expected_throughput ?? 0), }; ret[sta.mac] = sta; } return ret; }; export function freqlist(name) { const freq_flags = { no_10mhz: 'NO_10MHZ', no_20mhz: 'NO_20MHZ', no_ht40_minus: 'NO_HT40-', no_ht40_plus: 'NO_HT40+', no_80mhz: 'NO_80MHZ', no_160mhz: 'NO_160MHZ', indoor_only: 'INDOOR_ONLY', no_ir: 'NO_IR', no_he: 'NO_HE', radar: 'RADAR_DETECTION', }; let iface = ifaces[name]; let phy = find_phy(iface.wiphy); let channels = []; for (let k, band in phy.wiphy_bands) { if (!band) continue; let band_name = format_band(band.freqs[0].freq); for (let freq in band.freqs) { if (freq.disabled) continue; let channel = { freq: format_frequency(freq.freq), band: band_name, channel: format_channel(freq.freq), flags: [], active: iface.wiphy_freq == freq.freq, }; for (let k, v in freq_flags) if (freq[k]) push(channel.flags, v); push(channels, channel); } } return channels; }; export function info(name) { let order = []; for (let iface, data in ifaces) push(order, iface); let list = []; for (let iface in sort(order)) { if (name && iface != name) continue; let data = ifaces[iface]; let dev = { iface, ssid: data.ssid, mac: data.mac, mode: data.mode, channel: format_channel(data.wiphy_freq), freq: format_frequency(data.wiphy_freq), htmode: data.radio?.htmode, center_freq1: format_channel(data.center_freq1) || 'unknown', center_freq2: format_channel(data.center_freq2) || 'unknown', txpower: data.wiphy_tx_power_level / 100, noise: data.noise, signal: 0, bitrate: 0, encryption: 'unknown', hwmode: hwmodelist(iface), phy: 'phy' + data.wiphy, vaps: 'no', hw_type: data.hardware.type, hw_id: data.hardware.id, power_offset: data.hardware.power_offset || 'none', channel_offset: data.hardware.channel_offset || 'none', }; let phy = find_phy(data.wiphy); for (let limit in phy.interface_combinations?.[0]?.limits) if (limit.types?.ap && limit.max > 1) dev.vaps = 'yes'; if (data.bss_info) { if (data.bss_info.wpa_key_mgmt && data.bss_info.wpa_pairwise) dev.encryption = `${replace(data.bss_info.wpa_key_mgmt, ' ', ' / ')} (${data.bss_info.wpa_pairwise})`; else if (data.owe_transition_ifname) dev.encryption = 'none (OWE transition)'; else dev.encryption = 'none'; } let stations = assoclist(iface); for (let k, station in stations) { dev.signal += station.signal; dev.bitrate += station.tx.bitrate_raw; } dev.signal /= length(data.assoclist) || 1; dev.bitrate /= length(data.assoclist) || 1; dev.bitrate = format_rate(dev.bitrate); dev.quality = dbm2quality(dev.signal); if (data.owe_transition_ifname) dev.owe_transition_ifname = data.owe_transition_ifname; push(list, dev); } return list; }; export function htmodelist(name) { let iface = ifaces[name]; let phy = board_data.wlan?.['phy' + iface.wiphy]; if (!phy || !iface.radio.band) return []; return filter(phy.info.bands[uc(iface.radio.band)].modes, (v) => v != 'NOHT'); }; export function txpowerlist(name) { let iface = ifaces[name]; let max_power = iface.max_power / 100; let match = iface.wiphy_tx_power_level / 100; let list = []; for (let power = 0; power <= max_power; power++) { let txpower = { dbm: power, mw: dbm2mw(power), active: power == match, }; push(list, txpower); } return list; }; export function countrylist(dev) { let iface = ifaces[dev]; let list = { active: iface.country, countries, }; return list; }; function scan_extension(ext, cell) { const eht_chan_width = [ '20 MHz', '40 MHz', '80 MHz', '160 MHz', '320 MHz']; switch(ord(ext, 0)) { case 36: let offset = 7; if (!(ord(ext, 3) & 0x2)) break; if (ord(ext, 2) & 0x40) offset += 3; if (ord(ext, 2) & 0x80) offset += 1; cell.he = { chan_width: eht_chan_width[ord(ext, offset + 1) & 0x3], center_chan_1: ord(ext, offset + 2), center_chan_2: ord(ext, offset + 3), }; break; case 106: if (!(ord(ext, 1) & 0x1)) break; cell.eht = { chan_width: eht_chan_width[ord(ext, 6) & 0x7], center_chan_1: ord(ext, 7), center_chan_2: ord(ext, 8), }; break; } }; export function scan(dev) { const rsn_cipher = [ 'NONE', 'WEP-40', 'TKIP', 'WRAP', 'CCMP', 'WEP-104', 'AES-OCB', 'CKIP', 'GCMP', 'GCMP-256', 'CCMP-256' ]; const ht_chan_offset = [ 'no secondary', 'above', '[reserved]', 'below' ]; const vht_chan_width = [ '20 or 40 MHz', '80 MHz', '80+80 MHz', '160 MHz' ]; const ht_chan_width = [ '20 MHz', '40 MHz or higher' ]; const SCAN_FLAG_AP = (1<<2); let params = { dev, scan_flags: SCAN_FLAG_AP, scan_ssids: [ '' ], }; let res = nl80211.request(nl80211.const.NL80211_CMD_TRIGGER_SCAN, 0, params); if (res === false) { printf("Unable to trigger scan: " + nl80211.error() + "\n"); exit(1); } res = nl80211.waitfor([ nl80211.const.NL80211_CMD_NEW_SCAN_RESULTS, nl80211.const.NL80211_CMD_SCAN_ABORTED ], 5000); if (!res) { printf("Netlink error while awaiting scan results: " + nl80211.error() + "\n"); exit(1); } else if (res.cmd == nl80211.const.NL80211_CMD_SCAN_ABORTED) { printf("Scan aborted by kernel\n"); exit(1); } let scan = nl80211.request(nl80211.const.NL80211_CMD_GET_SCAN, nl80211.const.NLM_F_DUMP, { dev }); let cells = []; for (let k, bss in scan) { bss = bss.bss; let cell = { bssid: uc(bss.bssid), frequency: format_frequency(bss.frequency), band: format_band(bss.frequency), channel: format_channel(bss.frequency), dbm: bss.signal_mbm / 100, }; if (bss.capability & (1 << 1)) cell.mode = 'Ad-Hoc'; else if (bss.capability & (1 << 0)) cell.mode = 'Master'; else cell.mode = 'Mesh Point'; cell.quality = dbm2quality(cell.dbm); for (let ie in bss.information_elements) switch(ie.type) { case 0: case 114: cell.ssid = ie.data; break; case 7: cell.country = substr(ie.data, 0, 2); break; case 48: cell.crypto = { group: rsn_cipher[ord(ie.data, 5)] ?? '', pair: [], key_mgmt: [], }; let offset = 6; let count = ord(ie.data, offset); offset += 2; for (let i = 0; i < count; i++) { let key = rsn_cipher[ord(ie.data, offset + 3)]; if (key) push(cell.crypto.pair, key); offset += 4; } count = ord(ie.data, offset); offset += 2; for (let i = 0; i < count; i++) { let key = format_mgmt_key(ord(ie.data, offset + 3)); if (key) push(cell.crypto.key_mgmt, key); offset += 4; } break; case 61: cell.ht = { primary_channel: ord(ie.data, 0), secondary_chan_off: ht_chan_offset[ord(ie.data, 1) & 0x3], chan_width: ht_chan_width[(ord(ie.data, 1) & 0x4) >> 2], }; break; case 192: cell.vht = { chan_width: vht_chan_width[ord(ie.data, 0)], center_chan_1: ord(ie.data, 1), center_chan_2: ord(ie.data, 2), }; break; case 255: scan_extension(ie.data, cell); break; }; push(cells, cell); } return cells; }; update(); 07070101AE234C000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001500000000usr/share/ucode/wifi07070101AE2352000081A40000000000000000000000016A426C280000211F000000FE0000000000000000000000000000002300000000usr/share/ucode/wifi/supplicant.uc'use strict'; import { append, append_raw, append_vars, network_append, network_append_raw, network_append_vars, network_append_string_vars, set_default, dump_network, flush_network, wiphy_info, wiphy_band } from 'wifi.common'; import * as netifd from 'wifi.netifd'; import * as iface from 'wifi.iface'; import * as fs from 'fs'; function set_fixed_freq(data, config) { if (!data.frequency) return; set_default(config, 'fixed_freq', 1); set_default(config, 'frequency', data.frequency); if (data.htmode in [ 'VHT80', 'HE80', 'EHT80' ]) set_default(config, 'max_oper_chwidth', 1); else if (data.htmode in [ 'VHT160', 'HE160', 'EHT160' ]) set_default(config, 'max_oper_chwidth', 2); else if (data.htmode in [ 'EHT320' ]) set_default(config, 'max_oper_chwidth', 9); else if (data.htmode in [ 'VHT20', 'VHT40', 'HE20', 'HE40', 'EHT20', 'EHT40' ]) set_default(config, 'max_oper_chwidth', 0); else set_default(config, 'disable_vht', true); if (data.htmode in [ 'NOHT' ]) set_default(config, 'disable_ht', true); else if (data.htmode in [ 'HT20', 'VHT20', 'HE20', 'EHT20' ]) set_default(config, 'disable_ht40', true); else if (data.htmode in [ 'VHT40', 'VHT80', 'VHT160', 'HE40', 'HE80', 'HE160', 'EHT40', 'EHT80', 'EHT160', 'EHT320' ]) set_default(config, 'ht40', true); if (wildcard(data.htmode, 'VHT*')) set_default(config, 'vht', 1); } export function ratestr(rate) { if (rate == null) return rate; let rem = (rate / 100) % 10; rate = int(rate / 1000); if (rem > 0) rate += "." + rem; return "" + rate; }; export function ratelist(rates) { if (length(rates) < 1) return null; return join(",", map(rates, (rate) => ratestr(rate))); }; function setup_sta(data, config) { iface.parse_encryption(config); if (config.auth_type in [ 'sae', 'owe', 'eap2', 'eap192' ]) config.ieee80211w = 2; else if (config.auth_type in [ 'psk-sae' ] && !config.ieee80211w) config.ieee80211w = 1; if ((wildcard(data.htmode, 'EHT*') || wildcard(data.htmode, 'HE*')) && config.rsn_override) config.rsn_overriding = 1; else config.rsn_overriding = 0; set_default(config, 'ieee80211r', 0); set_default(config, 'sae_pwe', 2); set_default(config, 'multi_ap', 0); set_default(config, 'multi_profile', 1); set_default(config, 'default_disabled', 0); config.scan_ssid = 1; switch(config.mode) { case 'sta': set_default(config, 'multi_ap_backhaul_sta', config.multi_ap); break; case 'adhoc': config.ap_scan = 2; config.scan_ssid = 0; network_append('mode', 1); set_fixed_freq(data, config); break; case 'mesh': config.ssid = config.mesh_id; config.scan_ssid = null; network_append('mode', 5); set_fixed_freq(data, config); if (config.encryption && config.encryption != 'none') config.key_mgmt = 'SAE'; config.ieee80211w = null; break; } if (config.mode != 'mesh' ) { switch(config.wpa) { case 1: config.proto = 'WPA'; break; case 2: config.proto = 'RSN'; break; } } switch(config.auth_type) { case 'none': break; case 'owe': iface.wpa_key_mgmt(config); break; case 'wps': config.key_mgmt = 'WPS'; break; case 'psk': case 'psk2': case 'sae': case 'psk-sae': if (config.mode != 'mesh') iface.wpa_key_mgmt(config); if (config.mode == 'mesh' || config.auth_type == 'sae') config.sae_password = `"${config.key}"`; else config.psk = `"${config.key}"`; break; case 'eap': case 'eap2': case 'eap192': iface.wpa_key_mgmt(config); set_default(config, 'erp', config.fils); if (config.ca_cert_usesystem && fs.stat('/etc/ssl/certs/ca-certificates.crt')) config.ca_cert = '/etc/ssl/certs/ca-certificates.crt'; const eap_method_map = { fast: 'FAST', peap: 'PEAP', ttls: 'TTLS', tls: 'TLS' }; if (eap_method_map[config.eap_type]) config.eap = eap_method_map[config.eap_type]; switch(config.eap_type) { case 'fast': case 'peap': case 'ttls': set_default(config, 'auth', 'MSCHAPV2'); config.phase2 = `"auth=${config.auth}"`; if (config.auth == 'EAP-TLS') { if (config.ca_cert2_usesystem && fs.stat('/etc/ssl/certs/ca-certificates.crt')) config.ca_cert2 = '/etc/ssl/certs/ca-certificates.crt'; } break; } } if (config.wpa_pairwise == 'GCMP') { config.pairwise = 'GCMP'; config.group = 'GCMP'; } config.key_mgmt ??= 'NONE'; /* * Map UCI basic_rate to the correct wpa_supplicant network field: * mesh -> mesh_basic_rates (space-separated, 100 kb/s units) * other -> rates (comma-separated Mbps, e.g. "5.5,11") * "basic_rate" itself is not a valid wpa_supplicant network field. */ let brates = config.basic_rate; config.basic_rate = null; if (brates != null && length(brates) > 0) { if (config.mode == 'mesh') config.mesh_basic_rates = join(" ", map(brates, (br) => "" + int(br / 100))); else config.rates = ratelist(brates); } config.mcast_rate = ratestr(config.mcast_rate); network_append_string_vars(config, [ 'ssid', 'identity', 'anonymous_identity', 'password', 'ca_cert', 'ca_cert2', 'client_cert', 'client_cert2', 'subject_match', 'private_key', 'private_key_passwd', 'private_key2', 'private_key2_passwd', ]); network_append_vars(config, [ 'rsn_overriding', 'scan_ssid', 'noscan', 'disabled', 'multi_ap_profile', 'multi_ap_backhaul_sta', 'ocv', 'beacon_prot', 'key_mgmt', 'sae_pwe', 'psk', 'sae_password', 'pairwise', 'group', 'bssid', 'proto', 'mesh_fwding', 'mesh_rssi_threshold', 'frequency', 'fixed_freq', 'disable_ht', 'disable_ht40', 'disable_vht', 'vht', 'max_oper_chwidth', 'ht40', 'beacon_int', 'ieee80211w', 'rates', 'mesh_basic_rates', 'mcast_rate', 'altsubject_match', 'domain_match', 'domain_suffix_match', 'bssid_blacklist', 'bssid_whitelist', 'erp', 'eap', 'phase2', ]); } function freq_in_range(freq_ranges, freq) { if (!freq_ranges) return true; freq *= 1000; for (let range in freq_ranges) if (freq >= range.start && freq <= range.end) return true; } function wiphy_frequencies(phy, band, radio) { phy = wiphy_info(phy); band = wiphy_band(phy, band); if (!band) return; let ranges; for (let r in phy.radios) if (r.index == radio) ranges = r.freq_ranges; let freqs = []; for (let chan in band.freqs) if (!chan.disabled && freq_in_range(ranges, chan.freq)) push(freqs, chan.freq); if (length(freqs) > 0) return freqs; } export function generate(config_list, data, interface) { flush_network(); if (interface.bridge && (interface.config.mode == 'adhoc' || (interface.config.mode == 'sta' && !interface.config.wds && !interface.config.multi_ap))){ netifd.setup_failed('BRIDGE_NOT_ALLOWED'); return 1; } interface.config.country = data.config.country_code; interface.config.beacon_int = data.config.beacon_int; if (!data.config.scan_list) data.config.scan_list = wiphy_frequencies(data.phy, data.config.band, data.config.radio); if (data.config.scan_list) interface.config.freq_list = join(" ", data.config.scan_list); append_vars(interface.config, [ 'country', 'beacon_int', 'freq_list' ]); setup_sta(data.config, interface.config); let file_name = `/var/run/wpa-supplicant-${interface.config.ifname}.conf`; if (fs.stat(file_name)) fs.rename(file_name, file_name + '.prev'); dump_network(file_name); let config = { mode: interface.config.mode, ctrl: '/var/run/wpa_supplicant', iface: interface.config.ifname, config: file_name, '4addr': !!interface.config.wds, mlo: !!interface.config.mlo, freq_list: data.config.scan_list, powersave: false }; if (!interface.config.default_macaddr) config.macaddr = interface.config.macaddr; if (interface.config.wds) config.bridge = interface.bridge; push(config_list, config); return config; }; export function setup(config, data) { if (!global.ubus.list('wpa_supplicant')) system('ubus wait_for wpa_supplicant'); let ret = global.ubus.call('wpa_supplicant', 'config_set', { phy: data.phy, radio: data.config.radio, config, defer: true, num_global_macaddr: data.config.num_global_macaddr, macaddr_base: data.config.macaddr_base ?? "", }); if (ret) netifd.add_process('/usr/sbin/wpa_supplicant', ret.pid, true, true); else netifd.setup_failed('SUPPLICANT_START_FAILED'); }; export function start(data) { global.ubus.call('wpa_supplicant', 'config_set', { phy: data.phy, radio: data.config.radio, num_global_macaddr: data.config.num_global_macaddr, macaddr_base: data.config.macaddr_base ?? "", }); }; 07070101AE234D000081A40000000000000000000000016A426C2800003BB2000000FE0000000000000000000000000000001B00000000usr/share/ucode/wifi/ap.uc'use strict'; import * as libuci from 'uci'; import { md5 } from 'digest'; import * as fs from 'fs'; import { append, append_raw, append_value, append_vars, append_string_vars, comment, push_config, set_default, touch_file } from 'wifi.common'; import * as netifd from 'wifi.netifd'; import * as iface from 'wifi.iface'; function iface_setup(config) { switch(config.fixup) { case 'owe': config.ignore_broadcast_ssid = true; config.ssid = config.ssid + 'OWE'; break; case 'owe-transition': let ifname = config.ifname; config.ifname = config.owe_transition_ifname; config.owe_transition_ifname = ifname; config.owe_transition_ssid = config.ssid + 'OWE'; config.encryption = 'none'; config.ignore_broadcast_ssid = false; iface.prepare(config); break; } comment('Setup interface: ' + config.ifname); config.bridge = config.network_bridge; config.snoop_iface = config.network_ifname; if (!config.wds) config.wds_bridge = null; else config.wds_sta = true; if (!config.idx) append('interface', config.ifname); else append('bss', config.ifname); if (config.multicast_to_unicast || config.proxy_arp) config.ap_isolate = 1; if (config.proxy_arp) set_default(config, 'na_mcast_to_ucast', true); append('bssid', config.macaddr); config.ssid2 = config.ssid; config.wmm_enabled = 1; append_string_vars(config, [ 'ssid2' ]); append_vars(config, [ 'ctrl_interface', 'ap_isolate', 'max_num_sta', 'ap_max_inactivity', 'airtime_bss_weight', 'airtime_bss_limit', 'airtime_sta_weight', 'bss_load_update_period', 'chan_util_avg_period', 'disassoc_low_ack', 'skip_inactivity_poll', 'ignore_broadcast_ssid', 'uapsd_advertisement_enabled', 'utf8_ssid', 'multi_ap', 'multi_ap_vlanid', 'multi_ap_profile', 'tdls_prohibit', 'bridge', 'wds_sta', 'wds_bridge', 'snoop_iface', 'vendor_elements', 'nas_identifier', 'radius_acct_interim_interval', 'ocv', 'beacon_prot', 'spp_amsdu', 'multicast_to_unicast', 'preamble', 'proxy_arp', 'per_sta_vif', 'mbo', 'bss_transition', 'wnm_sleep_mode', 'wnm_sleep_mode_no_keys', 'qos_map_set', 'max_listen_int', 'dtim_period', 'wmm_enabled', 'start_disabled', 'na_mcast_to_ucast', 'no_probe_resp_if_max_sta', ]); } function iface_authentication_server(config) { for (let server in config.auth_server_addr) { append('auth_server_addr', server); append_vars(config, [ 'auth_server_port', 'auth_server_shared_secret' ]); } append_vars(config, [ 'radius_auth_req_attr' ]); } function iface_accounting_server(config) { for (let server in config.acct_server_addr) { append('acct_server_addr', server); append_vars(config, [ 'acct_server_port', 'acct_server_shared_secret' ]); } append_vars(config, [ 'radius_acct_req_attr' ]); } function iface_auth_type(config) { if (config.auth_type in [ 'sae', 'owe', 'eap2', 'eap192' ]) { config.ieee80211w = 2; config.sae_require_mfp = 1; if (!config.ppsk) set_default(config, 'sae_pwe', 2); } if (config.auth_type in [ 'psk-sae', 'eap-eap2' ]) { set_default(config, 'ieee80211w', 1); if (config.rsn_override) config.rsn_override_mfp = 2; config.sae_require_mfp = 1; if (!config.ppsk) set_default(config, 'sae_pwe', 2); } if (config.own_ip_addr) config.dynamic_own_ip_addr = null; if (!config.wpa) config.wpa_disable_eapol_key_retries = null; switch(config.auth_type) { case 'none': case 'owe': config.wps_possible = 1; config.wps_state = 1; append_string_vars(config, [ 'owe_transition_ssid' ]); append_vars(config, [ 'owe_transition_bssid', 'owe_transition_ifname', ]); break; case 'psk': case 'psk2': case 'sae': case 'psk-sae': config.vlan_possible = 1; config.wps_possible = 1; if (config.ppsk) { iface_authentication_server(config); config.macaddr_acl = 2; config.wpa_psk_radius = 2; } else if (length(config.key) == 64) { config.wpa_psk = config.key; } else if (length(config.key) >= 8 && length(config.key) <= 63) { config.wpa_passphrase = config.key; } else if (config.key) { netifd.setup_failed('INVALID_WPA_PSK'); } if (config.auth_type in [ 'psk', 'psk-sae' ]) { set_default(config, 'wpa_psk_file', `/var/run/hostapd-${config.ifname}.psk`); touch_file(config.wpa_psk_file); } if (config.auth_type in [ 'sae', 'psk-sae' ]) { set_default(config, 'sae_password_file', `/var/run/hostapd-${config.ifname}.sae`); touch_file(config.sae_password_file); } break; case 'eap': case 'eap2': case 'eap-eap2': case 'eap192': config.vlan_possible = 1; if (config.fils) { set_default(config, 'erp_domain', config.mobility_domain); set_default(config, 'erp_domain', substr(md5(config.ssid + '\n'), 0, 8)); set_default(config, 'fils_realm', config.erp_domain); set_default(config, 'erp_send_reauth_start', 1); set_default(config, 'fils_cache_id', substr(md5(config.fils_realm + '\n'), 0, 4)); } if (!config.eap_server) { iface_authentication_server(config); iface_accounting_server(config); } if (config.radius_das_client && config.radius_das_secret) { set_default(config, 'radius_das_port', 3799); config.radius_das_client = config.radius_das_client + ' ' + config.radius_das_secret; } set_default(config, 'eapol_version', config.wpa & 1); if (!config.eapol_version) config.eapol_version = null; append('eapol_key_index_workaround', '1'); append('ieee8021x', '1'); break; } append_vars(config, [ 'sae_require_mfp', 'sae_password_file', 'sae_pwe', 'sae_track_password', 'time_advertisement', 'time_zone', 'wpa_group_rekey', 'wpa_ptk_rekey', 'wpa_gmk_rekey', 'wpa_strict_rekey', 'macaddr_acl', 'wpa_psk_radius', 'wpa_psk', 'wpa_passphrase', 'wpa_psk_file', 'eapol_version', 'dynamic_vlan', 'radius_request_cui', 'eap_reauth_period', 'radius_das_client', 'radius_das_port', 'own_ip_addr', 'dynamic_own_ip_addr', 'wpa_disable_eapol_key_retries', 'auth_algs', 'wpa', 'wpa_pairwise', 'erp_domain', 'fils_realm', 'erp_send_reauth_start', 'fils_cache_id' ]); } function iface_ppsk(config) { if (!(config.auth_type in [ 'none', 'owe', 'psk', 'sae', 'psk-sae', 'wep' ]) || !config.auth_server_addr) return; iface_authentication_server(config); append('macaddr_acl', '2'); } function iface_wps(config) { push_config(config, 'config_methods', 'wps_pushbutton', 'push_button'); push_config(config, 'config_methods', 'wps_label', 'label'); if (config.multi_ap == 1) config.wps_possible = false; if (config.wps_possible && length(config.config_methods)) { config.eap_server = 1; set_default(config, 'wps_state', 2); if (config.ext_registrar && config.network_bridge) set_default(config, 'upnp_iface', config.network_bridge); if (config.multi_ap && config.multi_ap_backhaul_ssid) { append_string_vars(config, [ 'multi_ap_backhaul_ssid' ]); if (length(config.multi_ap_backhaul_key) == 64) append('multi_ap_backhaul_wpa_psk', config.multi_ap_backhaul_key); else if (length(config.multi_ap_backhaul_key) > 8) append('multi_ap_backhaul_wpa_passphrase', config.multi_ap_backhaul_key); else netifd.setup_failed('INVALID_WPA_PSK'); } append_vars(config, [ 'wps_state', 'device_type', 'device_name', 'config_methods', 'wps_independent', 'eap_server', 'ap_pin', 'ap_setup_locked', 'upnp_iface' ]); } } function iface_rrm(config) { set_default(config, 'rrm_neighbor_report', config.ieee80211k); set_default(config, 'rrm_beacon_report', config.ieee80211k); append_vars(config, [ 'rrm_neighbor_report', 'rrm_beacon_report', 'rnr', 'ftm_responder', ]); } function iface_ftm(config, phy_features) { if (!phy_features.ftm_responder || !config.ftm_responder) return; append_vars(config, [ 'ftm_responder', 'lci', 'civic' ]); } function iface_macfilter(config) { let path = `/var/run/hostapd-${config.ifname}.maclist`; switch(config.macfilter) { case 'allow': append('accept_mac_file', path); append('macaddr_acl', 1); config.vlan_possible = 1; break; case 'deny': append('deny_mac_file', path); append('macaddr_acl', 0); break; default: return; } let file = fs.open(path, 'w'); if (!file) { warn(`Failed to open ${path}`); return; } if (config.maclist) file.write(join('\n', config.maclist)); let macfile = fs.readfile(config.macfile); if (macfile) file.write(macfile); file.close(); } function iface_vlan(interface, config, vlans) { let path = `/var/run/hostapd-${config.ifname}.vlan`; let file = fs.open(path, 'w'); for (let k, vlan in vlans) if (vlan.config.name && vlan.config.vid) { let ifname = `${config.ifname}-${vlan.config.name}`; file.write(`${vlan.config.vid} ${ifname}\n`); netifd.set_vlan(interface, ifname, k); } file.close(); set_default(config, 'vlan_file', path); append_vars(config, [ 'vlan_file' ]); if (!config.vlan_possible || !config.dynamic_vlan) return; set_default(config, 'vlan_no_bridge', !config.vlan_bridge); append_vars(config, [ 'dynamic_vlan', 'vlan_naming', 'vlan_bridge', 'vlan_no_bridge', 'vlan_tagged_interface' ]); } function iface_wpa_stations(config, stas) { let path = `/var/run/hostapd-${config.ifname}.psk`; let file = fs.open(path, 'w'); for (let k, sta in stas) if (sta.config.mac && sta.config.key) { for (let mac in sta.config.mac) { let station = `${mac} ${sta.config.key}\n`; if (sta.config.vid) station = `vlanid=${sta.config.vid} ` + station; file.write(station); } } file.close(); set_default(config, 'wpa_psk_file', path); } function iface_sae_stations(config, stas) { let path = `/var/run/hostapd-${config.ifname}.sae`; let file = fs.open(path, 'w'); for (let k, sta in stas) if (sta.config.mac && sta.config.key) { for (let mac in sta.config.mac) { if (mac == '00:00:00:00:00:00') mac = 'ff:ff:ff:ff:ff:ff'; let station = `${sta.config.key}|mac=${mac}`; if (sta.config.vid) station = station + `|vlanid=${sta.config.vid}`; station = station + '\n'; file.write(station); } } file.close(); set_default(config, 'sae_password_file', path); } function iface_eap_server(config) { if (!config.eap_server) return; set_default(config, 'eap_server', true); set_default(config, 'eap_server_erp', true); append_vars(config, [ 'eap_server', 'eap_server_erp', 'eap_user_file', 'ca_cert', 'server_cert', 'private_key', 'private_key_passwd', 'server_id', ]); } function iface_roaming(config) { if (!config.ieee80211r || config.wpa < 2) return; set_default(config, 'mobility_domain', substr(md5(config.ssid + '\n'), 0, 4)); set_default(config, 'ft_psk_generate_local', config.auth_type == 'psk'); set_default(config, 'ft_iface', config.network_ifname); if (!config.ft_psk_generate_local) { if (!config.r0kh || !config.r1kh) { if (!config.auth_secret && !config.key) netifd.setup_failed('FT_KEY_CANT_BE_DERIVED'); let ft_key = md5(`${config.mobility_domain}/${config.auth_secret ?? config.key}`); set_default(config, 'r0kh', [ 'ff:ff:ff:ff:ff:ff,*,' + ft_key ]); set_default(config, 'r1kh', [ '00:00:00:00:00:00,00:00:00:00:00:00,' + ft_key ]); } for (let name in [ 'r0kh', 'r1kh' ]) for (let val in config[name]) append(name, join(' ', split(val, ',', 3))); append_vars(config, [ 'r1_key_holder', 'r0_key_lifetime', 'pmk_r1_push' ]); } append_vars(config, [ 'mobility_domain', 'ft_psk_generate_local', 'ft_over_ds', 'reassociation_deadline', 'ft_iface' ]); } function iface_mfp(config) { if (!config.ieee80211w || config.wpa < 2) { append('ieee80211w', 0); return; } if (config.auth_type == 'eap192') config.group_mgmt_cipher = 'BIP-GMAC-256'; else config.group_mgmt_cipher = config.ieee80211w_mgmt_cipher ?? 'AES-128-CMAC'; append_vars(config, [ 'ieee80211w', 'group_mgmt_cipher', 'assoc_sa_query_max_timeout', 'assoc_sa_query_retry_timeout' ]); } function iface_key_caching(config) { if (config.wpa < 2) return; if (config.network_bridge && config.rsn_preauth) { set_default(config, 'okc', true); config.rsn_preauth_interfaces = config.network_bridge; append_vars(config, [ 'rsn_preauth', 'rsn_preauth_interfaces' ]); } else { set_default(config, 'okc', (config.auth_type in [ 'sae', 'psk-sae', 'owe' ])); } if (!config.okc && !config.fils) config.disable_pmksa_caching = 1; append_vars(config, [ 'okc', 'disable_pmksa_caching' ]); } function iface_hs20(config) { if (!config.hs20) return; append_vars(config, [ 'hs20', 'disable_dgaf', 'anqp_domain_id', 'hs20_deauth_req_timeout', 'hs20_wan_metrics', 'hs20_operating_class', 'hs20_t_c_filename', 'hs20_t_c_timestamp', 'hs20_t_c_server_url', 'hs20_conn_capab' ]); } function iface_interworking(config) { if (!config.iw_enabled) return; config.interworking = true; if (config.domain_name) config.domain_name = join(',', config.domain_name); if (config.anqp_3gpp_cell_net) config.domain_name = join(',', config.anqp_3gpp_cell_net); append_vars(config, [ 'interworking', 'internet', 'asra', 'uesa', 'access_network_type', 'hessid', 'venue_group', 'venue_type', 'network_auth_type', 'gas_address3', 'roaming_consortium', 'anqp_elem', 'nai_realm', 'venue_name', 'venue_url', 'domain_name', 'anqp_3gpp_cell_net', ]); } export function generate(interface, data, config, vlans, stas, phy_features) { config.ctrl_interface = '/var/run/hostapd'; config.start_disabled = data.ap_start_disabled; iface_setup(config); iface.parse_encryption(config, data.config); if (data.config.band == '6g') { if (config.auth_type == 'psk-sae') config.auth_type = 'sae'; if (config.auth_type == 'eap-eap2') config.auth_type = 'eap2'; } if (config.auth_type in [ 'psk', 'psk-sae' ]) iface_wpa_stations(config, stas); if (config.auth_type in [ 'sae', 'psk-sae' ]) iface_sae_stations(config, stas); iface_auth_type(config); iface_accounting_server(config); iface_ppsk(config); iface_wps(config); iface_rrm(config); iface_ftm(config, phy_features); iface_macfilter(config); iface_vlan(interface, config, vlans); iface_eap_server(config); iface_roaming(config); iface_mfp(config); iface_key_caching(config); iface_hs20(config); iface_interworking(config); iface.wpa_key_mgmt(config); append_vars(config, [ 'wpa_key_mgmt', ]); if (config.rsn_override_key_mgmt || config.rsn_override_pairwise) { config.rsn_override_mfp ??= config.ieee80211w; config.rsn_override_key_mgmt ??= config.wpa_key_mgmt; config.rsn_override_pairwise ??= config.wpa_pairwise; append_vars(config, [ 'rsn_override_key_mgmt', 'rsn_override_pairwise', 'rsn_override_mfp' ]); if (config.mlo) { config.rsn_override_mfp_2 ??= config.rsn_override_mfp; config.rsn_override_key_mgmt_2 ??= config.rsn_override_key_mgmt; config.rsn_override_pairwise_2 ??= config.rsn_override_pairwise; append_vars(config, [ 'rsn_override_key_mgmt_2', 'rsn_override_pairwise_2', 'rsn_override_mfp_2' ]); } } /* raw options */ for (let raw in config.hostapd_bss_options) append_raw(raw); if (config.mlo) { append_raw('mld_ap=1'); if (data.config.radio != null) append_raw('mld_link_id=' + data.config.radio); } if (config.default_macaddr) append_raw('#default_macaddr'); else if (config.random_macaddr) append_raw('#random_macaddr'); }; 07070101AE2353000081A40000000000000000000000016A426C280000090A000000FE0000000000000000000000000000001E00000000usr/share/ucode/wifi/utils.uc'use strict'; import { readfile, realpath, lsdir } from "fs"; import * as nl80211 from "nl80211"; function phy_filename(phy, name) { return `/sys/class/ieee80211/${phy}/${name}`; } function phy_file(phy, name) { return readfile(phy_filename(phy, name)); } function phy_index(phy) { return +phy_file(phy, "index"); } function phy_path_match(phy, path) { let phy_path = realpath(phy_filename(phy, "device")); return substr(phy_path, -length(path)) == path; } function __find_phy_by_path(phys, path) { if (!path) return null; path = split(path, "+"); phys = filter(phys, (phy) => phy_path_match(phy, path[0])); phys = sort(phys, (a, b) => phy_index(a) - phy_index(b)); return phys[+path[1]]; } function find_phy_by_macaddr(phys, macaddr) { macaddr = lc(macaddr); return filter(phys, (phy) => phy_file(phy, "macaddr") == macaddr)[0]; } function rename_phy_by_name(phys, name, rename) { let data = json(readfile("/etc/board.json")).wlan; if (!data) return; data = data[name]; if (!data) return; let prev_name = __find_phy_by_path(phys, data.path); if (!prev_name) return; if (!rename) return true; let idx = phy_index(prev_name); nl80211.request(nl80211.const.NL80211_CMD_SET_WIPHY, 0, { wiphy: idx, wiphy_name: name }); let prev_idx = index(phys, prev_name); if (prev_idx >= 0) phys[prev_idx] = name; return true; } function find_phy_by_path(phys, path) { let name = __find_phy_by_path(phys, path); if (!name) return; let data = json(readfile("/etc/board.json")).wlan; if (!data || data[name]) return name; for (let cur_name, cur_data in data) { if (!phy_path_match(name, cur_data.path)) continue; let idx = phy_index(name); nl80211.request(nl80211.const.NL80211_CMD_SET_WIPHY, 0, { wiphy: idx, wiphy_name: cur_name }); return cur_name; } return name; } function find_phy_by_name(phys, name, rename) { if (index(phys, name) >= 0) return name; if (!rename_phy_by_name(phys, name, rename)) return; if (!rename) return name; return index(phys, name) < 0 ? null : name; } export function find_phy(config, rename) { let phys = lsdir("/sys/class/ieee80211"); return find_phy_by_path(phys, config.path) ?? find_phy_by_macaddr(phys, config.macaddr) ?? find_phy_by_name(phys, config.phy, rename); }; 07070101AE234E000081A40000000000000000000000016A426C2800000CBD000000FE0000000000000000000000000000001F00000000usr/share/ucode/wifi/common.uc'use strict'; import * as libubus from 'ubus'; import * as nl80211 from 'nl80211'; import * as fs from 'fs'; global.ubus = libubus.connect(); let config_data = ''; let network_data = ''; const nl80211_bands = [ '2g', '5g', '60g', '6g' ]; export function wiphy_info(phy) { let idx = +fs.readfile(`/sys/class/ieee80211/${phy}/index`); return nl80211.request(nl80211.const.NL80211_CMD_GET_WIPHY, nl80211.const.NLM_F_DUMP, { wiphy: idx, split_wiphy_dump: true }); }; export function wiphy_band(info, band) { let band_idx = index(nl80211_bands, band); if (band_idx < 0 || !info) return; return info.wiphy_bands[band_idx]; }; export function log(msg) { printf(`wifi-scripts: ${msg}\n`); }; export function append_raw(value) { config_data += value + '\n'; }; export function append(key, value) { if (value == null) return; switch (type(value)) { case 'array': value = join(' ', value); break; case 'bool': value = value ? 1 : 0; break; } append_raw(key + '=' + value); }; function escape_string(value) { let chars = map(split(value, ''), (v) => ord(v)); if (length(filter(chars, (v) => (v < 32 || v >= 128))) > 0) return hexenc(value); return `"${value}"`; } export function append_string(key, value) { if (value == null) return; append(key, escape_string(value)); }; export function append_vars(dict, keys) { for (let key in keys) append(key, dict[key]); }; export function append_string_vars(dict, keys) { for (let key in keys) append_string(key, dict[key]); }; export function network_append_raw(value) { network_data += value + '\n'; }; export function network_append(key, value) { if (value == null) return; switch (type(value)) { case 'array': value = join(' ', value); break; case 'bool': value = value ? 1 : 0; break; } network_append_raw('\t' + key + '=' + value); }; export function network_append_string(key, value) { if (value == null) return; network_append_raw('\t' + key + '=' + escape_string(value)); }; export function network_append_vars(dict, keys) { for (let key in keys) network_append(key, dict[key]); }; export function network_append_string_vars(dict, keys) { for (let key in keys) network_append_string(key, dict[key]); }; export function set_default(dict, key, value) { if (dict[key] == null) dict[key] = value; }; export function push_config(dict, key, option, value) { if (!dict[option]) return; dict[key] ??= []; push(dict[key], value); }; export function touch_file(filename) { let file = fs.open(filename, "a"); if (file) file.close(); else log('Failed to touch ' + filename); }; export function append_value(config, key, value) { if (!config[key]) config[key] = value; else config[key] += ' ' + value; }; export function comment(comment) { append_raw('\n# ' + comment); }; export function dump_config(file) { if (file) fs.writefile(file, config_data); return config_data; }; export function dump_network(file) { config_data += 'network={\n'; config_data += network_data;; config_data += '}\n'; if (file) fs.writefile(file, config_data); return config_data; }; export function flush_config() { config_data = ''; }; export function flush_network() { config_data = ''; network_data = ''; }; 07070101AE2354000081A40000000000000000000000016A426C2800000A41000000FE0000000000000000000000000000002100000000usr/share/ucode/wifi/validate.uc'use strict'; import { log } from 'wifi.common'; import * as fs from 'fs'; const schemas = { device: json(fs.readfile('/usr/share/schema/wireless.wifi-device.json')).properties, iface: json(fs.readfile('/usr/share/schema/wireless.wifi-iface.json')).properties, vlan: json(fs.readfile('/usr/share/schema/wireless.wifi-vlan.json')).properties, station: json(fs.readfile('/usr/share/schema/wireless.wifi-station.json')).properties, }; const types = { "array": 1, "string": 3, "number": 5, "boolean": 7, }; function dump_option(schema, key) { let _key = (schema[key].type == 'alias') ? schema[key].default : key; return [ key, types[schema[_key].type] ]; } export function dump_options() { let dump = { "name": "mac80211", }; for (let k, v in schemas) { dump[k] = []; for (let option in v) push(dump[k], dump_option(v, option)); }; printf('%J\n', dump); return 0; }; function abort(msg) { log(msg); die(); } function validate_value(schema, key, value) { switch(schema.type) { case 'number': value = +value; if (schema.minimum && value < schema.minimum) abort(`${key}: ${value} is lower than the minimum value`); if (schema.maximum && value > schema.maximum) abort(`${key}: ${value} is larger than the maximum value`); if (schema.enum && !(value in schema.enum)) abort(`${key}: ${value} has to be one of ${schema.enum}`); break; case 'boolean': value = !!+value; break; case 'string': if (schema.enum && !(value in schema.enum)) abort(`${key}: ${value} has to be one of ${schema.enum}`); break; case 'array': if (type(value) != 'array') value = [ value ]; if (schema.items?.type) for (let k, v in value) value[k] = validate_value(schema.items, key, v); break; } return value; } export function validate(schema, dict) { schema = schemas[schema]; /* complain about anything that is not in the schema */ for (let k, v in dict) { if (substr(k, 0, 1) == '.') continue; if (schema[k]) continue; log(`${k} is not present in the schema`); } /* convert all aliases */ for (let k, v in dict) { if (schema[k]?.type != 'alias') continue; if (schema[k].default == null) abort(`${k} alias does not have a default value`); dict[schema[k].default] = v; delete dict[k]; } /* set defaults */ for (let k, v in schema) { if (schema[k]?.type == 'alias') continue; if (dict[k] != null || schema[k].default == null) continue; dict[k] = schema[k].default; } /* validate value constraints */ for (let k, v in dict) { if (!schema[k]) continue; dict[k] = validate_value(schema[k], k, v); } }; 07070101AE2350000081A40000000000000000000000016A426C280000171A000000FE0000000000000000000000000000001E00000000usr/share/ucode/wifi/iface.uc'use strict'; import { append_value, log } from 'wifi.common'; import * as fs from 'fs'; export function parse_encryption(config, dev_config) { if (!config.encryption) return; let encryption = split(config.encryption, '+', 2); config.wpa = 0; for (let k, v in { 'wpa2*': 2, 'wpa3*': 2, '*psk2*': 2, 'psk3*': 2, 'sae*': 2, 'owe*': 2, 'wpa*mixed*': 3, '*psk*mixed*': 3, 'wpa*': 1, '*psk*': 1, }) if (wildcard(config.encryption, k)) { config.wpa = v; break; } config.wpa_pairwise = null; if (config.wpa) config.wpa_pairwise = (config.hw_mode == 'ad') ? 'GCMP' : 'CCMP'; config.auth_type = encryption[0] ?? 'none'; let wpa3_pairwise = config.wpa_pairwise; if (wildcard(dev_config?.htmode, 'EHT*') || wildcard(dev_config?.htmode, 'HE*')) wpa3_pairwise = 'GCMP-256 ' + wpa3_pairwise; switch(config.auth_type) { case 'owe': config.auth_type = 'owe'; break; case 'wpa3-192': config.auth_type = 'eap192'; break; case 'wpa3-mixed': config.auth_type = 'eap-eap2'; break; case 'wpa3': config.auth_type = 'eap2'; break; case 'psk': case 'psk2': case 'psk-mixed': config.auth_type = 'psk'; wpa3_pairwise = null; break; case 'sae': case 'psk3': config.auth_type = 'sae'; break; case 'psk3-mixed': case 'sae-mixed': config.auth_type = 'psk-sae'; break; case 'wpa': case 'wpa2': case 'wpa-mixed': config.auth_type = 'eap'; wpa3_pairwise = null; break; default: config.wpa_pairwise = null; wpa3_pairwise = null; break; } switch(encryption[1]){ case 'tkip+aes': case 'tkip+ccmp': case 'aes+tkip': case 'ccmp+tkip': config.wpa_pairwise = 'CCMP TKIP'; break; case 'ccmp256': config.wpa_pairwise = 'CCMP-256'; break; case 'aes': case 'ccmp': config.wpa_pairwise = 'CCMP'; break; case 'tkip': config.wpa_pairwise = 'TKIP'; break; case 'gcmp256': config.wpa_pairwise = 'GCMP-256'; break; case 'gcmp': config.wpa_pairwise = 'GCMP'; break; default: if (config.encryption == 'wpa3-192') { config.wpa_pairwise = 'GCMP-256'; break; } if (!wpa3_pairwise) break; if (config.rsn_override && wpa3_pairwise != config.wpa_pairwise) config.rsn_override_pairwise = wpa3_pairwise; else config.wpa_pairwise = wpa3_pairwise; break; } }; export function wpa_key_mgmt(config) { if (!config.wpa) return; switch(config.auth_type) { case 'psk': case 'psk2': append_value(config, 'wpa_key_mgmt', 'WPA-PSK'); if (config.wpa >= 2 && config.ieee80211r) append_value(config, 'wpa_key_mgmt', 'FT-PSK'); if (config.ieee80211w) append_value(config, 'wpa_key_mgmt', 'WPA-PSK-SHA256'); break; case 'eap': append_value(config, 'wpa_key_mgmt', 'WPA-EAP'); if (config.wpa >= 2 && config.ieee80211r) append_value(config, 'wpa_key_mgmt', 'FT-EAP'); if (config.ieee80211w) append_value(config, 'wpa_key_mgmt', 'WPA-EAP-SHA256'); break; case 'eap192': append_value(config, 'wpa_key_mgmt', 'WPA-EAP-SUITE-B-192'); if (config.ieee80211r) append_value(config, 'wpa_key_mgmt', 'FT-EAP-SHA384'); break; case 'eap-eap2': append_value(config, 'wpa_key_mgmt', 'WPA-EAP-SHA256'); if (config.ieee80211r) append_value(config, 'wpa_key_mgmt', 'FT-EAP'); if (config.rsn_override) config.rsn_override_key_mgmt = config.wpa_key_mgmt; append_value(config, 'wpa_key_mgmt', 'WPA-EAP'); break; case 'eap2': append_value(config, 'wpa_key_mgmt', 'WPA-EAP-SHA256'); if (config.ieee80211r) append_value(config, 'wpa_key_mgmt', 'FT-EAP'); break; case 'sae': append_value(config, 'wpa_key_mgmt', 'SAE'); if (config.ieee80211r) append_value(config, 'wpa_key_mgmt', 'FT-SAE'); break; case 'psk-sae': append_value(config, 'wpa_key_mgmt', 'SAE'); if (config.ieee80211r) append_value(config, 'wpa_key_mgmt', 'FT-SAE'); if (config.rsn_override) { config.rsn_override_key_mgmt = config.wpa_key_mgmt; append_value(config, 'rsn_override_key_mgmt_2', 'SAE-EXT-KEY'); if (config.ieee80211r) append_value(config, 'rsn_override_key_mgmt_2', 'FT-SAE-EXT-KEY'); } if (config.rsn_override > 1) delete config.wpa_key_mgmt; append_value(config, 'wpa_key_mgmt', 'WPA-PSK'); if (config.ieee80211w) append_value(config, 'wpa_key_mgmt', 'WPA-PSK-SHA256'); if (config.ieee80211r) append_value(config, 'wpa_key_mgmt', 'FT-PSK'); break; case 'owe': append_value(config, 'wpa_key_mgmt', 'OWE'); break; } if (config.fils) { switch(config.auth_type) { case 'eap192': append_value(config, 'wpa_key_mgmt', 'FILS-SHA384'); if (config.ieee80211r) append_value(config, 'wpa_key_mgmt', 'FT-FILS-SHA384'); break; case 'eap-eap2': case 'eap2': case 'eap': append_value(config, 'wpa_key_mgmt', 'FILS-SHA256'); if (config.ieee80211r) append_value(config, 'wpa_key_mgmt', 'FT-FILS-SHA256'); if (!config.rsn_override_key_mgmt) break; append_value(config, 'rsn_override_key_mgmt', 'FILS-SHA256'); if (config.ieee80211r) append_value(config, 'rsn_override_key_mgmt', 'FT-FILS-SHA256'); break; } } config.key_mgmt = config.wpa_key_mgmt; }; function macaddr_random() { let f = fs.open("/dev/urandom", "r"); let addr = f.read(6); addr = map(split(addr, ""), (v) => ord(v)); addr[0] &= ~1; addr[0] |= 2; return join(":", map(addr, (v) => sprintf("%02x", v))); } let mac_idx = 0; export function prepare(data, phy, num_global_macaddr, macaddr_base) { if (!data.macaddr) { let pipe = fs.popen(`ucode /usr/share/hostap/wdev.uc ${phy} get_macaddr id=${mac_idx} num_global=${num_global_macaddr} mbssid=${data.mbssid ?? 0} macaddr_base=${macaddr_base ?? ""}`); data.macaddr = trim(pipe.read("all"), '\n'); pipe.close(); data.default_macaddr = true; mac_idx++; } else if (data.macaddr == 'random') { data.macaddr = macaddr_random(); data.random_macaddr = true; } log(`Preparing interface: ${data.ifname} with MAC: ${data.macaddr}`); }; 07070101AE234F000081A40000000000000000000000016A426C28000047B2000000FE0000000000000000000000000000002000000000usr/share/ucode/wifi/hostapd.uc'use strict'; import { append, append_raw, append_vars, dump_config, flush_config, set_default, wiphy_info, wiphy_band } from 'wifi.common'; import { validate } from 'wifi.validate'; import * as netifd from 'wifi.netifd'; import * as iface from 'wifi.iface'; import * as nl80211 from 'nl80211'; import * as ap from 'wifi.ap'; import * as fs from 'fs'; const NL80211_EXT_FEATURE_ENABLE_FTM_RESPONDER = 33; const NL80211_EXT_FEATURE_RADAR_BACKGROUND = 61; let phy_features = {}; let phy_capabilities = {}; /* make sure old style UCI and hwmode and newer band properties are correctly resolved */ function set_device_defaults(config) { /* validate the hw mode */ if (config.hw_mode in [ '11a', '11b', '11g', '11ad' ]) config.hw_mode = substr(config.hw_mode, 2); else if (config.channel > 14) config.hw_mode = 'a'; else config.hw_mode = 'g'; /* validate band */ if (config.band == '2g') config.hw_mode = 'g'; else if (config.band in [ '5g', '6g', '60g' ]) config.hw_mode = 'a'; else switch (config.hw_mode) { case 'a': config.band = '5g'; break; case 'ad': config.band = '60g'; break; default: config.band = '2g'; break; } } /* setup sylog / stdout */ function device_log_append(config) { let log_mask = 0; for (let k in [ 'log_mlme', 'log_iapp', 'log_driver', 'log_wpa', 'log_radius', 'log_8021x', 'log_80211' ]) { log_mask <<= 1; log_mask |= config[k] ? 1 : 0; } append('logger_syslog', log_mask); append('logger_syslog_level', config.log_level); append('logger_stdout', log_mask); append('logger_stdout_level', config.log_level); } /* setup country code */ function device_country_code(config) { let status = global.ubus.call('network.wireless', 'status'); for (let name, radio in status) { if (!radio.config.country) continue; config.country_code = radio.config.country; } if (!exists(config, 'country_code')) return; if (config.hw_mode != 'a') delete config.ieee80211h; append_vars(config, [ 'country_code', 'country3', 'ieee80211h' ]); if (config.ieee80211d) append_vars(config, [ 'ieee80211d', 'local_pwr_constraint', 'spectrum_mgmt_required' ]); } /* setup cell density */ function device_cell_density_append(config) { switch (config.hw_mode) { case 'b': if (config.cell_density == 1) { config.supported_rates ??= [ 5500, 11000 ]; config.basic_rates ??= [ 5500, 11000 ]; } else if (config.cell_density > 2) { config.supported_rates ??= [ 11000 ]; config.basic_rates ??= [ 11000 ]; } ;; case 'g': if (config.cell_density in [ 0, 1 ]) { if (!config.legacy_rates) { config.supported_rates ??= [ 6000, 9000, 12000, 18000, 24000, 36000, 48000, 54000 ]; config.basic_rates ??= [ 6000, 12000, 24000 ]; } else if (config.cell_density == 1) { config.supported_rates ??= [ 5500, 6000, 9000, 11000, 12000, 18000, 24000, 36000, 48000, 54000 ]; config.basic_rates ??= [ 5500, 11000 ]; } } else if (config.cell_density == 2 || (config.cell_density > 3 && config.legacy_rates)) { if (!config.legacy_rates) { config.supported_rates ??= [ 12000, 18000, 24000, 36000, 48000, 54000 ]; config.basic_rates ??= [ 12000, 24000 ]; } else { config.supported_rates ??= [ 11000, 12000, 18000, 24000, 36000, 48000, 54000 ]; config.basic_rates ??= [ 11000 ]; } } else if (config.cell_density > 2) { config.supported_rates ??= [ 24000, 36000, 48000, 54000 ]; config.basic_rates ??= [ 24000 ]; } ;; case 'a': switch (config.cell_density) { case 1: config.supported_rates ??= [ 6000, 9000, 12000, 18000, 24000, 36000, 48000, 54000 ]; config.basic_rates ??= [ 6000, 12000, 24000 ]; break; case 2: config.supported_rates ??= [ 12000, 18000, 24000, 36000, 48000, 54000 ]; config.basic_rates ??= [ 12000, 24000 ]; break; case 3: config.supported_rates ??= [ 24000, 36000, 48000, 54000 ]; config.basic_rates ??= [ 24000 ]; break; } } } function device_rates(config) { for (let key in [ 'supported_rates', 'basic_rates' ]) config[key] = map(config[key], x => x / 100); append_vars(config, [ 'beacon_rate', 'supported_rates', 'basic_rates' ]); } function device_htmode_append(config) { config.channel_offset = config.band == '6g' ? 1 : 0; /* 802.11n */ config.ieee80211n = 0; if (config.band != '6g') { if (config.htmode in [ 'VHT20', 'HT20', 'HE20', 'EHT20' ]) { config.ieee80211n = 1; config.ht_capab = ''; } if (config.htmode in [ 'HT40', 'HT40+', 'HT40-', 'VHT40', 'VHT80', 'VHT160', 'HE40', 'HE80', 'HE160', 'EHT40', 'EHT80', 'EHT160' ]) { config.ieee80211n = 1; if (!config.channel) config.ht_capab = '[HT40+]'; else switch (config.hw_mode) { case 'a': switch (((config.channel / 4) + config.channel_offset) % 2) { case 0: config.ht_capab = '[HT40-]'; break; case 1: config.ht_capab = '[HT40+]'; break; } break; default: switch (config.htmode) { case 'HT40+': case 'HT40-': config.ht_capab = '[' + config.htmode + ']'; break; default: if (config.channel < 7) config.ht_capab = '[HT40+]'; else config.ht_capab = '[HT40-]'; break; } } } if (config.ieee80211n) { let ht_capab = phy_capabilities.ht_capa; if (ht_capab & 0x1 && config.ldpc) config.ht_capab += '[LDPC]'; if (ht_capab & 0x10 && config.greenfield) config.ht_capab += '[GF]'; if (ht_capab & 0x20 && config.short_gi_20) config.ht_capab += '[SHORT-GI-20]'; if (ht_capab & 0x40 && config.short_gi_40) config.ht_capab += '[SHORT-GI-40]'; if (ht_capab & 0x80 && config.tx_stbc) config.ht_capab += '[TX-STBC]'; if (ht_capab & 0x800 && config.max_amsdu) config.ht_capab += '[MAX-AMSDU-7935]'; if (ht_capab & 0x1000 && config.dsss_cck_40) config.ht_capab += '[DSSS_CCK-40]'; let rx_stbc = [ '', '[RX-STBC1]', '[RX-STBC12]', '[RX-STBC123]' ]; config.ht_capab += rx_stbc[min(config.rx_stbc, (ht_capab >> 8) & 3)]; append_vars(config, [ 'ieee80211n', 'ht_coex', 'ht_capab' ]); } } /* 802.11ac */ config.ieee80211ac = 1; config.vht_oper_centr_freq_seg0_idx = 0; config.vht_oper_chwidth = 0; switch (config.htmode) { case 'VHT20': case 'HE20': case 'EHT20': break; case 'VHT40': case 'HE40': case 'EHT40': config.vht_oper_centr_freq_seg0_idx = config.channel + (((config.channel / 4) + config.channel_offset) % 2 ? 2 : -2); break; case 'VHT80': case 'HE80': case 'EHT80': let delta = [ -6, 6, 2, -2 ]; config.vht_oper_centr_freq_seg0_idx = config.channel + delta[((config.channel / 4) + config.channel_offset) % 4]; config.vht_oper_chwidth = 1; break; case 'VHT160': case 'HE160': case 'EHT160': let vht_oper_centr_freq_seg0_idx_map = [[ 64, 50 ], [ 128, 114 ], [ 177, 163 ]]; if (config.band == '6g') vht_oper_centr_freq_seg0_idx_map = [ [ 29, 15 ], [ 61, 47 ], [ 93, 79 ], [ 125, 111 ], [ 157, 143 ], [ 189, 175 ], [ 221, 207 ]]; for (let k, v in vht_oper_centr_freq_seg0_idx_map) if (config.channel >= (v[0] - 28) && config.channel <= v[0]) { config.vht_oper_centr_freq_seg0_idx = v[1]; break; } config.vht_oper_chwidth = 2; break; default: config.ieee80211ac = 0; break; } config.eht_oper_chwidth = config.vht_oper_chwidth; config.eht_oper_centr_freq_seg0_idx = config.vht_oper_centr_freq_seg0_idx; if (config.band == '6g') { config.ieee80211ac = 0; switch(config.htmode) { case 'HE20': case 'EHT20': config.op_class = 131; break; case 'EHT320': let eht_center_seg0_map = [ [ 61, 31 ], [ 125, 95 ], [ 189, 159 ], [ 221, 191 ] ]; for (let k, v in eht_center_seg0_map) if (config.channel <= v[0]) { config.eht_oper_centr_freq_seg0_idx = v[1]; break; } config.op_class = 137; config.eht_oper_chwidth = 7; /* * Set HE operation values for 160MHz backward compatibility * with WiFi 6E clients. Pick the 160MHz half that contains * the primary channel. */ config.he_oper_chwidth = 3; if (config.channel < config.eht_oper_centr_freq_seg0_idx) config.he_oper_centr_freq_seg0_idx = config.eht_oper_centr_freq_seg0_idx - 16; else config.he_oper_centr_freq_seg0_idx = config.eht_oper_centr_freq_seg0_idx + 16; break; case 'HE40': case 'HE80': case 'HE160': case 'EHT40': case 'EHT80': case 'EHT160': config.op_class = 132 + config.eht_oper_chwidth; break; } append_vars(config, [ 'op_class' ]); } if (config.ieee80211ac && config.hw_mode == 'a') { /* VHT capab */ if (config.vht_oper_chwidth < 2) { config.vht160 = 0; config.short_gi_160 = 0; } set_default(config, 'tx_queue_data2_burst', '2.0'); let vht_capab = phy_capabilities.vht_capa; config.vht_capab = ''; if (vht_capab & 0x10 && config.rxldpc) config.vht_capab += '[RXLDPC]'; if (vht_capab & 0x20 && config.short_gi_80) config.vht_capab += '[SHORT-GI-80]'; if (vht_capab & 0x40 && config.short_gi_160) config.vht_capab += '[SHORT-GI-160]'; if (vht_capab & 0x80 && config.tx_stbc_2by1) config.vht_capab += '[TX-STBC-2BY1]'; if (vht_capab & 0x800 && config.su_beamformer) config.vht_capab += '[SU-BEAMFORMER]'; if (vht_capab & 0x1000 && config.su_beamformee) config.vht_capab += '[SU-BEAMFORMEE]'; if (vht_capab & 0x80000 && config.mu_beamformer) config.vht_capab += '[MU-BEAMFORMER]'; if (vht_capab & 0x100000 && config.mu_beamformee) config.vht_capab += '[MU-BEAMFORMEE]'; if (vht_capab & 0x200000 && config.vht_txop_ps) config.vht_capab += '[VHT-TXOP-PS]'; if (vht_capab & 0x400000 && config.htc_vht) config.vht_capab += '[HTC-VHT]'; if (vht_capab & 0x10000000 && config.rx_antenna_pattern) config.vht_capab += '[RX-ANTENNA-PATTERN]'; if (vht_capab & 0x20000000 && config.tx_antenna_pattern) config.vht_capab += '[TX-ANTENNA-PATTERN]'; let rx_stbc = [ '', '[RX-STBC-1]', '[RX-STBC-12]', '[RX-STBC-123]', '[RX-STBC-1234]' ]; config.vht_capab += rx_stbc[min(config.rx_stbc, (vht_capab >> 8) & 7)]; if (vht_capab & 0x800 && config.su_beamformer) config.vht_capab += '[SOUNDING-DIMENSION-' + min(((vht_capab >> 16) & 3) + 1, config.beamformer_antennas) + ']'; if (vht_capab & 0x1000 && config.su_beamformee) config.vht_capab += '[BF-ANTENNA-' + min(((vht_capab >> 13) & 3) + 1, config.beamformee_antennas) + ']'; /* supported Channel widths */ if ((vht_capab & 0xc) == 8 && config.vht160 >= 2) config.vht_capab += '[VHT160-80PLUS80]'; else if (((vht_capab & 0xc) == 4 || (vht_capab & 0xc) == 8) && config.vht160 >= 1) config.vht_capab += '[VHT160]'; /* maximum MPDU length */ if ((vht_capab & 3) > 1 && config.vht_max_mpdu >= 11454) config.vht_capab += '[MAX-MPDU-11454]'; else if ((vht_capab & 3) && config.vht_max_mpdu >= 7991) config.vht_capab += '[MAX-MPDU-7991]'; /* maximum A-MPDU length exponent */ let max_a_mpdu_len_exp = (vht_capab >> 20) & 0x38; for (let exp = 7; exp; exp--) if (max_a_mpdu_len_exp >= (0x8 * exp) && exp <= config.vht_max_a_mpdu_len_exp) { config.vht_capab += '[MAX-A-MPDU-LEN-EXP' + exp + ']'; break; } /* whether or not the STA supports link adaptation using VHT variant */ let vht_link_adapt = vht_capab & 0xC000000; if (vht_link_adapt >= 0xC000000 && config.vht_link_adapt > 3) config.vht_capab += '[VHT-LINK-ADAPT-3]'; if (vht_link_adapt >= 0x8000000 && config.vht_link_adapt > 2) config.vht_capab += '[VHT-LINK-ADAPT-2]'; append_vars(config, [ 'ieee80211ac', 'vht_oper_chwidth', 'vht_oper_centr_freq_seg0_idx', 'vht_capab' ]); } /* 802.11ax */ if (wildcard(config.htmode, 'HE*') || wildcard(config.htmode, 'EHT*')) { let he_phy_cap = phy_capabilities.he_phy_cap; let he_mac_cap = phy_capabilities.he_mac_cap; config.ieee80211ax = true; if (config.hw_mode == 'a') { /* * Only set HE values from VHT if not already set. * For 6GHz 320MHz, these are pre-set for 160MHz backward * compatibility with WiFi 6E clients. */ if (!config.he_oper_chwidth) config.he_oper_chwidth = config.vht_oper_chwidth; if (!config.he_oper_centr_freq_seg0_idx) config.he_oper_centr_freq_seg0_idx = config.vht_oper_centr_freq_seg0_idx; } if (config.band == "6g") { config.stationary_ap = true; append_vars(config, [ 'he_6ghz_reg_pwr_type', ]); } if (config.he_bss_color_enabled) { if (config.he_spr_non_srg_obss_pd_max_offset) config.he_spr_sr_control |= 1 << 2; if (!config.he_spr_psr_enabled) config.he_spr_sr_control |= 1; append_vars(config, [ 'he_bss_color', 'he_spr_non_srg_obss_pd_max_offset', 'he_spr_sr_control' ]); } if (!(he_phy_cap[3] & 0x80)) config.he_su_beamformer = false; if (!(he_phy_cap[4] & 0x1)) config.he_su_beamformee = false; if (!(he_phy_cap[4] & 0x2)) config.he_mu_beamformer = false; if (!(he_phy_cap[7] & 0x1)) config.he_spr_psr_enabled = false; if (!(he_mac_cap[0] & 0x1)) config.he_twt_required= false; append_vars(config, [ 'ieee80211ax', 'he_oper_chwidth', 'he_oper_centr_freq_seg0_idx', 'he_su_beamformer', 'he_su_beamformee', 'he_mu_beamformer', 'he_twt_required', 'he_default_pe_duration', 'he_rts_threshold', 'he_mu_edca_qos_info_param_count', 'he_mu_edca_qos_info_q_ack', 'he_mu_edca_qos_info_queue_request', 'he_mu_edca_qos_info_txop_request', 'he_mu_edca_ac_be_aifsn', 'he_mu_edca_ac_be_aci', 'he_mu_edca_ac_be_ecwmin', 'he_mu_edca_ac_be_ecwmax', 'he_mu_edca_ac_be_timer', 'he_mu_edca_ac_bk_aifsn', 'he_mu_edca_ac_bk_aci', 'he_mu_edca_ac_bk_ecwmin', 'he_mu_edca_ac_bk_ecwmax', 'he_mu_edca_ac_bk_timer', 'he_mu_edca_ac_vi_ecwmin', 'he_mu_edca_ac_vi_ecwmax', 'he_mu_edca_ac_vi_aifsn', 'he_mu_edca_ac_vi_aci', 'he_mu_edca_ac_vi_timer', 'he_mu_edca_ac_vo_aifsn', 'he_mu_edca_ac_vo_aci', 'he_mu_edca_ac_vo_ecwmin', 'he_mu_edca_ac_vo_ecwmax', 'he_mu_edca_ac_vo_timer', ]); } if (wildcard(config.htmode, 'EHT*')) { config.ieee80211be = true; append_vars(config, [ 'ieee80211be' ]); if (config.hw_mode == 'a') append_vars(config, [ 'eht_oper_chwidth', 'eht_oper_centr_freq_seg0_idx' ]); } append_vars(config, [ 'tx_queue_data2_burst', 'stationary_ap' ]); } function device_extended_features(data, flag) { return !!(data[flag / 8] | (1 << (flag % 8))); } function device_capabilities(config) { let phy = config.phy; phy = wiphy_info(phy); let band = wiphy_band(phy, config.band); phy_capabilities.ht_capa = band.ht_capa ?? 0; phy_capabilities.vht_capa = band.vht_capa ?? 0; phy_capabilities.he_mac_cap = []; phy_capabilities.he_phy_cap = []; for (let iftype in band.iftype_data) { if (!iftype.iftypes.ap) continue; phy_capabilities.he_mac_cap = iftype.he_cap_mac; phy_capabilities.he_phy_cap = iftype.he_cap_phy; } phy_features.ftm_responder = device_extended_features(phy.extended_features, NL80211_EXT_FEATURE_ENABLE_FTM_RESPONDER); phy_features.radar_background = device_extended_features(phy.extended_features, NL80211_EXT_FEATURE_RADAR_BACKGROUND); } function generate(config) { if (!config) die(`${config.path} is an unknown phy`); device_capabilities(config); append('driver', 'nl80211'); set_device_defaults(config); device_log_append(config); device_country_code(config); device_cell_density_append(config); device_rates(config); /* beacon */ append_vars(config, [ 'beacon_int', 'beacon_rate', 'rnr_beacon' ]); /* wpa_supplicant co-exist */ append_vars(config, [ 'noscan' ]); /* airtime */ if (config.airtime_mode) append_vars(config, [ 'airtime_mode' ]); /* assoc/thresholds */ append_vars(config, [ 'rssi_reject_assoc_rssi', 'rssi_reject_assoc_timeout', 'rssi_ignore_probe_request', 'iface_max_num_sta' ]); /* ACS / Radar*/ if (!phy_features.radar_background || config.band != '5g') delete config.enable_background_radar; else set_default(config, 'enable_background_radar', false); append_vars(config, [ 'acs_chan_bias', 'acs_exclude_dfs', 'enable_background_radar' ]); /* TX Power */ append_vars(config, [ 'min_tx_power' ]); /* hwmode, channel, op_class, ... */ append_vars(config, [ 'hw_mode', 'channel', 'rts_threshold', 'chanlist' ]); if (config.hw_mode in [ 'a', 'g' ] && config.require_mode in [ 'n', 'ac', 'ax' ]) { let require_mode = { n: 'require_ht', ac: 'require_vht', ax: 'require_he' }; config.legacy_rates = false; append(require_mode[config.require_mode], 1); } device_htmode_append(config); if (config.ieee80211ax || config.ieee80211be) append_vars(config, [ 'mbssid' ]); /* 6G power mode */ if (config.band != '6g') append_vars(config, [ 'reg_power_type' ]); /* raw options */ for (let raw in config.hostapd_options) append_raw(raw); } let iface_idx = 0; function setup_interface(interface, data, config, vlans, stas, phy_features, fixup) { config = { ...config, fixup }; config.idx = iface_idx++; ap.generate(interface, data, config, vlans, stas, phy_features); } export function setup(data) { let file_name = `/var/run/hostapd-${data.phy}${data.vif_phy_suffix}.conf`; flush_config(); if (fs.stat(file_name)) fs.rename(file_name, file_name + '.prev'); data.config.phy = data.phy; generate(data.config); if (data.config.num_global_macaddr) append('\n#num_global_macaddr', data.config.num_global_macaddr); if (data.config.macaddr_base) append('\n#macaddr_base', data.config.macaddr_base); let has_ap; for (let k, interface in data.interfaces) { if (interface.config.mode != 'ap') continue; interface.config.network_bridge = interface.bridge; interface.config.network_ifname = interface['bridge-ifname']; let owe = interface.config.encryption == 'owe' && interface.config.owe_transition; setup_interface(k, data, interface.config, interface.vlans, interface.stas, phy_features, owe ? 'owe' : null ); if (owe) setup_interface(k, data, interface.config, interface.vlans, interface.stas, phy_features, 'owe-transition'); has_ap = true; } let config = dump_config(file_name); let msg = { phy: data.phy, radio: data.config.radio, config: has_ap ? file_name : "", prev_config: file_name + '.prev' }; if (!global.ubus.list('hostapd')) system('ubus wait_for hostapd'); let ret = global.ubus.call('hostapd', 'config_set', msg); if (ret) netifd.add_process('/usr/sbin/hostapd', ret.pid, true, true); else netifd.setup_failed('HOSTAPD_START_FAILED'); }; 07070101AE2351000081A40000000000000000000000016A426C2800000431000000FE0000000000000000000000000000001F00000000usr/share/ucode/wifi/netifd.uc'use strict'; import { log } from 'wifi.common'; import * as fs from 'fs'; const CMD_UP = 0; const CMD_SET_DATA = 1; const CMD_PROCESS_ADD = 2; const CMD_PROCESS_KILL_ALL = 3; const CMD_SET_RETRY = 4; export function notify(command, params, data) { params ??= {}; data ??= {}; global.ubus.call('network.wireless', 'notify', { command, device: global.radio, ...params, data }); }; export function set_up() { notify(CMD_UP); }; export function set_data(data) { notify(CMD_SET_DATA, null, data); }; export function add_process(exe, pid, required, keep) { exe = fs.realpath(exe); notify(CMD_PROCESS_ADD, null, { pid, exe, required, keep }); }; export function set_retry(retry) { notify(CMD_SET_RETRY, null, { retry }); }; export function set_vif(interface, ifname) { notify(CMD_SET_DATA, { interface }, { ifname }); }; export function set_vlan(interface, ifname, vlan) { notify(CMD_SET_DATA, { interface, vlan }, { ifname }); }; export function setup_failed(reason) { log(`Device setup failed: ${reason}`); printf('%s\n', reason); set_retry(false); }; 07070101AE230C000041ED0000000000000000000000036A426C2800000000000000FE0000000000000000000000000000001400000000usr/share/firewall407070101AE230E000081A40000000000000000000000016A426C2800000BC8000000FE0000000000000000000000000000001C00000000usr/share/firewall4/main.uc{% let fw4 = require("fw4"); function read_state() { let state = fw4.read_state(); if (!state) { warn("Unable to read firewall state - do you need to start the firewall?\n"); exit(1); } return state; } function reload_sets() { let state = read_state(), sets = fw4.check_set_types(); for (let set in state.ipsets) { if (!set.loadfile && !length(set.entries)) continue; if (!exists(sets, set.name)) { warn(`Named set '${set.name}' does not exist - do you need to restart the firewall?\n`); continue; } else if (fw4.concat(sets[set.name]) != fw4.concat(set.types)) { warn(`Named set '${set.name}' has a different type - want '${fw4.concat(set.types)}' but is '${fw4.concat(sets[set.name])}' - do you need to restart the firewall?\n`); continue; } let first = true; let printer = (entry) => { if (first) { print(`add element inet fw4 ${set.name} {\n`); first = false; } print(` ${join(" . ", entry)},\n`); }; print(`flush set inet fw4 ${set.name}\n`); map(set.entries, printer); if (set.loadfile) fw4.parse_setfile(set, printer); if (!first) print("}\n\n"); } } function render_ruleset(use_statefile) { fw4.load(use_statefile); include("templates/ruleset.uc", { fw4, type, exists, length, include }); } function lookup_network(net) { let state = read_state(); for (let zone in state.zones) { for (let network in (zone.network || [])) { if (network.device == net) { print(zone.name, "\n"); exit(0); } } } exit(1); } function lookup_device(dev) { let state = read_state(); for (let zone in state.zones) { for (let rule in (zone.match_rules || [])) { if (dev in rule.devices_pos) { print(zone.name, "\n"); exit(0); } } } exit(1); } function lookup_zone(name, dev) { let state = read_state(); for (let zone in state.zones) { if (zone.name == name) { let devices = []; map(zone.match_rules, (r) => push(devices, ...(r.devices_pos || []))); if (dev) { if (dev in devices) { print(dev, "\n"); exit(0); } exit(1); } if (length(devices)) print(join("\n", devices), "\n"); exit(0); } } exit(1); } function run_includes() { let state = read_state(), paths = []; for (let inc in state.includes) { if (inc.type != 'script') continue; let path = replace(inc.path, "'", "'\\''"); let rc = system([ 'sh', '-c', `exec 1000>&-; config() { echo "You cannot use UCI in firewall includes!" >&2; exit 1; }; . '${path}'` ], 30000); if (rc != 0) warn(`Include '${inc.path}' failed with exit code ${rc}\n`); } } switch (getenv("ACTION")) { case "start": return render_ruleset(true); case "print": return render_ruleset(false); case "reload-sets": return reload_sets(); case "network": return lookup_network(getenv("OBJECT")); case "device": return lookup_device(getenv("OBJECT")); case "zone": return lookup_zone(getenv("OBJECT"), getenv("DEVICE")); case "includes": return run_includes(); } 07070101AE230D000081A40000000000000000000000016A426C2800000893000000FE0000000000000000000000000000001C00000000usr/share/firewall4/helpersconfig helper option name 'amanda' option description 'Amanda backup and archiving proto' option module 'nf_conntrack_amanda' option family 'any' option proto 'udp' option port '10080' config helper option name 'ftp' option description 'FTP passive connection tracking' option module 'nf_conntrack_ftp' option family 'any' option proto 'tcp' option port '21' config helper option name 'RAS' option description 'RAS proto tracking' option module 'nf_conntrack_h323' option family 'any' option proto 'udp' option port '1719' config helper option name 'Q.931' option description 'Q.931 proto tracking' option module 'nf_conntrack_h323' option family 'any' option proto 'tcp' option port '1720' config helper option name 'irc' option description 'IRC DCC connection tracking' option module 'nf_conntrack_irc' option family 'ipv4' option proto 'tcp' option port '6667' config helper option name 'netbios-ns' option description 'NetBIOS name service broadcast tracking' option module 'nf_conntrack_netbios_ns' option family 'ipv4' option proto 'udp' option port '137' config helper option name 'pptp' option description 'PPTP VPN connection tracking' option module 'nf_conntrack_pptp' option family 'ipv4' option proto 'tcp' option port '1723' config helper option name 'sane' option description 'SANE scanner connection tracking' option module 'nf_conntrack_sane' option family 'any' option proto 'tcp' option port '6566' config helper option name 'sip' option description 'SIP VoIP connection tracking' option module 'nf_conntrack_sip' option family 'any' option proto 'udp' option port '5060' config helper option name 'snmp' option description 'SNMP monitoring connection tracking' option module 'nf_conntrack_snmp' option family 'ipv4' option proto 'udp' option port '161' config helper option name 'tftp' option description 'TFTP connection tracking' option module 'nf_conntrack_tftp' option family 'any' option proto 'udp' option port '69' config helper option name 'rtsp' option description 'RTSP connection tracking' option module 'nf_conntrack_rtsp' option family 'ipv4' option proto 'tcp' option port '554' 07070101AE230F000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001E00000000usr/share/firewall4/templates07070101AE2312000081A40000000000000000000000016A426C28000014D3000000FE0000000000000000000000000000002600000000usr/share/firewall4/templates/rule.uc{%+ if (rule.family && !rule.has_addrs): -%} meta nfproto {{ fw4.nfproto(rule.family) }} {%+ endif -%} {%+ if (!rule.proto.any && !rule.has_ports && !rule.icmp_types && !rule.icmp_codes): -%} meta l4proto {{ fw4.l4proto(rule.family, rule.proto) }} {%+ endif -%} {%+ if (rule.iifnames): -%} iifname {{ fw4.set(rule.iifnames) }} {%+ endif -%} {%+ if (rule.oifnames): -%} oifname {{ fw4.set(rule.oifnames) }} {%+ endif -%} {%+ if (rule.saddrs_pos): -%} {{ fw4.ipproto(rule.family) }} saddr {{ fw4.set(rule.saddrs_pos) }} {%+ endif -%} {%+ if (rule.saddrs_neg): -%} {{ fw4.ipproto(rule.family) }} saddr != {{ fw4.set(rule.saddrs_neg) }} {%+ endif -%} {%+ for (let a in rule.saddrs_masked): -%} {{ fw4.ipproto(rule.family) }} saddr & {{ a.mask }} {{ a.invert ? '!=' : '==' }} {{ a.addr }} {%+ endfor -%} {%+ if (rule.daddrs_pos): -%} {{ fw4.ipproto(rule.family) }} daddr {{ fw4.set(rule.daddrs_pos) }} {%+ endif -%} {%+ if (rule.daddrs_neg): -%} {{ fw4.ipproto(rule.family) }} daddr != {{ fw4.set(rule.daddrs_neg) }} {%+ endif -%} {%+ for (let a in rule.daddrs_masked): -%} {{ fw4.ipproto(rule.family) }} daddr & {{ a.mask }} {{ a.invert ? '!=' : '==' }} {{ a.addr }} {%+ endfor -%} {%+ if (rule.sports_pos): -%} {{ rule.proto.name }} sport {{ fw4.set(rule.sports_pos) }} {%+ endif -%} {%+ if (rule.sports_neg): -%} {{ rule.proto.name }} sport != {{ fw4.set(rule.sports_neg) }} {%+ endif -%} {%+ if (rule.dports_pos): -%} {{ rule.proto.name }} dport {{ fw4.set(rule.dports_pos) }} {%+ endif -%} {%+ if (rule.dports_neg): -%} {{ rule.proto.name }} dport != {{ fw4.set(rule.dports_neg) }} {%+ endif -%} {%+ if (rule.smacs_pos): -%} ether saddr {{ fw4.set(rule.smacs_pos) }} {%+ endif -%} {%+ if (rule.smacs_neg): -%} ether saddr != {{ fw4.set(rule.smacs_neg) }} {%+ endif -%} {%+ if (rule.icmp_types): -%} {{ (rule.family == 4) ? "icmp" : "icmpv6" }} type {{ fw4.set(rule.icmp_types) }} {%+ endif -%} {%+ if (rule.icmp_codes): -%} {{ (rule.family == 4) ? "icmp" : "icmpv6" }} type . {{ (rule.family == 4) ? "icmp" : "icmpv6" }} code {{ fw4.set(rule.icmp_codes, true) }} {%+ endif -%} {%+ if (rule.helper): -%} ct helper{% if (rule.helper.invert): %} !={% endif %} {{ fw4.quote(rule.helper.name, true) }} {%+ endif -%} {%+ if (rule.limit): -%} limit rate {{ rule.limit.rate }}/{{ rule.limit.unit }} {%- if (rule.limit_burst): %} burst {{ rule.limit_burst }} packets{% endif %} {%+ endif -%} {%+ if (rule.start_date && rule.stop_date): -%} meta time {{ fw4.datestamp(rule.start_date) }}-{{ fw4.datestamp(rule.stop_date) }} {%+ elif (rule.start_date): -%} meta time >= {{ fw4.datestamp(rule.start_date) }} {%+ elif (rule.stop_date): -%} meta time <= {{ fw4.datestamp(rule.stop_date) }} {%+ endif -%} {%+ if (rule.start_time && rule.stop_time): -%} meta hour {{ fw4.time(rule.start_time) }}-{{ fw4.time(rule.stop_time) }} {%+ elif (rule.start_time): -%} meta hour >= {{ fw4.time(rule.start_time) }} {%+ elif (rule.stop_time): -%} meta hour <= {{ fw4.time(rule.stop_time) }} {%+ endif -%} {%+ if (rule.weekdays): -%} meta day{% if (rule.weekdays.invert): %} !={% endif %} {{ fw4.set(rule.weekdays.days) }} {%+ endif -%} {%+ if (rule.mark && rule.mark.mask < 0xFFFFFFFF): -%} meta mark and {{ fw4.hex(rule.mark.mask) }} {{ rule.mark.invert ? '!=' : '==' }} {{ fw4.hex(rule.mark.mark) }} {%+ endif -%} {%+ if (rule.mark && rule.mark.mask == 0xFFFFFFFF): -%} meta mark{% if (rule.mark.invert): %} !={% endif %} {{ fw4.hex(rule.mark.mark) }} {%+ endif -%} {%+ if (rule.dscp): -%} {{ fw4.ipproto(rule.family) }} dscp{% if (rule.dscp.invert): %} !={% endif %} {{ fw4.hex(rule.dscp.dscp) }} {%+ endif -%} {%+ if (rule.ipset): -%} {{ fw4.concat(rule.ipset.fields) }}{{ rule.ipset.invert ? ' !=' : '' }} @{{ rule.ipset.name }} {%+ endif -%} {%+ if (rule.log && rule.log_limit): -%} limit rate {{ rule.log_limit.rate }}/{{ rule.log_limit.unit }} log prefix {{ fw4.quote(rule.log, true) }} {%+ include("rule.uc", { fw4, zone, rule: { ...rule, log: 0 } }) %} {%+ elif (rule.log && zone?.log_limit): -%} limit name "{{ zone.name }}.log_limit" log prefix {{ fw4.quote(rule.log, true) }} {%+ include("rule.uc", { fw4, zone, rule: { ...rule, log: 0 } }) %} {%+ else -%} {%+ if (rule.counter): -%} counter {%+ endif -%} {%+ if (rule.log): -%} log prefix {{ fw4.quote(rule.log, true) }} {%+ endif -%} {%+ if (rule.target == "mark"): -%} meta mark set {{ (rule.set_xmark.mask == 0xFFFFFFFF) ? fw4.hex(rule.set_xmark.mark) : (rule.set_xmark.mark == 0) ? `mark and ${fw4.hex(~rule.set_xmark.mask & 0xFFFFFFFF)}` : (rule.set_xmark.mark == rule.set_xmark.mask) ? `mark or ${fw4.hex(rule.set_xmark.mark)}` : (rule.set_xmark.mask == 0) ? `mark xor ${fw4.hex(rule.set_xmark.mark)}` : `mark and ${fw4.hex(~rule.set_xmark.mask & 0xFFFFFFFF)} xor ${fw4.hex(rule.set_xmark.mark)}` }} {%+ elif (rule.target == "dscp"): -%} {{ fw4.ipproto(rule.family) }} dscp set {{ fw4.hex(rule.set_dscp.dscp) }} {%+ elif (rule.target == "notrack"): -%} notrack {%+ elif (rule.target == "helper"): -%} ct helper set {{ fw4.quote(rule.set_helper.name, true) }} {%+ elif (rule.jump_chain): -%} jump {{ rule.jump_chain }} {%+ elif (rule.target): -%} {{ rule.target }} {%+ endif -%} comment {{ fw4.quote(`!fw4: ${rule.name}`, true) }} {%+ endif -%} 07070101AE2314000081A40000000000000000000000016A426C2800000266000000FE0000000000000000000000000000003300000000usr/share/firewall4/templates/zone-drop-invalid.uc{%+ if (zone.masq ^ zone.masq6): -%} meta nfproto {{ fw4.nfproto(zone.masq ? 4 : 6) }} {%+ endif -%} {%+ include("zone-match.uc", { egress: true, rule }) -%} ct state invalid {%+ if ((zone.log & 1) && zone.log_limit): -%} limit name "{{ zone.name }}.log_limit" log prefix "drop {{ zone.name }} invalid ct state: " {%+ include("zone-drop-invalid.uc", { fw4, zone: { ...zone, log: 0 }, rule }) %} {%+ else -%} {%+ if (zone.counter): -%} counter {%+ endif -%} {%+ if (zone.log & 1): -%} log prefix "drop {{ zone.name }} invalid ct state: " {%+ endif -%} drop comment "!fw4: Prevent NAT leakage" {%+ endif -%} 07070101AE2319000081A40000000000000000000000016A426C2800000360000000FE0000000000000000000000000000002E00000000usr/share/firewall4/templates/zone-notrack.uc{%+ let devs = fw4.filter_loopback_devs(fw4.devices_pos, output), nets = fw4.filter_loopback_addrs(fw4.subnets_pos, output); if (!((output && (length(devs) || length(nets))) || (!output && (rule.devices_neg || rule.subnets_neg || length(devs) || length(nets))))) return; -%} {%+ if (rule.family): -%} meta nfproto {{ fw4.nfproto(rule.family) }} {%+ endif -%} {%+ if (length(devs)): -%} iifname {{ fw4.set(devs) }} {%+ endif -%} {%+ if (rule.devices_neg): -%} iifname != {{ fw4.set(rule.devices_neg) }} {%+ endif -%} {%+ if (length(nets)): -%} {{ fw4.ipproto(rule.family) }} saddr {{ fw4.set(nets) }} {%+ endif -%} {%+ if (rule.subnets_neg): -%} {{ fw4.ipproto(rule.family) }} saddr != {{ fw4.set(rule.subnets_neg) }} {%+ endif -%} jump notrack_{{ zone.name }} comment "!fw4: {{ zone.name }} {{ fw4.nfproto(rule.family, true) }} CT bypass" 07070101AE2316000081A40000000000000000000000016A426C28000003A5000000FE0000000000000000000000000000002B00000000usr/share/firewall4/templates/zone-masq.ucmeta nfproto {{ fw4.nfproto(family) }} {%+ if (saddrs && saddrs[0]): -%} {{ fw4.ipproto(family) }} saddr {{ fw4.set(map(saddrs[0], fw4.cidr)) }} {%+ endif -%} {%+ if (saddrs && saddrs[1]): -%} {{ fw4.ipproto(family) }} saddr != {{ fw4.set(map(saddrs[1], fw4.cidr)) }} {%+ endif -%} {%+ for (let a in (saddrs ? saddrs[2] : [])): -%} {{ fw4.ipproto(family) }} saddr & {{ a.mask }} {{ a.invert ? '!=' : '==' }} {{ a.addr }} {%+ endfor -%} {%+ if (daddrs && daddrs[0]): -%} {{ fw4.ipproto(family) }} daddr {{ fw4.set(map(daddrs[0], fw4.cidr)) }} {%+ endif -%} {%+ if (daddrs && daddrs[1]): -%} {{ fw4.ipproto(family) }} daddr != {{ fw4.set(map(daddrs[1], fw4.cidr)) }} {%+ endif -%} {%+ for (let a in (daddrs ? daddrs[2] : [])): -%} {{ fw4.ipproto(family) }} daddr & {{ a.mask }} {{ a.invert ? '!=' : '==' }} {{ a.addr }} {%+ endfor -%} masquerade comment "!fw4: Masquerade {{ fw4.nfproto(family, true) }} {{ zone.name }} traffic" 07070101AE231A000081A40000000000000000000000016A426C280000038B000000FE0000000000000000000000000000002E00000000usr/share/firewall4/templates/zone-verdict.uc{%+ if (rule.family): -%} meta nfproto {{ fw4.nfproto(rule.family) }} {%+ endif -%} {%+ include("zone-match.uc", { egress, rule }) -%} {%+ if (verdict != "accept" && (zone.log & 1) && zone.log_limit): -%} limit name "{{ zone.name }}.log_limit" log prefix "{{ verdict }} {{ zone.name }} {{ egress ? "out" : "in" }}: " {%+ include("zone-verdict.uc", { fw4, zone: { ...zone, log: 0 }, rule, egress, verdict }) %} {%+ else -%} {%+ if (zone.counter): -%} counter {%+ endif -%} {%+ if (verdict != "accept" && (zone.log & 1)): -%} log prefix "{{ verdict }} {{ zone.name }} {{ egress ? "out" : "in" }}: " {%+ endif -%} {% if (verdict == "reject"): -%} jump handle_reject comment "!fw4: reject {{ zone.name }} {{ fw4.nfproto(rule.family, true) }} traffic" {% else -%} {{ verdict }} comment "!fw4: {{ verdict }} {{ zone.name }} {{ fw4.nfproto(rule.family, true) }} traffic" {% endif -%} {% endif -%} 07070101AE2315000081A40000000000000000000000016A426C2800000168000000FE0000000000000000000000000000002B00000000usr/share/firewall4/templates/zone-jump.uc{%+ if (rule.family): -%} meta nfproto {{ fw4.nfproto(rule.family) }} {%+ endif -%} {%+ include("zone-match.uc", { egress: (direction in ["output", "srcnat"]), rule }) -%} jump {{ direction }}_{{ zone.name }} comment "!fw4: Handle {{ zone.name }} {{ fw4.nfproto(rule.family, true) }} {{ direction }} {{ (direction == 'helper') ? "assignment" : "traffic" }}" 07070101AE2318000081A40000000000000000000000016A426C2800000194000000FE0000000000000000000000000000002D00000000usr/share/firewall4/templates/zone-mssfix.uc{%+ if (rule.family): -%} meta nfproto {{ fw4.nfproto(rule.family) }} {%+ endif -%} {%+ include("zone-match.uc", { egress, rule }) -%} tcp flags syn / syn,fin,rst tcp option maxseg size set rt mtu {%+ if (zone.log & 2): -%} log prefix "MSSFIX {{ zone.name }} out: " {%+ endif -%} comment "!fw4: Zone {{ zone.name }} {{ fw4.nfproto(rule.family, true) }} {{ egress ? "egress" : "ingress" }} MTU fixing" 07070101AE2311000081A40000000000000000000000016A426C280000125C000000FE0000000000000000000000000000002A00000000usr/share/firewall4/templates/redirect.uc{%+ if (redirect.family && !redirect.has_addrs): -%} meta nfproto {{ fw4.nfproto(redirect.family) }} {%+ endif -%} {%+ if (!redirect.proto.any && !redirect.has_ports): -%} meta l4proto {{ (redirect.proto.name == 'icmp' && redirect.family == 6) ? 'ipv6-icmp' : redirect.proto.name }} {%+ endif -%} {%+ if (redirect.device): -%} oifname {{ fw4.quote(redirect.device, true) }} {%+ endif -%} {%+ if (redirect.saddrs_pos): -%} {{ fw4.ipproto(redirect.family) }} saddr {{ fw4.set(redirect.saddrs_pos) }} {%+ endif -%} {%+ if (redirect.saddrs_neg): -%} {{ fw4.ipproto(redirect.family) }} saddr != {{ fw4.set(redirect.saddrs_neg) }} {%+ endif -%} {%+ for (let a in redirect.saddrs_masked): -%} {{ fw4.ipproto(redirect.family) }} saddr & {{ a.mask }} {{ a.invert ? '!=' : '==' }} {{ a.addr }} {%+ endfor -%} {%+ if (redirect.daddrs_pos): -%} {{ fw4.ipproto(redirect.family) }} daddr {{ fw4.set(redirect.daddrs_pos) }} {%+ endif -%} {%+ if (redirect.daddrs_neg): -%} {{ fw4.ipproto(redirect.family) }} daddr != {{ fw4.set(redirect.daddrs_neg) }} {%+ endif -%} {%+ for (let a in redirect.daddrs_masked): -%} {{ fw4.ipproto(redirect.family) }} daddr & {{ a.mask }} {{ a.invert ? '!=' : '==' }} {{ a.addr }} {%+ endfor -%} {%+ if (redirect.sports_pos): -%} {{ redirect.proto.name }} sport {{ fw4.set(redirect.sports_pos) }} {%+ endif -%} {%+ if (redirect.sports_neg): -%} {{ redirect.proto.name }} sport != {{ fw4.set(redirect.sports_neg) }} {%+ endif -%} {%+ if (redirect.dports_pos): -%} {{ redirect.proto.name }} dport {{ fw4.set(redirect.dports_pos) }} {%+ endif -%} {%+ if (redirect.dports_neg): -%} {{ redirect.proto.name }} dport != {{ fw4.set(redirect.dports_neg) }} {%+ endif -%} {%+ if (redirect.smacs_pos): -%} ether saddr {{ fw4.set(redirect.smacs_pos) }} {%+ endif -%} {%+ if (redirect.smacs_neg): -%} ether saddr != {{ fw4.set(redirect.smacs_neg) }} {%+ endif -%} {%+ if (redirect.helper): -%} ct helper{% if (redirect.helper.invert): %} !={% endif %} {{ fw4.quote(redirect.helper.name, true) }} {%+ endif -%} {%+ if (redirect.limit): -%} limit rate {{ redirect.limit.rate }}/{{ redirect.limit.unit }} {%- if (redirect.limit_burst): %} burst {{ redirect.limit_burst }} packets{% endif %} {%+ endif -%} {%+ if (redirect.start_date && redirect.stop_date): -%} meta time {{ fw4.datestamp(redirect.start_date) }}-{{ fw4.datestamp(redirect.stop_date) }} {%+ elif (redirect.start_date): -%} meta time >= {{ fw4.datestamp(redirect.start_date) }} {%+ elif (redirect.stop_date): -%} meta time <= {{ fw4.datestamp(redirect.stop_date) }} {%+ endif -%} {%+ if (redirect.start_time && redirect.stop_time): -%} meta hour {{ fw4.time(redirect.start_time) }}-{{ fw4.time(redirect.stop_time) }} {%+ elif (redirect.start_time): -%} meta hour >= {{ fw4.time(redirect.start_time) }} {%+ elif (redirect.stop_time): -%} meta hour <= {{ fw4.time(redirect.stop_time) }} {%+ endif -%} {%+ if (redirect.weekdays): -%} meta day{% if (redirect.weekdays.invert): %} !={% endif %} {{ fw4.set(redirect.weekdays.days) }} {%+ endif -%} {%+ if (redirect.mark && redirect.mark.mask < 0xFFFFFFFF): -%} meta mark and {{ fw4.hex(redirect.mark.mask) }} {{ redirect.mark.invert ? '!=' : '==' }} {{ fw4.hex(redirect.mark.mark) }} {%+ endif -%} {%+ if (redirect.mark && redirect.mark.mask == 0xFFFFFFFF): -%} meta mark{% if (redirect.mark.invert): %} !={% endif %} {{ fw4.hex(redirect.mark.mark) }} {%+ endif -%} {%+ if (redirect.ipset): -%} {{ fw4.concat(redirect.ipset.fields) }}{{ redirect.ipset.invert ? ' !=' : '' }} @{{ redirect.ipset.name }} {%+ endif -%} {%+ if (redirect.log && redirect.log_limit): -%} limit rate {{ redirect.log_limit.rate }}/{{ redirect.log_limit.unit }} log prefix {{ fw4.quote(redirect.log, true) }} {%+ include("redirect.uc", { fw4, zone, redirect: { ...redirect, log: 0 } }) %} {%+ elif (redirect.log && zone?.log_limit): -%} limit name "{{ zone.name }}.log_limit" log prefix {{ fw4.quote(redirect.log, true) }} {%+ include("redirect.uc", { fw4, zone, redirect: { ...redirect, log: 0 } }) %} {%+ else -%} {%+ if (redirect.counter): -%} counter {%+ endif -%} {%+ if (redirect.log): -%} log prefix {{ fw4.quote(redirect.log, true) }} {%+ endif -%} {% if (redirect.target == "redirect"): -%} redirect{% if (redirect.rport): %} to {{ fw4.port(redirect.rport) }}{% endif %} {%- elif (redirect.target == "accept" || redirect.target == "masquerade"): -%} {{ redirect.target }} {%- else -%} {{ redirect.target }} {{ redirect.raddr ? fw4.host(redirect.raddr, redirect.rport != null) : '' }} {%- if (redirect.rport): %}:{{ fw4.port(redirect.rport) }}{% endif %} {% endif %} comment {{ fw4.quote(`!fw4: ${redirect.name}`, true) }} {% endif -%} 07070101AE2317000081A40000000000000000000000016A426C2800000358000000FE0000000000000000000000000000002C00000000usr/share/firewall4/templates/zone-match.uc{%+ if (rule.devices_pos): -%} {{ egress ? "oifname" : "iifname" }} {{ fw4.set(rule.devices_pos) }} {%+ endif -%} {%+ if (rule.devices_neg): -%} {{ egress ? "oifname" : "iifname" }} != {{ fw4.set(rule.devices_neg) }} {%+ endif -%} {%+ for (let wcndev in rule.devices_neg_wildcard): -%} {{ egress ? "oifname" : "iifname" }} != {{ fw4.quote(wcndev) }} {%+ endfor -%} {%+ if (rule.subnets_pos): -%} {{ fw4.ipproto(rule.family) }} {{ egress ? "daddr" : "saddr" }} {{ fw4.set(rule.subnets_pos) }} {%+ endif -%} {%+ if (rule.subnets_neg): -%} {{ fw4.ipproto(rule.family) }} {{ egress ? "daddr" : "saddr" }} != {{ fw4.set(rule.subnets_neg) }} {%+ endif -%} {%+ for (let subnet in rule.subnets_masked): -%} {{ fw4.ipproto(rule.family) }} {{ egress ? "daddr" : "saddr" }} & {{ subnet.mask }} {{ subnet.invert ? '!=' : '==' }} {{ subnet.addr }} {%+ endfor -%} 07070101AE2310000081A40000000000000000000000016A426C28000010F7000000FE0000000000000000000000000000002D00000000usr/share/firewall4/templates/mangle-rule.uc{%+ for (let src_devices in rule.src?.zone) } {%+ if (rule.family && !rule.has_addrs): -%} meta nfproto {{ fw4.nfproto(rule.family) }} {%+ endif -%} {%+ if (!rule.proto.any && !rule.has_ports && !rule.icmp_types && !rule.icmp_codes): -%} meta l4proto {{ (rule.proto.name == 'icmp' && rule.family == 6) ? 'ipv6-icmp' : rule.proto.name }} {%+ endif -%} {%+ if (rule.saddrs_pos): -%} {{ fw4.ipproto(rule.family) }} saddr {{ fw4.set(rule.saddrs_pos) }} {%+ endif -%} {%+ if (rule.saddrs_neg): -%} {{ fw4.ipproto(rule.family) }} saddr != {{ fw4.set(rule.saddrs_neg) }} {%+ endif -%} {%+ if (rule.daddrs_pos): -%} {{ fw4.ipproto(rule.family) }} daddr {{ fw4.set(rule.daddrs_pos) }} {%+ endif -%} {%+ if (rule.daddrs_neg): -%} {{ fw4.ipproto(rule.family) }} daddr != {{ fw4.set(rule.daddrs_neg) }} {%+ endif -%} {%+ if (rule.sports_pos): -%} {{ rule.proto.name }} sport {{ fw4.set(rule.sports_pos) }} {%+ endif -%} {%+ if (rule.sports_neg): -%} {{ rule.proto.name }} sport != {{ fw4.set(rule.sports_neg) }} {%+ endif -%} {%+ if (rule.dports_pos): -%} {{ rule.proto.name }} dport {{ fw4.set(rule.dports_pos) }} {%+ endif -%} {%+ if (rule.dports_neg): -%} {{ rule.proto.name }} dport != {{ fw4.set(rule.dports_neg) }} {%+ endif -%} {%+ if (rule.smacs_pos): -%} ether saddr {{ fw4.set(rule.smacs_pos) }} {%+ endif -%} {%+ if (rule.smacs_neg): -%} ether saddr != {{ fw4.set(rule.smacs_neg) }} {%+ endif -%} {%+ if (rule.icmp_types): -%} {{ (rule.family == 4) ? "icmp" : "icmpv6" }} type {{ fw4.set(rule.icmp_types) }} {%+ endif -%} {%+ if (rule.icmp_codes): -%} {{ (rule.family == 4) ? "icmp" : "icmpv6" }} type . {{ (rule.family == 4) ? "icmp" : "icmpv6" }} code {{ fw4.set(rule.icmp_codes, true) }} {%+ endif -%} {%+ if (rule.helper): -%} ct helper{% if (rule.helper.invert): %} !={% endif %} {{ fw4.quote(rule.helper.name, true) }} {%+ endif -%} {%+ if (rule.limit): -%} limit rate {{ rule.limit.rate }}/{{ rule.limit.unit }} {%- if (rule.limit_burst): %} burst {{ rule.limit_burst }} packets{% endif %} {%+ endif -%} {%+ if (rule.start_date): -%} meta time >= {{ exists(rule.start_date, "hour") ? fw4.datetime(rule.start_date) : fw4.date(rule.start_date) }} {%+ endif -%} {%+ if (rule.stop_date): -%} meta time <= {{ exists(rule.stop_date, "hour") ? fw4.datetime(rule.stop_date) : fw4.date(rule.stop_date) }} {%+ endif -%} {%+ if (rule.start_time): -%} meta hour >= {{ fw4.time(rule.start_time) }} {%+ endif -%} {%+ if (rule.stop_time): -%} meta hour <= {{ fw4.time(rule.stop_time) }} {%+ endif -%} {%+ if (rule.weekdays): -%} meta day{% if (rule.weekdays.invert): %} !={% endif %} {{ fw4.set(rule.weekdays.days) }} {%+ endif -%} {%+ if (rule.mark && rule.mark.mask < 0xFFFFFFFF): -%} meta mark and {{ fw4.hex(rule.mark.mask) }} {{ rule.mark.invert ? '!=' : '==' }} {{ fw4.hex(rule.mark.mark) }} {%+ endif -%} {%+ if (rule.mark && rule.mark.mask == 0xFFFFFFFF): -%} meta mark{% if (rule.mark.invert): %} !={% endif %} {{ fw4.hex(rule.mark.mark) }} {%+ endif -%} {%+ if (rule.dscp): -%} dscp{% if (rule.dscp.invert): %} !={% endif %} {{ fw4.hex(rule.dscp.dscp) }} {%+ endif -%} {%+ if (rule.ipset): -%} {{ fw4.concat(rule.ipset.fields) }}{{ rule.ipset.invert ? ' !=' : '' }} @{{ rule.ipset.name }} {%+ endif -%} {%+ if (rule.counter): -%} counter {%+ endif -%} {%+ if (rule.log): -%} log prefix {{ fw4.quote(rule.log, true) }} {%+ endif -%} {%+ if (rule.target == "mark"): -%} meta mark set {{ (rule.set_xmark.mask == 0xFFFFFFFF) ? fw4.hex(rule.set_xmark.mark) : (rule.set_xmark.mark == 0) ? 'mark and ' + fw4.hex(~rule.set_xmark.mask & 0xFFFFFFFF) : (rule.set_xmark.mark == rule.set_xmark.mask) ? 'mark or ' + fw4.hex(rule.set_xmark.mark) : (rule.set_xmark.mask == 0) ? 'mark xor ' + fw4.hex(rule.set_xmark.mark) : 'mark and ' + fw4.hex(~r.set_xmark.mask & 0xFFFFFFFF) + ' xor ' + fw4.hex(r.set_xmark.mark) }} {%+ elif (rule.target == "dscp"): -%} {{ fw4.ipproto(rule.family) }} dscp set {{ fw4.hex(rule.set_dscp.dscp) }} {%+ elif (rule.target == "notrack"): -%} notrack {%+ elif (rule.target == "helper"): -%} ct helper set {{ fw4.quote(rule.set_helper.name, true) }} {%+ elif (rule.jump_chain): -%} jump {{ rule.jump_chain }} {%+ elif (rule.target): -%} {{ rule.target }} {%+ endif -%} comment {{ fw4.quote(`!fw4: ${rule.name}`, true) }} 07070101AE2313000081A40000000000000000000000016A426C2800003ABD000000FE0000000000000000000000000000002900000000usr/share/firewall4/templates/ruleset.uc{% let flowtable_devices = fw4.resolve_offload_devices(); let available_helpers = filter(fw4.helpers(), h => h.available); let defined_ipsets = fw4.ipsets(); let zones_with_limits = filter(fw4.zones(), z => z.log_limit); -%} table inet fw4 flush table inet fw4 {% if (fw4.check_flowtable()): %} delete flowtable inet fw4 ft {% endif %} {% fw4.includes('ruleset-prepend') %} table inet fw4 { {% if (length(flowtable_devices) > 0): %} # # Flowtable # flowtable ft { hook ingress priority 0; devices = {{ fw4.set(flowtable_devices, true) }}; counter; {% if (fw4.default_option("flow_offloading_hw")): %} flags offload; {% endif %} } {% endif %} {% if (length(available_helpers)): %} # # CT helper definitions # {% for (let helper in available_helpers): %} {% for (let proto in helper.proto): %} ct helper {{ helper.name }} { type {{ fw4.quote(helper.name, true) }} protocol {{ proto.name }}; } {% endfor %} {% endfor %} {% endif %} {% if (length(defined_ipsets)): %} # # Set definitions # {% for (let set in defined_ipsets): %} set {{ set.name }} { {% if (set.comment): %} comment {{ fw4.quote(set.comment, true) }} {% endif %} type {{ fw4.concat(set.types) }} {% if (set.maxelem > 0): %} size {{ set.maxelem }} {% endif %} {% if (set.timeout > 0): %} timeout {{ set.timeout }}s {% endif %} {% if (set.interval): %} auto-merge {% endif %} {% if (set.flags): %} flags {{ join(',', set.flags) }} {% endif %} {% fw4.print_setentries(set) %} } {% endfor %} {% endif %} # # Defines # {% for (let zone in fw4.zones()): %} define {{ replace(zone.name, /^[0-9]/, '_$&') }}_devices = {{ fw4.set(zone.match_devices, true) }} define {{ replace(zone.name, /^[0-9]/, '_$&') }}_subnets = {{ fw4.set(zone.match_subnets, true) }} {% endfor %} {% if (length(zones_with_limits)): %} # # Limits # {% for (let zone in zones_with_limits): %} limit {{ zone.name }}.log_limit { comment "{{ zone.name }} log limit" rate {{ zone.log_limit.rate }}/{{ zone.log_limit.unit }} } {% endfor %} {% endif %} # # User includes # include "/etc/nftables.d/*.nft" {% fw4.includes('table-prepend') %} # # Filter rules # chain input { type filter hook input priority filter; policy {{ fw4.input_policy(true) }}; iif "lo" accept comment "!fw4: Accept traffic from loopback" {% fw4.includes('chain-prepend', 'input') %} ct state vmap { established : accept, related : accept{% if (fw4.default_option("drop_invalid")): %}, invalid : drop{% endif %} } comment "!fw4: Handle inbound flows" {% if (fw4.default_option("synflood_protect") && fw4.default_option("synflood_rate")): %} tcp flags & (fin | syn | rst | ack) == syn jump syn_flood comment "!fw4: Rate limit TCP syn packets" {% endif %} {% for (let rule in fw4.rules("input")): %} {%+ include("rule.uc", { fw4, zone: null, rule }) %} {% endfor %} {% for (let zone in fw4.zones()): for (let rule in zone.match_rules): %} {%+ include("zone-jump.uc", { fw4, zone, rule, direction: "input" }) %} {% endfor; endfor %} {% if (fw4.input_policy() == "reject"): %} jump handle_reject {% endif %} {% fw4.includes('chain-append', 'input') %} } chain forward { type filter hook forward priority filter; policy {{ fw4.forward_policy(true) }}; {% if (length(flowtable_devices) > 0): %} meta l4proto { tcp, udp } flow offload @ft; {% endif %} {% fw4.includes('chain-prepend', 'forward') %} ct state vmap { established : accept, related : accept{% if (fw4.default_option("drop_invalid")): %}, invalid : drop{% endif %} } comment "!fw4: Handle forwarded flows" {% for (let rule in fw4.rules("forward")): %} {%+ include("rule.uc", { fw4, zone: (rule.src?.zone?.log_limit ? rule.src.zone : rule.dest?.zone), rule }) %} {% endfor %} {% for (let zone in fw4.zones()): for (let rule in zone.match_rules): %} {%+ include("zone-jump.uc", { fw4, zone, rule, direction: "forward" }) %} {% endfor; endfor %} {% fw4.includes('chain-append', 'forward') %} {% if (fw4.forward_policy() == "reject"): %} jump handle_reject {% endif %} } chain output { type filter hook output priority filter; policy {{ fw4.output_policy(true) }}; oif "lo" accept comment "!fw4: Accept traffic towards loopback" {% fw4.includes('chain-prepend', 'output') %} ct state vmap { established : accept, related : accept{% if (fw4.default_option("drop_invalid")): %}, invalid : drop{% endif %} } comment "!fw4: Handle outbound flows" {% for (let rule in fw4.rules("output")): %} {%+ include("rule.uc", { fw4, zone: null, rule }) %} {% endfor %} {% for (let zone in fw4.zones()): %} {% for (let rule in zone.match_rules): %} {% if (zone.dflags.helper): %} {% let devices_pos = fw4.filter_loopback_devs(rule.devices_pos, true); %} {% let subnets_pos = fw4.filter_loopback_addrs(rule.subnets_pos, true); %} {% if (devices_pos || subnets_pos): %} {%+ include("zone-jump.uc", { fw4, zone, rule: { ...rule, devices_pos, subnets_pos }, direction: "helper" }) %} {% endif %} {% endif %} {%+ include("zone-jump.uc", { fw4, zone, rule, direction: "output" }) %} {% endfor %} {% endfor %} {% fw4.includes('chain-append', 'output') %} {% if (fw4.output_policy() == "reject"): %} jump handle_reject {% endif %} } chain prerouting { type filter hook prerouting priority filter; policy accept; {% for (let zone in fw4.zones()): %} {% if (zone.dflags.helper): %} {% for (let rule in zone.match_rules): %} {% let devices_pos = fw4.filter_loopback_devs(rule.devices_pos, false); %} {% let subnets_pos = fw4.filter_loopback_addrs(rule.subnets_pos, false); %} {% if (rule.devices_neg || rule.subnets_neg || devices_pos || subnets_pos): %} {%+ include("zone-jump.uc", { fw4, zone, rule: { ...rule, devices_pos, subnets_pos }, direction: "helper" }) %} {% endif %} {% endfor %} {% endif %} {% endfor %} } chain handle_reject { meta l4proto tcp reject with {{ (fw4.default_option("tcp_reject_code") != "tcp-reset") ? `icmpx type ${fw4.default_option("tcp_reject_code")}` : "tcp reset" }} comment "!fw4: Reject TCP traffic" reject with {{ (fw4.default_option("any_reject_code") != "tcp-reset") ? `icmpx type ${fw4.default_option("any_reject_code")}` : "tcp reset" }} comment "!fw4: Reject any other traffic" } {% if (fw4.default_option("synflood_protect") && fw4.default_option("synflood_rate")): let r = fw4.default_option("synflood_rate"); let b = fw4.default_option("synflood_burst"); %} chain syn_flood { limit rate {{ r.rate }}/{{ r.unit }} {%- if (b): %} burst {{ b }} packets{% endif %} return comment "!fw4: Accept SYN packets below rate-limit" drop comment "!fw4: Drop excess packets" } {% endif %} {% for (let zone in fw4.zones()): %} chain input_{{ zone.name }} { {% fw4.includes('chain-prepend', `input_${zone.name}`) %} {% for (let rule in fw4.rules(`input_${zone.name}`)): %} {%+ include("rule.uc", { fw4, zone, rule }) %} {% endfor %} {% if (zone.dflags.dnat): %} ct status dnat accept comment "!fw4: Accept port redirections" {% endif %} {% fw4.includes('chain-append', `input_${zone.name}`) %} jump {{ zone.input }}_from_{{ zone.name }} } chain output_{{ zone.name }} { {% fw4.includes('chain-prepend', `output_${zone.name}`) %} {% for (let rule in fw4.rules(`output_${zone.name}`)): %} {%+ include("rule.uc", { fw4, zone, rule }) %} {% endfor %} {% fw4.includes('chain-append', `output_${zone.name}`) %} jump {{ zone.output }}_to_{{ zone.name }} } chain forward_{{ zone.name }} { {% fw4.includes('chain-prepend', `forward_${zone.name}`) %} {% for (let rule in fw4.rules(`forward_${zone.name}`)): %} {%+ include("rule.uc", { fw4, zone, rule }) %} {% endfor %} {% if (zone.dflags.dnat): %} ct status dnat accept comment "!fw4: Accept port forwards" {% endif %} {% fw4.includes('chain-append', `forward_${zone.name}`) %} jump {{ zone.forward }}_to_{{ zone.name }} {% if (fw4.forward_policy() != "accept" && (zone.log & 1)): %} {%+ if (zone.log_limit): %}limit name "{{ zone.name }}.log_limit" {%+ endif -%} log prefix "{{ fw4.forward_policy() }} {{ zone.name }} forward: " {% endif %} } {% if (zone.dflags.helper): %} chain helper_{{ zone.name }} { {% for (let rule in fw4.rules(`helper_${zone.name}`)): %} {%+ include("rule.uc", { fw4, zone, rule }) %} {% endfor %} } {% endif %} {% for (let verdict in ["accept", "reject", "drop"]): %} {% if (zone.sflags[verdict]): %} chain {{ verdict }}_from_{{ zone.name }} { {% for (let rule in zone.match_rules): %} {%+ include("zone-verdict.uc", { fw4, zone, rule, egress: false, verdict }) %} {% endfor %} } {% endif %} {% if (zone.dflags[verdict]): %} chain {{ verdict }}_to_{{ zone.name }} { {% for (let rule in zone.match_rules): %} {% if (!fw4.default_option("drop_invalid") && verdict == "accept" && (zone.masq || zone.masq6) && !zone.masq_allow_invalid): %} {%+ include("zone-drop-invalid.uc", { fw4, zone, rule }) %} {% endif %} {%+ include("zone-verdict.uc", { fw4, zone, rule, egress: true, verdict }) %} {% endfor %} } {% endif %} {% endfor %} {% endfor %} # # NAT rules # chain dstnat { type nat hook prerouting priority dstnat; policy accept; {% fw4.includes('chain-prepend', 'dstnat') %} {% for (let zone in fw4.zones()): %} {% if (zone.dflags.dnat): %} {% for (let rule in zone.match_rules): %} {%+ include("zone-jump.uc", { fw4, zone, rule, direction: "dstnat" }) %} {% endfor %} {% endif %} {% endfor %} {% fw4.includes('chain-append', 'dstnat') %} } chain srcnat { type nat hook postrouting priority srcnat; policy accept; {% fw4.includes('chain-prepend', 'srcnat') %} {% for (let redirect in fw4.redirects("srcnat")): %} {%+ include("redirect.uc", { fw4, zone: null, redirect }) %} {% endfor %} {% for (let zone in fw4.zones()): %} {% if (zone.dflags.snat): %} {% for (let rule in zone.match_rules): %} {%+ include("zone-jump.uc", { fw4, zone, rule, direction: "srcnat" }) %} {% endfor %} {% endif %} {% endfor %} {% fw4.includes('chain-append', 'srcnat') %} } {% for (let zone in fw4.zones()): %} {% if (zone.dflags.dnat): %} chain dstnat_{{ zone.name }} { {% fw4.includes('chain-prepend', `dstnat_${zone.name}`) %} {% for (let redirect in fw4.redirects(`dstnat_${zone.name}`)): %} {%+ include("redirect.uc", { fw4, zone, redirect }) %} {% endfor %} {% fw4.includes('chain-append', `dstnat_${zone.name}`) %} } {% endif %} {% if (zone.dflags.snat): %} chain srcnat_{{ zone.name }} { {% fw4.includes('chain-prepend', `srcnat_${zone.name}`) %} {% for (let redirect in fw4.redirects(`srcnat_${zone.name}`)): %} {%+ include("redirect.uc", { fw4, zone, redirect }) %} {% endfor %} {% if (zone.masq): %} {% for (let saddrs in zone.masq4_src_subnets): %} {% for (let daddrs in zone.masq4_dest_subnets): %} {%+ include("zone-masq.uc", { fw4, zone, family: 4, saddrs, daddrs }) %} {% endfor %} {% endfor %} {% endif %} {% if (zone.masq6): %} {% for (let saddrs in zone.masq6_src_subnets): %} {% for (let daddrs in zone.masq6_dest_subnets): %} {%+ include("zone-masq.uc", { fw4, zone, family: 6, saddrs, daddrs }) %} {% endfor %} {% endfor %} {% endif %} {% fw4.includes('chain-append', `srcnat_${zone.name}`) %} } {% endif %} {% endfor %} # # Raw rules (notrack) # chain raw_prerouting { type filter hook prerouting priority raw; policy accept; {% for (let zone in fw4.zones()): %} {% if (zone.dflags["notrack"]): %} {% for (let rule in zone.match_rules): %} {% let devices_pos = fw4.filter_loopback_devs(rule.devices_pos, false); %} {% let subnets_pos = fw4.filter_loopback_addrs(rule.subnets_pos, false); %} {% if (rule.devices_neg || rule.subnets_neg || devices_pos || subnets_pos): %} {%+ include("zone-jump.uc", { fw4, zone, rule: { ...rule, devices_pos, subnets_pos }, direction: "notrack" }) %} {% endif %} {% endfor %} {% endif %} {% endfor %} {% fw4.includes('chain-append', 'raw_prerouting') %} } chain raw_output { type filter hook output priority raw; policy accept; {% fw4.includes('chain-prepend', 'raw_output') %} {% for (let zone in fw4.zones()): %} {% if (zone.dflags["notrack"]): %} {% for (let rule in zone.match_rules): %} {% let devices_pos = fw4.filter_loopback_devs(rule.devices_pos, true); %} {% let subnets_pos = fw4.filter_loopback_addrs(rule.subnets_pos, true); %} {% if (devices_pos || subnets_pos): %} {%+ include("zone-jump.uc", { fw4, zone, rule: { ...rule, devices_pos, subnets_pos }, direction: "notrack" }) %} {% endif %} {% endfor %} {% endif %} {% endfor %} {% fw4.includes('chain-append', 'raw_output') %} } {% for (let zone in fw4.zones()): %} {% if (zone.dflags.notrack): %} chain notrack_{{ zone.name }} { {% for (let rule in fw4.rules(`notrack_${zone.name}`)): %} {%+ include("rule.uc", { fw4, zone, rule }) %} {% endfor %} } {% endif %} {% endfor %} # # Mangle rules # chain mangle_prerouting { type filter hook prerouting priority mangle; policy accept; {% fw4.includes('chain-prepend', 'mangle_prerouting') %} {% for (let rule in fw4.rules("mangle_prerouting")): %} {%+ include("rule.uc", { fw4, zone: null, rule }) %} {% endfor %} {% fw4.includes('chain-append', 'mangle_prerouting') %} } chain mangle_postrouting { type filter hook postrouting priority mangle; policy accept; {% fw4.includes('chain-prepend', 'mangle_postrouting') %} {% for (let rule in fw4.rules("mangle_postrouting")): %} {%+ include("rule.uc", { fw4, zone: null, rule }) %} {% endfor %} {% for (let zone in fw4.zones()): %} {% if (zone.mtu_fix): %} {% for (let rule in zone.match_rules): %} {%+ include("zone-mssfix.uc", { fw4, zone, rule, egress: true }) %} {% endfor %} {% endif %} {% endfor %} {% fw4.includes('chain-append', 'mangle_postrouting') %} } chain mangle_input { type filter hook input priority mangle; policy accept; {% fw4.includes('chain-prepend', 'mangle_input') %} {% for (let rule in fw4.rules("mangle_input")): %} {%+ include("rule.uc", { fw4, zone: null, rule }) %} {% endfor %} {% fw4.includes('chain-append', 'mangle_input') %} } chain mangle_output { type route hook output priority mangle; policy accept; {% fw4.includes('chain-prepend', 'mangle_output') %} {% for (let rule in fw4.rules("mangle_output")): %} {%+ include("rule.uc", { fw4, zone: null, rule }) %} {% endfor %} {% fw4.includes('chain-append', 'mangle_output') %} } chain mangle_forward { type filter hook forward priority mangle; policy accept; {% fw4.includes('chain-prepend', 'mangle_forward') %} {% for (let rule in fw4.rules("mangle_forward")): %} {%+ include("rule.uc", { fw4, zone: null, rule }) %} {% endfor %} {% for (let zone in fw4.zones()): %} {% if (zone.mtu_fix): %} {% for (let rule in zone.match_rules): %} {%+ include("zone-mssfix.uc", { fw4, zone, rule, egress: false }) %} {% endfor %} {% endif %} {% endfor %} {% fw4.includes('chain-append', 'mangle_forward') %} } {% fw4.includes('table-append') %} } {% fw4.includes('ruleset-append') %} 07070101AE2346000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001100000000usr/share/schema07070101AE234A000081A40000000000000000000000016A426C280000055C000000FE0000000000000000000000000000002900000000usr/share/schema/wireless.wifi-vlan.json{ "$id": "https://openwrt.org/wifi.vlan.json", "$schema": "http://json-schema.org/draft-07/schema#", "description": "OpenWrt WiFi VLAN Schema", "type": "object", "properties": { "bridge_isolate": { "description": "Enable bridge port isolation for the wireless interface", "type": "boolean" }, "iface": { "description": "List of interfaces this VLAN is associated with", "type": "array", "items": { "type": "string" } }, "isolate": { "description": "Isolates wireless clients from each other", "type": "boolean" }, "multicast_to_unicast": { "description": "Request that the AP will do multicast-to-unicast conversion for ARP, IPv4, and IPv6 frames", "type": "boolean" }, "name": { "description": "VLAN name", "type": "string" }, "network": { "description": "Specifies one or multiple logical network interfaces declared in the network configuration, each one should be a L3 bridge to be able to attach this L2 wireless interface.", "type": "array", "items": { "type": "string" } }, "network_vlan": { "description": "Make a wireless interface a tagged member of extra VLANs", "type": "array", "items": { "type": "string" } }, "proxy_arp": { "description": "Proxy ARP", "type": "boolean" }, "vid": { "description": "VLAN ID", "type": "string" } } } 07070101AE2348000081A40000000000000000000000016A426C28000073D1000000FE0000000000000000000000000000002A00000000usr/share/schema/wireless.wifi-iface.json{ "$id": "https://openwrt.org/wifi.iface.json", "$schema": "http://json-schema.org/draft-07/schema#", "description": "OpenWrt WiFi Interface Schema", "type": "object", "properties": { "access_network_type": { "description": "Interworking Access Network Type", "type": "number", "minimum": 0, "maximum": 15 }, "acct_interval": { "type": "alias", "default": "radius_acct_interim_interval" }, "acct_port": { "type": "alias", "default": "acct_server_port" }, "acct_secret": { "type": "alias", "default": "acct_server_shared_secret" }, "acct_server": { "type": "alias", "default": "acct_server_addr" }, "acct_server_addr": { "description": "RADIUS accounting server to handle client authentication", "type": "array", "items": { "type": "string" } }, "acct_server_port": { "description": "RADIUS accounting port", "type": "number", "default": 1813 }, "acct_server_shared_secret": { "description": "Shared accounting RADIUS secret", "type": "string" }, "airtime_bss_limit": { "description": "Whether the current BSS should be limited (when airtime_mode=3)", "type": "boolean" }, "airtime_bss_weight": { "description": "Per-BSS airtime weight. In multi-BSS mode, set for each BSS and hostapd will configure station weights to enforce the correct ratio between BSS weights depending on the number of active stations", "type": "number" }, "airtime_sta_weight": { "description": "Static configuration of station weights (when airtime_mode=1). Kernel default weight is 256", "type": "array", "items": { "type": "string" } }, "altsubject_match": { "description": "Semicolon separated string of entries to be matched against the alternative subject name of the authentication server certificate", "type": "array", "items": { "type": "string" } }, "altsubject_match2": { "type": "array" }, "anonymous_identity": { "description": "Anonymous identity string for EAP", "type": "string" }, "anqp_3gpp_cell_net": { "description": "3GPP Cellular Network information", "type": "array", "items": { "type": "string" } }, "anqp_domain_id": { "description": "An identifier for a set of APs in an ESS that share the same common ANQP information", "type": "number", "minimum": 0, "maximum": 65535, "default": 0 }, "ap_isolate": { "description": "Isolates wireless clients from each other, only applicable in ap mode", "type": "boolean", "default": false }, "ap_max_inactivity": { "description": "Station inactivity limit in seconds: If a station does not send anything in ap_max_inactivity seconds, an empty data frame is sent to it in order to verify whether it is still in range. If this frame is not ACKed, the station will be disassociated and then deauthenticated", "type": "number" }, "ap_pin": { "description": "Static access point PIN for WPS", "type": "string" }, "ap_setup_locked": { "description": "AP can be configured into a locked state where new WPS Registrar are not accepted", "type": "boolean" }, "anqp_elem": { "description": "Arbitrary ANQP-element configuration", "type": "array", "items": { "type": "string" } }, "asra": { "description": "Additional Step Required for Access", "type": "boolean", "default": false }, "assoc_sa_query_max_timeout": { "description": "Specifies the 802.11w Association SA Query maximum timeout.", "type": "number", "minimum": 1, "maximum": 4294967295 }, "assoc_sa_query_retry_timeout": { "description": "Association SA Query retry timeout", "type": "number", "minimum": 1, "maximum": 4294967295 }, "auth": { "description": "Defines the phase 2 (inner) authentication method, only applicable if eap_type is peap or ttl", "type": "string" }, "auth_cache": { "type": "alias", "default": "okc" }, "auth_port": { "type": "alias", "default": "auth_server_port" }, "auth_secret": { "type": "alias", "default": "auth_server_shared_secret" }, "auth_server": { "type": "alias", "default": "auth_server_addr" }, "auth_server_addr": { "description": "RADIUS authentication server to handle client authentication", "type": "array", "items": { "type": "string" } }, "auth_server_port": { "description": "RADIUS authentication port", "type": "number", "default": 1812 }, "auth_server_shared_secret": { "description": "Shared authentication RADIUS secret", "type": "string" }, "basic_rate": { "type": "array" }, "beacon_prot": { "description": "Management frame protection for Beacon frames", "type": "boolean" }, "bridge_isolate": { "description": "Enable bridge port isolation for the wireless interface", "type": "boolean" }, "bss_load_update_period": { "description": "BSS Load update period (in BUs)", "type": "number", "default": 60 }, "bss_transition": { "description": "BSS Transition Management", "type": "boolean" }, "bssid": { "description": "Override the BSSID of the network", "type": "string" }, "bssid_blacklist": { "type": "array" }, "bssid_whitelist": { "type": "array" }, "ca_cert": { "description": "Specifies the path the CA certificate used for authentication", "type": "string" }, "ca_cert2_usesystem": { "type": "boolean" }, "ca_cert_usesystem": { "type": "boolean" }, "chan_util_avg_period": { "description": "Channel utilization averaging period (in BUs)", "type": "number", "default": 600 }, "civic": { "description": "The content of a location civic measurement subelement", "type": "string" }, "client_cert": { "description": "File path to client certificate file (PEM/DER)", "type": "string" }, "dae_client": { "type": "alias", "default": "radius_das_client" }, "dae_port": { "type": "alias", "default": "radius_das_port" }, "dae_secret": { "type": "alias", "default": "radius_das_secret" }, "default_disabled": { "type": "alias", "default": "disabled" }, "device": { "description": "Devices to enable this interface on (wifi-device section names)", "type": "array", "items": { "type": "string" } }, "device_name": { "description": "Primary Device Name used by WPS", "type": "string", "default": "OpenWrt AP" }, "device_type": { "description": "Primary Device Type used by WPS", "type": "string", "default": "6-0050F204-1" }, "disabled": { "description": "Do not bring the interface up automatically", "type": "boolean" }, "disable_dgaf": { "description": "Disable Downstream Group-Addressed Forwarding", "type": "boolean", "default": false }, "disassoc_low_ack": { "description": "Disassociate stations based on excessive transmission failures or other indications of connection loss. This depends on the driver capabilities and may not be available with all drivers.", "type": "boolean", "default": true }, "domain_match": { "type": "array", "items": { "type": "string" } }, "domain_match2": { "type": "array" }, "domain_name" : { "type": "array", "items": { "type": "string" } }, "domain_suffix_match": { "type": "array", "items": { "type": "string" } }, "domain_suffix_match2": { "type": "array" }, "dtim_period": { "description": "Set the DTIM (delivery traffic information message) period. There will be one DTIM per this many beacon frames. This may be set between 1 and 255. This option only has an effect on ap wifi-ifaces.", "type": "number", "default": 2, "minimum": 1, "maximum": 255 }, "dynamic_ownip": { "type": "alias", "default": "dynamic_own_ip_addr" }, "dynamic_own_ip_addr": { "type": "boolean" }, "dynamic_vlan": { "description": "Allow RADIUS authentication server to decide which VLAN is used for the stations (0 = disabled, 1 = optional, 2 = required)", "type": "number", "enum": [ 0, 1, 2 ], "default": 0 }, "eap_reauth_period": { "description": "EAP reauthentication period in seconds", "type": "number" }, "eap_server": { "description": "Use integrated EAP server instead of external RADIUS authentication server", "type": "boolean" }, "eap_type": { "type": "string" }, "eap_user_file": { "description": "Path for EAP server user database", "type": "string" }, "eapol_version": { "description": "IEEE 802.1X/EAPOL version", "type": "number", "enum": [ 1, 2 ] }, "enable": { "description": "Enable the interface", "type": "boolean", "default": true }, "encryption": { "type": "string" }, "esr": { "description": "Emergency services reachable", "type": "boolean", "default": false }, "ext_registrar": { "description": "WPS UPnP interface", "type": "boolean" }, "fils": { "description": "Enable FILS", "type": "boolean" }, "fils_dhcp": { "description": "DHCP server for FILS HLP. Set to '*' for automatic lookup.", "type": "string" }, "ft_iface": { "description": "Inter-AP communication interface for 802.11r", "type": "string" }, "ft_over_ds": { "description": "Whether to enable FT-over-DS", "type": "boolean", "default": false }, "ft_psk_generate_local": { "description": "Whether to generate FT response locally for PSK networks. This avoids use of PMK-R1 push/pull from other APs with FT-PSK networks as the required information (PSK and other session data) is already locally available.", "type": "boolean" }, "ftm_responder": { "description": "Publish fine timing measurement (FTM) responder functionality", "type": "boolean" }, "gas_address3": { "type": "string" }, "hidden": { "type": "alias", "default": "ignore_broadcast_ssid" }, "hessid": { "description": "Homogeneous ESS identifier", "type": "string" }, "hostapd_bss_options": { "description": "Additional raw options to be added", "type": "array", "items": { "type": "string" } }, "hs20": { "description": "Enable Hotspot 2.0 support", "type": "boolean" }, "hs20_conn_capab": { "description": "Connection Capability", "type": "array", "items": { "type": "string" } }, "hs20_deauth_req_timeout": { "description": "Deauthentication request timeout", "type": "number", "default": 60 }, "hs20_operating_class": { "description": "Operating Class Indication", "type": "string" }, "hs20_t_c_filename": { "description": "Terms and Conditions information", "type": "string" }, "hs20_t_c_server_url": { "description": "Terms and Conditions server", "type": "string" }, "hs20_t_c_timestamp": { "description": "Terms and Conditions timestamp", "type": "string" }, "hs20_wan_metrics": { "description": "WAN Metrics", "type": "string" }, "identity": { "description": "Identity string for EAP", "type": "string" }, "ieee80211k": { "description": "Enables Radio Resource Measurement (802.11k) support", "type": "boolean" }, "ieee80211r": { "description": "Enables fast BSS transition (802.11r) support.", "type": "boolean" }, "ieee80211w": { "description": "Enables MFP (802.11w) support (0 = disabled, 1 = optional, 2 = required). Requires the 'full' version of wpad/hostapd and support from the Wi-Fi driver", "type": "number", "enum": [ 0, 1, 2 ] }, "ieee80211w_max_timeout": { "type": "alias", "default": "assoc_sa_query_max_timeout" }, "ieee80211w_mgmt_cipher": { "description": "Group Management cypher", "type": "string" }, "ieee80211w_retry_timeout": { "type": "alias", "default": "assoc_sa_query_retry_timeout" }, "ifname": { "description": "Specifies a custom name for the Wi-Fi interface, which is otherwise automatically named. Maximum length: 15 characters", "type": "string" }, "ignore_broadcast_ssid": { "description": "Disables the broadcasting of beacon frames if set to 1 and, in doing so, hides the ESSID. Where the ESSID is hidden, clients may fail to roam and airtime efficiency may be significantly reduced.", "type": "boolean", "default": false }, "internet": { "description": "Whether the network provides connectivity to the Internet", "type": "boolean", "default": true }, "isolate": { "type": "alias", "default": "ap_isolate" }, "iw_access_network_type": { "type": "alias", "default": "access_network_type" }, "iw_anqp_3gpp_cell_net": { "type": "alias", "default": "anqp_3gpp_cell_net" }, "iw_anqp_elem": { "type": "alias", "default": "anqp_elem" }, "iw_asra": { "type": "alias", "default": "asra" }, "iw_domain_name": { "type": "alias", "default": "domain_name" }, "iw_enabled": { "type": "boolean", "default": false }, "iw_esr": { "type": "alias", "default": "esr" }, "iw_gas_address3": { "type": "alias", "default": "gas_address3" }, "iw_hessid": { "type": "alias", "default": "hessid" }, "iw_internet": { "type": "alias", "default": "internet" }, "iw_ipaddr_type_availability": { "type": "number" }, "iw_nai_realm": { "type": "alias", "default": "nai_realm" }, "iw_network_auth_type": { "type": "alias", "default": "network_auth_type" }, "iw_qos_map_set": { "type": "alias", "default": "qos_map_set" }, "roaming_consortium": { "type": "alias", "default": "roaming_consortium" }, "iw_uesa": { "type": "alias", "default": "uesa" }, "iw_venue_group": { "type": "alias", "default": "venue_group" }, "iw_venue_name": { "type": "alias", "default": "venue_name" }, "iw_venue_type": { "type": "alias", "default": "venue_type" }, "iw_venue_url": { "type": "alias", "default": "venue_url" }, "key": { "description": "Encryption key", "type": "string" }, "lci": { "description": "The content of a LCI measurement subelement", "type": "string" }, "macaddr": { "description": "Override the BSSID of the network", "type": "string" }, "macfile": { "description": "File containing a list MACs used by the macfilter", "type": "string" }, "macfilter": { "description": "Allow/deny associations based on the clients MAC", "type": "string", "enum": [ "allow", "deny" ] }, "maclist": { "description": "List of MACs used by the macfilter option", "type": "array", "items": { "type": "string" } }, "manufacturer": { "description": "Manufacturer used by WPS", "type": "string", "default": "www.openwrt.org" }, "max_inactivity": { "type": "alias", "default": "ap_max_inactivity" }, "max_listen_int": { "type": "alias", "default": "max_listen_interval" }, "max_listen_interval": { "description": "How many Beacon periods STAs are allowed to remain asleep", "type": "number" }, "max_num_sta": { "description": "Maximum number of stations allowed in station table", "type": "number" }, "maxassoc": { "type": "alias", "default": "max_num_sta" }, "mbo": { "description": "Multiband Operation", "type": "boolean" }, "mcast_rate": { "description": "Allowed multicast rate", "type": "number" }, "mesh_auto_open_plinks": { "type": "boolean" }, "mesh_awake_window": { "type": "number" }, "mesh_confirm_timeout": { "type": "number" }, "mesh_element_ttl": { "type": "number" }, "mesh_fwding": { "description": "Enable 802.11s layer-2 routing and forwarding", "type": "boolean" }, "mesh_nolearn": { "description": "Disable 802.11s path discovery", "type": "boolean" }, "mesh_gate_announcements": { "type": "number" }, "mesh_holding_timeout": { "type": "number" }, "mesh_hwmp_active_path_timeout": { "type": "number" }, "mesh_hwmp_active_path_to_root_timeout": { "type": "number" }, "mesh_hwmp_confirmation_interval": { "type": "number" }, "mesh_hwmp_max_preq_retries": { "type": "number" }, "mesh_hwmp_net_diameter_traversal_time": { "type": "number" }, "mesh_hwmp_preq_min_interval": { "type": "number" }, "mesh_hwmp_rann_interval": { "type": "number" }, "mesh_hwmp_root_interval": { "type": "number" }, "mesh_hwmp_rootmode": { "type": "number" }, "mesh_id": { "type": "string" }, "mesh_max_peer_links": { "type": "number" }, "mesh_max_retries": { "type": "number" }, "mesh_min_discovery_timeout": { "type": "number" }, "mesh_path_refresh_time": { "type": "number" }, "mesh_plink_timeout": { "type": "number" }, "mesh_power_mode": { "type": "string" }, "mesh_retry_timeout": { "type": "number" }, "mesh_rssi_threshold": { "type": "number" }, "mesh_sync_offset_max_neighor": { "type": "number" }, "mesh_ttl": { "type": "number" }, "mlo": { "description": "Multi-Link Operation", "type": "boolean" }, "mobility_domain": { "description": "DID is used to indicate a group of APs between which a STA can use Fast BSS Transition.", "type": "string" }, "mode": { "type": "string" }, "multi_ap": { "description": "Enable Multi-AP functionality", "type": "number" }, "multi_ap_vlanid": { "description": "Multi-AP Default VLAN ID", "type": "number" }, "multi_ap_profile": { "description": "Multi-AP Profile", "type": "number" }, "multi_ap_backhaul_key": { "type": "string" }, "multi_ap_backhaul_ssid": { "description": "Multi-AP backhaul BSS SSID", "type": "string" }, "multicast_to_unicast": { "description": "Request that the AP will do multicast-to-unicast conversion for ARP, IPv4, and IPv6 frames ", "type": "boolean" }, "multicast_to_unicast_all": { "type": "alias", "default": "multicast_to_unicast" }, "na_mcast_to_ucast": { "description": "IPv6 Neighbor Advertisement multicast-to-unicast conversion", "type": "boolean" }, "nas_identifier": { "description": "NAS-Identifier string for RADIUS messages", "type": "string" }, "nai_realm": { "description": "NAI Realm information", "type": "array", "items": { "type": "string" } }, "nasid": { "type": "alias", "default": "nas_identifier" }, "network": { "description": "Specifies one or multiple logical network interfaces declared in the network configuration, each one should be a L3 bridge to be able to attach this L2 wireless interface.", "type": "array", "items": { "type": "string" } }, "network_auth_type": { "description": "Network Authentication Type", "type": "string" }, "network_vlan": { "description": "Make a wireless interface a tagged member of extra VLANs", "type": "array", "items": { "type": "string" } }, "no_probe_resp_if_max_sta": { "description": "Do not answer probe requests if iface_max_num_sta was reached", "type": "boolean" }, "ocv": { "description": "Operating Channel Validation", "type": "number", "minimum": 0, "maximum": 15 }, "okc": { "description": "PMKSA and Opportunistic Key Caching", "type": "boolean" }, "owe_transition": { "description": "Indicate that an OWE BSS shall automatically add an unencrypted transition interface", "type": "boolean" }, "owe_transition_bssid": { "description": "Pointer to the matching open/OWE BSS", "type": "string" }, "owe_transition_ifname": { "description": "Alternatively, OWE transition mode BSSID/SSID can be configured with a reference to a BSS operated by this hostapd process.", "type": "string" }, "owe_transition_ssid": { "description": "The SSID used by the OWE transition device", "type": "string" }, "ownip": { "type": "alias", "default": "own_ip_addr" }, "own_ip_addr": { "description": "The own IP address of the access point", "type": "string" }, "password:wpakey": { "type": "string" }, "pbc_in_m1": { "description": "WPS capability discovery workaround for PBC with Windows 7", "type": "boolean" }, "per_sta_vif": { "description": "Per-Station AP_VLAN interface mode", "type": "boolean" }, "pmk_r1_push": { "description": "Whether PMK-R1 push is enabled at R0KH", "type": "boolean", "default": false }, "port:port": { "type": "number" }, "powersave": { "type": "boolean" }, "ppsk": { "description": "Lookup PSK2 Keys up via a Radius server", "type": "boolean" }, "preamble": { "description": "Short Preamble", "type": "boolean", "default": true }, "priv_key": { "type": "string" }, "priv_key_pwd": { "type": "string" }, "private_key": { "description": "Private key matching with the server certificate for EAP-TLS/PEAP/TTLS", "type": "string" }, "private_key_passwd": { "description": "Passphrase for private key", "type": "string" }, "proxy_arp": { "description": "Proxy ARP", "type": "boolean" }, "qos_map_set": { "description": "QoS Map Set configuration", "type": "string", "default": "0,0,2,16,1,1,255,255,18,22,24,38,40,40,44,46,48,56" }, "r0_key_lifetime": { "description": "Default lifetime of the PMK-R0 in seconds", "type": "number" }, "r0kh": { "description": "List of R0KHs in the same Mobility Domain", "type": "array", "items": { "type": "string" } }, "r1_key_holder": { "description": "PMK-R1 Key Holder identifier", "type": "string" }, "r1kh": { "description": "List of R1KHs in the same Mobility Domain", "type": "array", "items": { "type": "string" } }, "radios": { "type": "array", "items": { "type": "string" } }, "radius_acct_interim_interval": { "description": "Interim accounting update interval", "type": "number" }, "radius_acct_req_attr": { "description": "Additional Accounting-Request attributes", "type": "array", "items": { "type": "string" } }, "radius_auth_req_attr": { "description": "Additional Access-Request attributes", "type": "array", "items": { "type": "string" } }, "radius_client_addr": { "description": "RADIUS client forced local IP address for the access point", "type": "string" }, "radius_das_client": { "description": "DAS client (the host that can send Disconnect/CoA requests)", "type": "string" }, "radius_das_port": { "description": "Dynamic Authorization Extensions port", "type": "number" }, "radius_das_secret": { "description": "Dynamic Authorization Extensions secret", "type": "string" }, "radius_request_cui" :{ "description": "Request Chargeable-User-Identity (RFC 4372)", "type": "boolean" }, "reassociation_deadline": { "description": "Reassociation deadline in time units", "type": "number", "minimum": 1000, "maximum": 65535, "default": 20000 }, "request_cui": { "type": "alias", "default": "radius_request_cui" }, "rrm_beacon_report": { "description": "Enable beacon report via radio measurements", "type": "boolean" }, "rrm_neighbor_report": { "description": "Enable neighbor report via radio measurements", "type": "boolean" }, "rnr": { "description": "Enable reduced neighbor reporting", "type": "boolean" }, "roaming_consortium": { "description": "Roaming Consortium List", "type": "array", "items": { "type": "string" } }, "rsn_preauth": { "type": "boolean" }, "rsn_override": { "type": "number", "description": "Use RSNE override IE WPA3 compatibility (0: disabled, 1: enabled, 2:force WPA2 for older devices)", "default": 1 }, "sae_password_file": { "description": "External file containing VLAN SAE MAC address triplets", "type": "string" }, "sae_pwe": { "description": "SAE mechanism for PWE derivation", "type": "number", "enum": [ 0, 1, 2 ] }, "sae_require_mfp": { "description": "Require MFP for all associations using SAE", "type": "boolean" }, "sae_track_password": { "description": "Tracking of SAE password use", "type": "number" }, "server:host": { "type": "string" }, "server_cert": { "description": "Server certificate (PEM or DER file) for EAP-TLS/PEAP/TTLS", "type": "string" }, "server_id": { "description": "Server identity", "type": "string" }, "short_preamble": { "type": "alias", "default": "preamble" }, "skip_inactivity_poll": { "description": "The inactivity polling can be disabled to disconnect stations based on inactivity timeout so that idle stations are more likely to be disconnected even if they are still in range of the AP", "type": "boolean", "default": false }, "spp_amsdu": { "description": "Signaling and Payload Protected A-MSDU", "type": "boolean" }, "ssid": { "type": "string" }, "ssid:string": { "type": "string" }, "start_disabled": { "type": "number" }, "subject_match": { "description": "Substring to be matched against the subject of the authentication server certificate", "type": "string" }, "subject_match2": { "type": "string" }, "supported_rates": { "type": "array" }, "tdls_prohibit": { "description": "Prohibit use of TDLS in this BSS", "type": "boolean" }, "time_advertisement": { "description": "Time advertisement", "type": "number", "enum": [ 0, 2 ] }, "time_zone": { "description": "Local time zone as specified in 8.3 of IEEE Std 1003.1-2004", "type": "string" }, "uapsd": { "type": "alias", "default": "uapsd_advertisement_enabled" }, "uapsd_advertisement_enabled": { "description": "WMM-PS Unscheduled Automatic Power Save Delivery [U-APSD]", "type": "boolean", "default": true }, "uesa": { "description": "Unauthenticated emergency service accessible", "type": "boolean", "default": false }, "utf8_ssid": { "description": "Whether the SSID is to be interpreted using UTF-8 encoding", "type": "boolean", "default": true }, "vendor_elements": { "description": "Additional vendor specific elements for Beacon and Probe Response frames", "type": "array", "items": { "type": "string" } }, "venue_group": { "type": "string" }, "venue_name": { "description": "Venue Name information", "type": "array", "items": { "type": "string" } }, "venue_type": { "type": "string" }, "venue_url": { "description": "Venue URL information", "type": "array", "items": { "type": "string" } }, "vlan_bridge": { "description": "Bridge (prefix) to add the wifi and the tagged interface to.", "type": "string" }, "vlan_file": { "type": "string" }, "vlan_naming": { "description": "When hostapd creates a VLAN interface on vlan_tagged_interfaces, it needs to know how to name it.", "type": "boolean", "default": true }, "vlan_no_bridge": { "description": "To not setup a bridge for dynamic vlans", "type": "boolean" }, "vlan_tagged_interface": { "type": "string" }, "wds": { "type": "boolean" }, "wds_bridge": { "description": "If bridge parameter is set, the WDS STA interface will be added to the same bridge by default", "type": "string" }, "wds_sta": { "description": "If bridge parameter is set, the WDS STA interface will be added to the same bridge by default", "type": "boolean" }, "wnm_sleep_mode": { "description": "WNM-Sleep Mode (extended sleep mode for stations)", "type": "boolean" }, "wnm_sleep_mode_no_keys": { "description": "WNM-Sleep Mode GTK/IGTK workaround", "type": "boolean" }, "wpa_disable_eapol_key_retries": { "description": "Workaround for key reinstallation attacks", "type": "boolean", "default": false }, "wpa_gmk_rekey": { "description": "Time interval for rekeying GMK (master key used internally to generate GTKs)", "type": "number" }, "wpa_group_rekey": { "description": "Time interval for rekeying GTK (broadcast/multicast encryption keys)", "type": "number" }, "wpa_master_rekey": { "type": "alias", "default": "wpa_gmk_rekey" }, "wpa_pair_rekey": { "type": "alias", "default": "wpa_ptk_rekey" }, "wpa_psk_file": { "description": "External file conatining VLAN PSK MAC address triplets", "type": "string" }, "wpa_ptk_rekey": { "description": "Maximum lifetime for PTK in seconds", "type": "number" }, "wpa_strict_rekey": { "description": "Rekey GTK when any STA that possesses the current GTK is leaving the BSS", "type": "boolean" }, "wps_ap_setup_locked": { "type": "alias", "default": "ap_setup_locked" }, "wps_device_name": { "type": "alias", "default": "device_name" }, "wps_device_type": { "type": "alias", "default": "device_type" }, "wps_independent": { "description": "Whether to manage this interface independently from other WPS interfaces", "type": "number", "default": true }, "wps_label": { "description": "Support WPS labels", "type": "boolean" }, "wps_manufacturer": { "type": "alias", "default": "manufacturer" }, "wps_pbc_in_m1": { "type": "alias", "default": "pbc_in_m1" }, "wps_pin": { "type": "alias", "default": "ap_pin" }, "wps_pushbutton": { "description": "Support WPS pushbutton", "type": "boolean" } } } 07070101AE2347000081A40000000000000000000000016A426C2800004E0A000000FE0000000000000000000000000000002B00000000usr/share/schema/wireless.wifi-device.json{ "$id": "https://openwrt.org/wifi.device.json", "$schema": "http://json-schema.org/draft-07/schema#", "description": "OpenWrt WiFi Device Schema", "type": "object", "properties": { "acs_chan_bias": { "description": "Can be used to increase (or decrease) the likelihood of a specific channel to be selected by the ACS algorithm", "type": "string" }, "acs_exclude_dfs": { "description": "Exclude DFS channels from ACS", "type": "boolean", "default": false }, "airtime_mode": { "description": "Set the airtime policy operating mode", "type": "number", "default": 0, "minimum": 0, "maximum": 3 }, "antenna_gain": { "description": "Reduction in antenna gain from regulatory maximum in dBi", "type": "number", "default": 0 }, "assoc_sa_query_max_timeout": { "description": "Association SA Query maximum timeout", "type": "number" }, "assoc_sa_query_retry_timeout": { "description": "Association SA Query retry timeout", "type": "number" }, "auth_cache": { "type": "alias", "default": "okc" }, "background_radar": { "type": "alias", "default": "enable_background_radar" }, "band": { "description": "The wireless band thatthe radio shall operate on", "type": "string", "enum": [ "2g", "5g", "6g", "60g" ] }, "basic_rate": { "type": "alias", "default": "basic_rates" }, "basic_rates": { "description": "Set the supported basic rates. Each basic_rate is measured in kb/s. This option only has an effect on ap and adhoc wifi-ifaces. ", "type": "array", "items": { "type": "number" } }, "beacon_int": { "description": "Set the beacon interval. This is the time interval between beacon frames, measured in units of 1.024 ms. hostapd permits this to be set between 15 and 65535. This option only has an effect on ap and adhoc wifi-ifaces", "type": "number", "default": 100, "minimum": 15, "maximum": 65535 }, "beacon_rate": { "description": "Beacon frame TX rate configuration", "type": "string" }, "beamformee_antennas": { "description": "Beamformee antenna override", "type": "number", "default": 4 }, "beamformer_antennas": { "description": "Beamformer antenna override", "type": "number", "default": 4 }, "bssid": { "description": "Overrides the MAC address used for the Wi-Fi interface. Warning: if the MAC address specified is a multicast address, this override will fail silently. To avoid this problem, ensure that the mac address specified is a valid unicast mac address", "type": "string" }, "cell_density": { "description": "Configures data rates based on the coverage cell density. Normal configures basic rates to 6, 12, 24 Mbps if legacy_rates is 0, else to 5.5, 11 Mbps. High configures basic rates to 12, 24 Mbps if legacy_rates is 0, else to the 11 Mbps rate. Very High configures 24 Mbps as the basic rate. Supported rates lower than the minimum basic rate are not offered. The basic_rate and supported_rates options overrides this option. 0 = Disabled, 1 = Normal, 2 = High, 3 = Very High", "type": "number", "default": 0, "minimum": 0, "maximum": 3 }, "chanbw": { "description": "Specifies a narrow channel width in MHz, possible values are: 5, 10, 20", "type": "number", "enum": [ 5, 10, 20 ] }, "channel": { "description": "Specifies the wireless channel. “auto” defaults to the lowest available channel, or utilizes the ACS algorithm depending on hardware/driver support", "type": "string" }, "channels": { "type": "alias", "default": "chanlist" }, "channel_list": { "type": "alias", "default": "chanlist" }, "chanlist": { "description": "Use specific channels, when channel is in “auto” mode. This option allows hostapd to select one of the provided channels when a channel should be automatically selected. Channels can be provided as range using hyphen ('-') or individual channels can be specified by space (' ') separated values", "type": "array", "items": { "type": "string" } }, "country": { "type": "alias", "default": "country_code" }, "country3": { "description": "The third octet of the Country String (dot11CountryString)", "type": "string" }, "country_code": { "description": "Specifies the two-letter country code (e.g. EN or DE), affects the available channels and transmission powers", "type": "string" }, "country_ie": { "type": "alias", "default": "ieee80211d" }, "disabled": { "description": "When set to 1, wireless network is disabled", "type": "boolean", "default": false }, "distance": { "description": "Distance between the ap and the furthest client in meters", "type": "number", "default": 0 }, "doth": { "type": "alias", "default": "ieee80211h" }, "dsss_cck_40": { "description": "DSSS/CCK Mode in 40 MHz allowed in Beacon, Measurement Pilot and Probe Response frames", "type": "boolean", "default": true }, "enable_background_radar": { "description": "This feature allows CAC to be run on dedicated radio RF chains", "type": "boolean" }, "frag": { "description": "Fragmentation threshold", "type": "number" }, "greenfield": { "description": "Receive Greenfield - treats pre-80211n traffic as noise", "type": "boolean", "default": false }, "he_bss_color": { "description": "BSS color to be announced", "type": "number", "minimum": 1, "maximum": 128, "default": 128 }, "he_bss_color_enabled": { "description": "Enable BSS color", "type": "boolean", "default": true }, "he_default_pe_duration": { "description": "The duration of PE field in an HE PPDU in us", "type": "number", "default": 4, "enum": [ 4, 8, 12, 16 ] }, "he_mu_beamformer": { "description": "HE multiple user beamformer support", "type": "boolean", "default": true }, "he_mu_edca_ac_be_aci": { "type": "number", "default": 0 }, "he_mu_edca_ac_be_aifsn": { "type": "number", "default": 8 }, "he_mu_edca_ac_be_ecwmax": { "type": "number", "default": 10 }, "he_mu_edca_ac_be_ecwmin": { "type": "number", "default": 9 }, "he_mu_edca_ac_be_timer": { "type": "number", "default": 255 }, "he_mu_edca_ac_bk_aci": { "type": "number", "default": 1 }, "he_mu_edca_ac_bk_aifsn": { "type": "number", "default": 15 }, "he_mu_edca_ac_bk_ecwmax": { "type": "number", "default": 10 }, "he_mu_edca_ac_bk_ecwmin": { "type": "number", "default": 9 }, "he_mu_edca_ac_bk_timer": { "type": "number", "default": 255 }, "he_mu_edca_ac_vi_aci": { "type": "number", "default": 2 }, "he_mu_edca_ac_vi_aifsn": { "type": "number", "default": 5 }, "he_mu_edca_ac_vi_ecwmax": { "type": "number", "default": 7 }, "he_mu_edca_ac_vi_ecwmin": { "type": "number", "default": 5 }, "he_mu_edca_ac_vi_timer": { "type": "number", "default": 255 }, "he_mu_edca_ac_vo_aci": { "type": "number", "default": 3 }, "he_mu_edca_ac_vo_aifsn": { "type": "number", "default": 5 }, "he_mu_edca_ac_vo_ecwmax": { "type": "number", "default": 7 }, "he_mu_edca_ac_vo_ecwmin": { "type": "number", "default": 5 }, "he_mu_edca_ac_vo_timer": { "type": "number", "default": 255 }, "he_mu_edca_qos_info_param_count": { "type": "number", "default": 0 }, "he_mu_edca_qos_info_q_ack": { "type": "number", "default": 0 }, "he_mu_edca_qos_info_queue_request": { "type": "number", "default": 0 }, "he_mu_edca_qos_info_txop_request": { "type": "number", "default": 0 }, "he_oper_centr_freq_seg0_idx": { "description": "", "type": "string" }, "he_oper_chwidth": { "description": "", "type": "string" }, "he_6ghz_reg_pwr_type": { "description": "This config is to set the 6 GHz Access Point type.", "type": "number", "minimum": 0, "maximum": 4, "default": 0 }, "he_rts_threshold": { "description": "Duration of STA transmission", "type": "number", "default": 1023 }, "he_spr_non_srg_obss_pd_max_offset": { "description": "", "type": "number" }, "he_spr_psr_enabled": { "description": "", "type": "boolean", "default": false }, "he_spr_sr_control": { "description": "", "type": "number", "default": 3 }, "he_su_beamformee": { "description": "", "type": "boolean", "default": true }, "he_su_beamformer": { "description": "", "type": "boolean", "default": true }, "he_twt_required": { "description": "", "type": "boolean", "default": false }, "hostapd_options": { "type": "array", "items": { "type": "string" } }, "ht_coex": { "description": "Disable honoring 40 MHz intolerance in coexistence flags of stations", "type": "boolean", "default": false }, "htc_vht": { "description": "STA supports receiving a VHT variant HT Control field", "type": "boolean", "default": true }, "htmode": { "description": "Specifies the high throughput mode", "type": "string", "enum": [ "NOHT", "HT20", "HT40-", "HT40+", "HT40", "VHT20", "VHT40", "VHT80", "VHT160", "HE20", "HE40", "HE80", "HE160", "EHT20", "EHT40", "EHT80", "EHT160", "EHT320" ] }, "hwmode": { "type": "alias", "default": "hw_mode" }, "hw_mode": { "description": "Legacy way, use the band property instead", "type": "string", "enum": [ "11a", "11b", "11g", "11ad" ] }, "ieee80211d": { "description": "Enables IEEE 802.11d country IE (information element) advertisement in beacon and probe response frames. This IE contains the country code and channel/power map. Requires country", "type": "boolean", "default": true }, "ieee80211h": { "description": "This enables radar detection and DFS support", "type": "boolean", "default": true }, "ieee80211w": { "description": "Whether management frame protection (MFP) is enabled", "type": "number", "minimum": 0, "maximum": 2 }, "ieee80211w_max_timeout": { "type": "alias", "default": "assoc_sa_query_max_timeout" }, "ieee80211w_mgmt_cipher": { "description": "Cypher used for MFP", "type": "string" }, "ieee80211w_retry_timeout": { "type": "alias", "default": "assoc_sa_query_retry_timeout" }, "ifname_prefix": { "description": "Default ifname prefix for this radio", "type": "string" }, "iface_max_num_sta": { "description": "Limits the maximum allowed number of associated clients", "type": "number" }, "ldpc": { "description": " LDPC (Low-Density Parity-Check code) capability ", "type": "boolean", "default": true }, "legacy_rates": { "description": "Allow legacy 802.11b data rates (used by cell_density)", "type": "boolean", "default": false }, "local_pwr_constraint": { "description": "Add Power Constraint element to Beacon and Probe Response frame", "type": "number", "minimum": 0, "maximum": 255 }, "log_80211": { "description": "Enable IEEE 802.11 logging", "type": "boolean", "default": true }, "log_8021x": { "description": "Enable IEEE 802.1X logging", "type": "boolean", "default": true }, "log_driver": { "description": "Enable driver interface logging", "type": "boolean", "default": true }, "log_iapp": { "description": "Enable iapp logging", "type": "boolean", "default": true }, "log_level": { "description": "Log severity", "type": "number", "default": 2, "minimum": 0, "maximum": 4 }, "log_mlme": { "description": "Enable MLME logging", "type": "boolean", "default": true }, "log_radius": { "description": "Enable Radius logging", "type": "boolean", "default": true }, "log_wpa": { "description": "Enable WPA logging", "type": "boolean", "default": true }, "logger_stdout": { "description": "Log to stdout", "type": "boolean", "default": true }, "logger_stdout_level": { "description": "Log severity", "type": "number", "default": 2, "minimum": 0, "maximum": 4 }, "logger_syslog": { "description": "Log to syslog", "type": "boolean", "default": true }, "logger_syslog_level": { "description": "Syslog severity", "type": "number", "default": 2, "minimum": 0, "maximum": 4 }, "macaddr": { "type": "alias", "default": "bssid" }, "macaddr_base": { "type": "string", "description": "Base MAC address used for deriving interface MAC addresses" }, "max_amsdu": { "description": "Maximum A-MSDU length of 7935 octects (3839 octets if option set to 0)", "type": "boolean", "default": true }, "maxassoc": { "type": "alias", "default": "iface_max_num_sta" }, "mbssid": { "description": "Multiple BSSID Advertisement in IEEE 802.11ax IEEE Std 802.11ax-2021 added a feature where instead of multiple interfaces on a common radio transmitting individual Beacon frames, those interfaces can form a set with a common Beacon frame transmitted for all Set minimum permitted max TX power (in dBm) for ACS and DFS channel selection", "type": "number", "default": 0, "minimum": 0, "maximum": 2 }, "min_tx_power": { "description": "Set minimum permitted max TX power (in dBm) for ACS and DFS channel selection", "type": "number", "default": 0 }, "mu_beamformee": { "description": "Supports operation as an MU beamformee", "type": "boolean", "default": true }, "mu_beamformer": { "description": " Supports operation as an MU beamformer", "type": "boolean", "default": true }, "multiple_bssid": { "type": "alias", "default": "mbssid" }, "num_global_macaddr": { "description": "The number of MACs that this radio can use", "type": "number", "default": 1 }, "noscan": { "description": "Do not scan for overlapping BSSs in HT40+/- mode.", "type": "boolean", "default": false }, "okc": { "description": "Enable Opportunistic Key Caching", "type": "boolean" }, "path": { "description": "Alternative to phy used to identify the device based paths in /sys/devices", "type": "string" }, "phy": { "description": "Name of the phy, as described in board.json", "type": "string" }, "radio": { "description": "Index of the phy radio (for multi-radio PHYs)", "type": "number", "default": -1 }, "reg_power_type": { "type": "alias", "default": "he_6ghz_reg_pwr_type" }, "require_mode": { "description": "Sets the minimum client capability level mode that connecting clients must support to be allowed to connect", "type": "string", "enum": [ "n", "ac", "ax" ] }, "rnr_beacon": { "description": "", "type": "string" }, "rsn_preauth": { "description": "Enable IEEE 802.11i/RSN/WPA2 pre-authentication", "type": "boolean" }, "rssi_ignore_probe_request": { "description": "Ignore Probe Request frames if RSSI is below given threshold (in dBm)", "type": "number", "default": 0 }, "rssi_reject_assoc_rssi": { "description": "Reject STA association if RSSI is below given threshold (in dBm)", "type": "number", "default": 0 }, "rssi_reject_assoc_timeout": { "description": "Association retry delay in seconds allowed by the STA if RSSI has not met the threshold", "type": "number", "default": 30, "minimum": 0, "maximum": 255 }, "rts": { "description": "Override the RTS/CTS threshold", "type": "number" }, "rts_threshold": { "description": "RTS/CTS threshold", "type": "number", "minimum": -1, "maximum": 65535 }, "rx_antenna_pattern": { "description": "Rx antenna pattern does not change during the lifetime of an association", "type": "boolean", "default": true }, "rx_stbc": { "description": "Supports reception of PPDUs using STBC", "type": "number", "default": 3, "minimum": 0, "maximum": 4 }, "rxantenna": { "description": "Specifies the antenna for receiving, the value may be driver specific, usually it is 1 for the first and 2 for the second antenna. Specifying 0 enables automatic selection by the driver if supported. This option has no effect if diversity is enabled", "type": "number" }, "rxldpc": { "description": "Supports receiving LDPC coded pkts", "type": "boolean", "default": true }, "scan_list": { "description": "List of frequencies (in MHz) to scan when looking for networks in client mode", "type": "array", "items": { "type": "number" } }, "short_gi_160": { "description": "Short GI for 160 MHz", "type": "boolean", "default": true }, "short_gi_20": { "description": "Short GI for 20 MHz", "type": "boolean", "default": true }, "short_gi_40": { "description": "Short GI for 40 MHz", "type": "boolean", "default": true }, "short_gi_80": { "description": "Short GI for 80 MHz", "type": "boolean", "default": true }, "spectrum_mgmt_required": { "description": "Set Spectrum Management subfield in the Capability Information field", "type": "boolean", "default": false }, "stationary_ap": { "description": "Stationary AP config indicates that the AP doesn't move hence location data can be considered as always up to date.", "type": "boolean", "default": true }, "su_beamformee": { "description": "Single user beamformee", "type": "boolean", "default": true }, "su_beamformer": { "description": "Single user beamformer", "type": "boolean", "default": true }, "supported_rates": { "description": "Set the supported data rates. Each supported rate is measured in kb/s. This option only has an effect on ap and adhoc wifi-ifaces. This must be a superset of the rates set in basic_rate. The minimum basic rate should also be the minimum supported rate. It is recommended to use the cell_density option instead", "type": "array", "items": { "type": "number" } }, "tx_antenna_pattern": { "description": "Tx antenna pattern does not change during the lifetime of an association", "type": "boolean", "default": true }, "tx_burst": { "type": "alias", "default": "tx_queue_data2_burst" }, "tx_queue_data2_burst": { "description": "", "type": "number" }, "tx_stbc": { "description": "Transmit STBC (Space-Time Block Coding)", "type": "boolean", "default": true }, "tx_stbc_2by1": { "description": "Supports transmission of at least 2×1 STBC", "type": "boolean", "default": true }, "txantenna": { "description": "Specifies the antenna for transmitting, values are identical to rxantenna", "type": "number" }, "txpower": { "description": "Specifies the maximum desired transmission power in dBm. The actual txpower used depends on regulatory requirements", "type": "number" }, "type": { "description": "Device type (only mac80211 supported)", "type": "string" }, "vht160": { "description": "Supported channel widths. 0 == 160MHz and 80+80 MHz not supported, 1 == 160 MHz supported, 2 == 160MHz and 80+80 MHz supported", "type": "number", "minimum": 0, "maximum": 2, "default": 2 }, "vht_link_adapt": { "description": "TA supports link adaptation using VHT variant HT Control field", "type": "number", "minimum": 0, "maximum": 3 }, "vht_max_a_mpdu_len_exp": { "description": "Indicates the maximum length of A-MPDU pre-EOF padding that the STA can recv", "type": "number", "minimum": 0, "maximum": 7, "default": 7 }, "vht_max_mpdu": { "description": "Maximum MPDU length", "type": "number", "enum": [ 3895, 7991, 11454 ], "default": 11454 }, "vht_txop_ps": { "description": "VHT TXOP PS mode", "type": "boolean", "default": true } } } 07070101AE2349000081A40000000000000000000000016A426C28000002AD000000FE0000000000000000000000000000002C00000000usr/share/schema/wireless.wifi-station.json{ "$id": "https://openwrt.org/wifi.station.json", "$schema": "http://json-schema.org/draft-07/schema#", "description": "OpenWrt WiFi Station Schema", "type": "object", "properties": { "iface": { "description": "List of interfaces this station is associated with", "type": "array", "items": { "type": "string" } }, "mac": { "description": "The station's MAC addresses", "type": "array", "items": { "type": "string" }, "default": ["00:00:00:00:00:00"] }, "key": { "description": "The passphrase that shall be used", "type": "string" }, "vid": { "description": "The VLAN Id used by the station", "type": "string" } } } 07070101AE2342000081A40000000000000000000000016A426C2800004C55000000FE0000000000000000000000000000001C00000000usr/share/wifi_devices.json{ "pci": [ [ "0x0777", "0x11ac", "0x0777", "0xe7f9", 0, 0, "Ubiquiti", "LiteBeam, 5AC" ], [ "0xffff", "0xffff", "0xffff", "0xb102", 0, 0, "Ubiquiti", "PowerStation2, (18V)" ], [ "0xffff", "0xffff", "0xffff", "0xb202", 0, 0, "Ubiquiti", "PowerStation2, (16D)" ], [ "0xffff", "0xffff", "0xffff", "0xb302", 0, 0, "Ubiquiti", "PowerStation2, (EXT)" ], [ "0xffff", "0xffff", "0xffff", "0xb105", 0, 0, "Ubiquiti", "PowerStation5, (22V)" ], [ "0xffff", "0xffff", "0xffff", "0xb305", 0, 0, "Ubiquiti", "PowerStation5, (EXT)" ], [ "0xffff", "0xffff", "0xffff", "0xc302", 0, 0, "Ubiquiti", "PicoStation2" ], [ "0xffff", "0xffff", "0xffff", "0xc3a2", 10, 0, "Ubiquiti", "PicoStation2, HP" ], [ "0xffff", "0xffff", "0xffff", "0xa105", 0, 0, "Ubiquiti", "WispStation5" ], [ "0xffff", "0xffff", "0xffff", "0xa002", 10, 0, "Ubiquiti", "LiteStation2" ], [ "0xffff", "0xffff", "0xffff", "0xa005", 5, 0, "Ubiquiti", "LiteStation5" ], [ "0xffff", "0xffff", "0xffff", "0xc002", 10, 0, "Ubiquiti", "NanoStation2" ], [ "0xffff", "0xffff", "0xffff", "0xc005", 5, 0, "Ubiquiti", "NanoStation5" ], [ "0xffff", "0xffff", "0xffff", "0xc102", 10, 0, "Ubiquiti", "NanoStation, Loco2" ], [ "0xffff", "0xffff", "0xffff", "0xc105", 5, 0, "Ubiquiti", "NanoStation, Loco5" ], [ "0xffff", "0xffff", "0xffff", "0xc202", 10, 0, "Ubiquiti", "Bullet2" ], [ "0xffff", "0xffff", "0xffff", "0xc205", 5, 0, "Ubiquiti", "Bullet5" ], [ "0x168c", "0xffff", "0x0777", "0xe002", 6, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe003", 3, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe005", 5, 0, "Ubiquiti", "NanoStation, M5" ], [ "0x168c", "0xffff", "0x0777", "0xe006", 5, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe009", 6, 0, "Ubiquiti", "NanoStation, Loco, M9" ], [ "0x168c", "0xffff", "0x0777", "0xe012", 10, 0, "Ubiquiti", "NanoStation, M2" ], [ "0x168c", "0xffff", "0x0777", "0xe035", 3, 0, "Ubiquiti", "NanoStation, M3" ], [ "0x168c", "0xffff", "0x0777", "0xe0a2", 2, 0, "Ubiquiti", "NanoStation, Loco, M2" ], [ "0x168c", "0xffff", "0x0777", "0xe0a5", 1, 0, "Ubiquiti", "NanoStation, Loco, M5" ], [ "0x168c", "0xffff", "0x0777", "0xe102", 6, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe105", 5, 0, "Ubiquiti", "Rocket, M5" ], [ "0x168c", "0xffff", "0x0777", "0xe112", 10, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe115", 3, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe1a3", 3, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe1a5", 5, 0, "Ubiquiti", "PowerBridge, M5" ], [ "0x168c", "0xffff", "0x0777", "0xe1b2", 10, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe1b3", 3, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe1b5", 5, 0, "Ubiquiti", "Rocket, M5" ], [ "0x168c", "0xffff", "0x0777", "0xe1b6", 5, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe1b9", 6, 0, "Ubiquiti", "Rocket, M9" ], [ "0x168c", "0xffff", "0x0777", "0xe1c2", 10, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe1c3", 3, 0, "Ubiquiti", "Rocket, M3" ], [ "0x168c", "0xffff", "0x0777", "0xe1c5", 5, 0, "Ubiquiti", "Rocket, M5, GPS" ], [ "0x168c", "0xffff", "0x0777", "0xe1c5", 5, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe1d2", 10, 0, "Ubiquiti", "Rocket, M2, Titanium" ], [ "0x168c", "0xffff", "0x0777", "0xe1d3", 3, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe1d5", 5, 0, "Ubiquiti", "airOS, XM/XW" ], [ "0x168c", "0xffff", "0x0777", "0xe1d9", 6, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe1e3", 3, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe1e5", 5, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe202", 12, 0, "Ubiquiti", "Bullet, M2" ], [ "0x168c", "0xffff", "0x0777", "0xe205", 6, 0, "Ubiquiti", "Bullet, M5" ], [ "0x168c", "0xffff", "0x0777", "0xe212", 1, 0, "Ubiquiti", "AirGrid, M2" ], [ "0x168c", "0xffff", "0x0777", "0xe215", 1, 0, "Ubiquiti", "AirGrid, M5" ], [ "0x168c", "0xffff", "0x0777", "0xe232", 2, 0, "Ubiquiti", "NanoBridge, M2" ], [ "0x168c", "0xffff", "0x0777", "0xe233", 3, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe235", 1, 0, "Ubiquiti", "NanoBridge, M5" ], [ "0x168c", "0xffff", "0x0777", "0xe239", 6, 0, "Ubiquiti", "NanoBridge, M9" ], [ "0x168c", "0xffff", "0x0777", "0xe242", 9, 0, "Ubiquiti", "AirGrid, M2, HP" ], [ "0x168c", "0xffff", "0x0777", "0xe243", 3, 0, "Ubiquiti", "NanoBridge, M3" ], [ "0x168c", "0xffff", "0x0777", "0xe245", 6, 0, "Ubiquiti", "AirGrid, M5, HP" ], [ "0x168c", "0xffff", "0x0777", "0xe252", 9, 0, "Ubiquiti", "AirGrid, M2, HP" ], [ "0x168c", "0xffff", "0x0777", "0xe255", 6, 0, "Ubiquiti", "AirGrid, M5, HP" ], [ "0x168c", "0xffff", "0x0777", "0xe2a3", 3, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe2a5", 5, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe2b2", 10, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe2b5", 1, 0, "Ubiquiti", "NanoBridge, M5" ], [ "0x168c", "0xffff", "0x0777", "0xe2b9", 6, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe2c2", 10, 0, "Ubiquiti", "NanoBeam, M2, Int" ], [ "0x168c", "0xffff", "0x0777", "0xe2c3", 6, 0, "Ubiquiti", "Bullet, M2, XW" ], [ "0x168c", "0xffff", "0x0777", "0xe2c4", 6, 0, "Ubiquiti", "airOS, XW" ], [ "0x168c", "0xffff", "0x0777", "0xe2d2", 12, 0, "Ubiquiti", "Bullet, M2, Titanium, HP" ], [ "0x168c", "0xffff", "0x0777", "0xe2d4", 6, 0, "Ubiquiti", "airOS, XW" ], [ "0x168c", "0xffff", "0x0777", "0xe2d5", 6, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe2e5", 4, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe302", 12, 0, "Ubiquiti", "PicoStation, M2"], [ "0x168c", "0xffff", "0x0777", "0xe305", 6, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe345", 6, 0, "Ubiquiti", "WispStation, M5" ], [ "0x168c", "0xffff", "0x0777", "0xe3a5", 5, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe3b5", 6, 0, "Ubiquiti", "airOS, XM/XW" ], [ "0x168c", "0xffff", "0x0777", "0xe3e5", 4, 0, "Ubiquiti", "PowerBeam, M5, 300" ], [ "0x168c", "0xffff", "0x0777", "0xe402", 10, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe405", 1, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe4a2", 1, 0, "Ubiquiti", "AirRouter" ], [ "0x168c", "0xffff", "0x0777", "0xe4a5", 1, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe4b2", 9, 0, "Ubiquiti", "AirRouter, HP" ], [ "0x168c", "0xffff", "0x0777", "0xe4d5", 5, 0, "Ubiquiti", "Rocket, M5, Titanium" ], [ "0x168c", "0xffff", "0x0777", "0xe4e5", 4, 0, "Ubiquiti", "PowerBeam, M5, 400" ], [ "0x168c", "0xffff", "0x0777", "0xe5e5", 4, 0, "Ubiquiti", "airOS, XW" ], [ "0x168c", "0xffff", "0x0777", "0xe6a2", 1, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe6b2", 1, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe6b5", 5, 0, "Ubiquiti", "Rocket, M5, XW" ], [ "0x168c", "0xffff", "0x0777", "0xe6c2", 6, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe6e5", 4, 0, "Ubiquiti", "PowerBeam, M5, 400, ISO" ], [ "0x168c", "0xffff", "0x0777", "0xe7f8", 2, 0, "Ubiquiti", "airOS, XW" ], [ "0x168c", "0xffff", "0x0777", "0xe805", 5, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0xffff", "0x0777", "0xe812", 6, 0, "Ubiquiti", "NanoBeam, M2, 13" ], [ "0x168c", "0xffff", "0x0777", "0xe815", 4, 0, "Ubiquiti", "NanoBeam, M5, 16" ], [ "0x168c", "0xffff", "0x0777", "0xe825", 4, 0, "Ubiquiti", "NanoBeam, M5, 19" ], [ "0x168c", "0xffff", "0x0777", "0xe835", 6, 0, "Ubiquiti", "AirGrid, M5, XW" ], [ "0x168c", "0xffff", "0x0777", "0xe845", 1, 0, "Ubiquiti", "NanoStation, Loco, M5, XW" ], [ "0x168c", "0xffff", "0x0777", "0xe855", 5, 0, "Ubiquiti", "NanoStation, M5, XW" ], [ "0x168c", "0xffff", "0x0777", "0xe865", 6, 0, "Ubiquiti", "LiteBeam, M5" ], [ "0x168c", "0xffff", "0x0777", "0xe866", 6, 0, "Ubiquiti", "NanoStation, M2, XW" ], [ "0x168c", "0xffff", "0x0777", "0xe867", 2, 0, "Ubiquiti", "NanoStation, Loco, M2, XW" ], [ "0x168c", "0xffff", "0x0777", "0xe868", 7, 0, "Ubiquiti", "Rocket, M2, XW" ], [ "0x168c", "0xffff", "0x0777", "0xe869", 2, 0, "Ubiquiti", "airOS, XW" ], [ "0x168c", "0xffff", "0x0777", "0xe875", 4, 0, "Ubiquiti", "airOS, XW" ], [ "0x168c", "0xffff", "0x0777", "0xe879", 2, 0, "Ubiquiti", "airOS, XW" ], [ "0x168c", "0xffff", "0x0777", "0xe885", 4, 0, "Ubiquiti", "PowerBeam, M5, 620, XW" ], [ "0x168c", "0xffff", "0x0777", "0xe895", 4, 0, "Ubiquiti", "airOS, XW" ], [ "0x168c", "0xffff", "0x0777", "0xe8a5", 1, 0, "Ubiquiti", "NanoStation, Loco, M5"], [ "0x168c", "0xffff", "0x0777", "0xe8b5", 5, 0, "Ubiquiti", "airOS, XM" ], [ "0x168c", "0x001b", "0x0777", "0x3002", 10, 0, "Ubiquiti", "XR2" ], [ "0x168c", "0x001b", "0x7777", "0x3002", 10, 0, "Ubiquiti", "XR2" ], [ "0x168c", "0x001b", "0x0777", "0x3b02", 10, 0, "Ubiquiti", "XR2.3" ], [ "0x168c", "0x001b", "0x0777", "0x3c02", 10, 0, "Ubiquiti", "XR2.6" ], [ "0x168c", "0x001b", "0x0777", "0x3b03", 10, 0, "Ubiquiti", "XR3-2.8" ], [ "0x168c", "0x001b", "0x0777", "0x3c03", 10, 0, "Ubiquiti", "XR3-3.6" ], [ "0x168c", "0x001b", "0x0777", "0x3003", 10, 0, "Ubiquiti", "XR3" ], [ "0x168c", "0x001b", "0x0777", "0x3004", 10, 0, "Ubiquiti", "XR4" ], [ "0x168c", "0x001b", "0x0777", "0x3005", 10, 0, "Ubiquiti", "XR5" ], [ "0x168c", "0x001b", "0x7777", "0x3005", 10, 0, "Ubiquiti", "XR5" ], [ "0x168c", "0x001b", "0x0777", "0x3007", 10, 0, "Ubiquiti", "XR7" ], [ "0x168c", "0x001b", "0x0777", "0x3009", 10, -1520, "Ubiquiti", "XR9" ], [ "0x168c", "0x001b", "0x168c", "0x2063", 0, 0, "Atheros", "AR5413" ], [ "0x168c", "0x0013", "0x168c", "0x1042", 1, 0, "Ubiquiti", "SRC" ], [ "0x168c", "0x0013", "0x0777", "0x2041", 10, 0, "Ubiquiti", "SR2" ], [ "0x168c", "0x0013", "0x0777", "0x2004", 6, 0, "Ubiquiti", "SR4" ], [ "0x168c", "0x0013", "0x7777", "0x2004", 6, 0, "Ubiquiti", "SR4" ], [ "0x168c", "0x0013", "0x0777", "0x1004", 6, 0, "Ubiquiti", "SR4C" ], [ "0x168c", "0x0013", "0x7777", "0x1004", 6, 0, "Ubiquiti", "SR4C" ], [ "0x168c", "0x0013", "0x168c", "0x2042", 7, 0, "Ubiquiti", "SR5" ], [ "0x168c", "0x0013", "0x7777", "0x2009", 12, -1500, "Ubiquiti", "SR9" ], [ "0x168c", "0x0027", "0x168c", "0x2082", 7, 0, "Ubiquiti", "SR71A" ], [ "0x168c", "0x0027", "0x0777", "0x4082", 7, 0, "Ubiquiti", "SR71" ], [ "0x168c", "0x0029", "0x0777", "0x4005", 7, 0, "Ubiquiti", "SR71-15" ], [ "0x168c", "0x002a", "0x0777", "0xe302", 12, 0, "Ubiquiti", "PicoStation, M2" ], [ "0x168c", "0x002a", "0x0777", "0xe012", 12, 0, "Ubiquiti", "NanoStation, M2" ], [ "0x168c", "0x002a", "0x0777", "0xe005", 5, 0, "Ubiquiti", "NanoStation, M5" ], [ "0x168c", "0x002a", "0x0777", "0xe202", 12, 0, "Ubiquiti", "Bullet, M2" ], [ "0x168c", "0x002a", "0x0777", "0xe805", 5, 0, "Ubiquiti", "Bullet, M5" ], [ "0x168c", "0x002a", "0x0777", "0xe345", 0, 0, "Ubiquiti", "WispStation, M5" ], [ "0x168c", "0x0029", "0x168c", "0xa094", 0, 0, "Atheros", "AR9220" ], [ "0x168c", "0x0029", "0x168c", "0xa095", 0, 0, "Atheros", "AR9223" ], [ "0x168c", "0x002a", "0x168c", "0xa093", 0, 0, "Atheros", "AR9280" ], [ "0x168c", "0x002b", "0x168c", "0xa091", 0, 0, "Atheros", "AR9285" ], [ "0x168c", "0x002d", "0x168c", "0x209a", 0, 0, "Atheros", "AR9287" ], [ "0x168c", "0x002e", "0x1a3b", "0x1121", 0, 0, "Atheros", "AR9287" ], [ "0x168c", "0x002e", "0x0777", "0xe0a2", 8, 0, "Ubiquiti", "NanoStation, Loco, M2, (XM)" ], [ "0x168c", "0x002e", "0x168c", "0x30a4", 0, 0, "Atheros", "AR9287" ], [ "0x168c", "0x002e", "0x168c", "0xa199", 0, 0, "Atheros", "AR9287" ], [ "0x168c", "0x0030", "0x168c", "0x3112", 0, 0, "Atheros", "AR9380" ], [ "0x168c", "0x0030", "0x168c", "0x3114", 0, 0, "Atheros", "AR9390" ], [ "0x168c", "0x0033", "0x168c", "0xa120", 0, 0, "Atheros", "AR9580" ], [ "0x168c", "0x0033", "0x168c", "0xa136", 0, 0, "Atheros", "AR9580" ], [ "0x168c", "0x0033", "0x168c", "0x3123", 0, 0, "Atheros", "AR9590" ], [ "0x168c", "0x0033", "0x19b6", "0xd014", 0, 0, "MikroTik", "R11e-5HnD" ], [ "0x168c", "0x0033", "0x19b6", "0xd057", 0, 0, "MikroTik", "R11e-5HnDr2" ], [ "0x168c", "0x0033", "0x19b6", "0xd016", 0, 0, "MikroTik", "R11e-2HPnD" ], [ "0x168c", "0x0034", "0x17aa", "0x3214", 0, 0, "Atheros", "AR9462" ], [ "0x168c", "0x003c", "0x0000", "0x0000", 0, 0, "Qualcomm Atheros", "QCA9880" ], [ "0x168c", "0x003c", "0x168c", "0x3223", 0, 0, "Qualcomm Atheros", "QCA9880" ], [ "0x168c", "0x003c", "0x1a56", "0x1420", 0, 0, "Qualcomm Atheros", "QCA9862" ], [ "0x168c", "0x003c", "0x19b6", "0xd03c", 0, 0, "Mikrotik", "R11e-5HacT" ], [ "0x168c", "0x003c", "0x19b6", "0xd075", 0, 0, "Mikrotik", "R11e-5HacD" ], [ "0x168c", "0x003e", "0x168c", "0x3361", 0, 0, "Qualcomm Atheros", "QCA6174" ], [ "0x168c", "0x0046", "0x168c", "0xcafe", 0, 0, "Qualcomm Atheros", "QCA9984" ], [ "0x168c", "0x0040", "0x168c", "0x0002", 0, 0, "Qualcomm Atheros", "QCA9990" ], [ "0x168c", "0x0046", "0x0777", "0xe535", 0, 0, "Qualcomm Atheros", "QCA9994" ], [ "0x168c", "0x0046", "0x0777", "0xe5a2", 0, 0, "Qualcomm Atheros", "QCA9994" ], [ "0x168c", "0x0050", "0x0000", "0x0000", 0, 0, "Qualcomm Atheros", "QCA9887" ], [ "0x168c", "0x0056", "0x0000", "0x0000", 0, 0, "Qualcomm Atheros", "QCA9886" ], [ "0x17cb", "0x1104", "0x17cb", "0x1104", 0, 0, "Qualcomm Atheros", "QCN6024/9024/9074" ], [ "0x1814", "0x3051", "0x1814", "0x0007", 0, 0, "Ralink", "Rt3051" ], [ "0x1814", "0x3052", "0x1814", "0x0008", 0, 0, "Ralink", "Rt3052" ], [ "0x1814", "0x3350", "0x1814", "0x000b", 0, 0, "Ralink", "Rt3350" ], [ "0x1814", "0x3662", "0x1814", "0x000d", 0, 0, "Ralink", "Rt3662" ], [ "0x11ab", "0x2a55", "0x11ab", "0x0000", 0, 0, "Marvell", "88W8864" ], [ "0x02df", "0x9135", "0x0000", "0x0000", 0, 0, "Marvell", "88W8887" ], [ "0x11ab", "0x2b40", "0x11ab", "0x0000", 0, 0, "Marvell", "88W8964" ], [ "0x02df", "0x9141", "0x0000", "0x0000", 0, 0, "Marvell", "88W8997" ], [ "0x14c3", "0x0608", "0x14c3", "0x0608", 0, 0, "AMD", "RZ608" ], [ "0x14c3", "0x7603", "0x14c3", "0x7603", 0, 0, "MediaTek", "MT7603E" ], [ "0x14c3", "0x7610", "0x14c3", "0x7610", 0, 0, "MediaTek", "MT7610E" ], [ "0x14c3", "0x7612", "0x14c3", "0x7612", 0, 0, "MediaTek", "MT7612E" ], [ "0x14c3", "0x7663", "0x14c3", "0x7663", 0, 0, "MediaTek", "MT7613BE" ], [ "0x14c3", "0x7615", "0x7615", "0x14c3", 0, 0, "MediaTek", "MT7615E" ], [ "0x14c3", "0x7628", "0x14c3", "0x0004", 0, 0, "MediaTek", "MT76x8" ], [ "0x14c3", "0x7650", "0x14c3", "0x7650", 0, 0, "MediaTek", "MT7610E" ], [ "0x14c3", "0x7662", "0x14c3", "0x7662", 0, 0, "MediaTek", "MT76x2E" ], [ "0x14c3", "0x7915", "0x14c3", "0x7915", 0, 0, "MediaTek", "MT7915E" ], [ "0x14c3", "0x7906", "0x14c3", "0x7906", 0, 0, "MediaTek", "MT7916AN" ], [ "0x14c3", "0x7990", "0x14C3", "0x6639", 0, 0, "MediaTek", "MT7996E" ], [ "0x14c3", "0x7992", "0x14C3", "0x7992", 0, 0, "MediaTek", "MT7992E" ], [ "0x14e4", "0xaa52", "0x14e4", "0xaa52", 0, 0, "Broadcom", "BCM43602" ], [ "0x02d0", "0xa9a6", "0x0000", "0x0000", 0, 0, "Cypress", "CYW43455" ], [ "0x02d0", "0x4345", "0x0000", "0x0000", 0, 0, "Cypress", "CYW43455" ], [ "0x1ae9", "0x0310", "0x1ae9", "0x0000", 0, 0, "Wilocity", "Wil6210" ], [ "0x0000", "0x0000", "0x148f", "0x7601", 0, 0, "MediaTek", "MT7601U" ], [ "0x0000", "0x0000", "0x0e8d", "0x7961", 0, 0, "MediaTek", "MT7921AU" ], [ "0x0000", "0x0000", "0x0b05", "0x1833", 0, 0, "ASUS", "USB-AC54" ], [ "0x0000", "0x0000", "0x0b05", "0x17eb", 0, 0, "ASUS", "USB-AC55" ], [ "0x0000", "0x0000", "0x0b05", "0x180b", 0, 0, "ASUS", "USB-N53, B1" ], [ "0x0000", "0x0000", "0x0e8d", "0x7612", 0, 0, "Aukey", "USBAC1200" ], [ "0x0000", "0x0000", "0x057c", "0x8503", 0, 0, "AVM", "FRITZ!WLAN, AC860" ], [ "0x0000", "0x0000", "0x7392", "0xb711", 0, 0, "Edimax", "EW-7722UAC" ], [ "0x0000", "0x0000", "0x0e8d", "0x7632", 0, 0, "High, Cloud", "HC-M7662BU1" ], [ "0x0000", "0x0000", "0x2c4e", "0x0103", 0, 0, "Mercury", "UD13" ], [ "0x0000", "0x0000", "0x0846", "0x9053", 0, 0, "Netgear", "A6210" ], [ "0x0000", "0x0000", "0x045e", "0x02e6", 0, 0, "Microsoft", "XBox, One, Wireless, Adapter" ], [ "0x0000", "0x0000", "0x045e", "0x02fe", 0, 0, "Microsoft", "XBox, One, Wireless, Adapter" ], [ "0x0000", "0x0000", "0x148f", "0x7610", 0, 0, "MediaTek", "MT7610U" ], [ "0x0000", "0x0000", "0x13b1", "0x003e", 0, 0, "Linksys", "AE6000" ], [ "0x0000", "0x0000", "0x0e8d", "0x7610", 0, 0, "Sabrent", "NTWLAC" ], [ "0x0000", "0x0000", "0x7392", "0xa711", 0, 0, "Edimax", "7711MAC" ], [ "0x0000", "0x0000", "0x148f", "0x761a", 0, 0, "TP-Link", "TL-WDN5200" ], [ "0x0000", "0x0000", "0x0b05", "0x17d1", 0, 0, "ASUS", "USB-AC51" ], [ "0x0000", "0x0000", "0x0b05", "0x17db", 0, 0, "ASUS", "USB-AC50" ], [ "0x0000", "0x0000", "0x0df6", "0x0075", 0, 0, "Sitecom", "WLA-3100" ], [ "0x0000", "0x0000", "0x2019", "0xab31", 0, 0, "Planex", "GW-450D" ], [ "0x0000", "0x0000", "0x2001", "0x3d02", 0, 0, "D-Link", "DWA-171, rev, B1" ], [ "0x0000", "0x0000", "0x0586", "0x3425", 0, 0, "Zyxel", "NWD6505" ], [ "0x0000", "0x0000", "0x07b8", "0x7610", 0, 0, "AboCom", "AU7212" ], [ "0x0000", "0x0000", "0x04bb", "0x0951", 0, 0, "I-O, DATA", "WN-AC433UK" ], [ "0x0000", "0x0000", "0x057c", "0x8502", 0, 0, "AVM", "FRITZ!WLAN, AC430" ], [ "0x0000", "0x0000", "0x293c", "0x5702", 0, 0, "Comcast", "Xfinity, KXW02AAA" ], [ "0x0000", "0x0000", "0x20f4", "0x806b", 0, 0, "TRENDnet", "TEW-806UBH" ], [ "0x0000", "0x0000", "0x7392", "0xc711", 0, 0, "Devolo", "WiFi, Stick, ac" ], [ "0x0000", "0x0000", "0x0df6", "0x0079", 0, 0, "Sitecom", "WL-356" ], [ "0x0000", "0x0000", "0x2357", "0x0123", 0, 0, "TP-Link", "T2UHP, US, v1" ], [ "0x0000", "0x0000", "0x2357", "0x010b", 0, 0, "TP-Link", "T2UHP, UN, v1" ], [ "0x0000", "0x0000", "0x2357", "0x0105", 0, 0, "TP-Link", "Archer, T1U" ], [ "0x0000", "0x0000", "0x0e8d", "0x7630", 0, 0, "MediaTek", "MT7630U" ], [ "0x0000", "0x0000", "0x0e8d", "0x7650", 0, 0, "MediaTek", "MT7650U" ], [ "0x0000", "0x0000", "0x0e8d", "0x7663", 0, 0, "MediaTek", "MT7663U" ], [ "0x0000", "0x0000", "0x043e", "0x310c", 0, 0, "LG", "LGSBWAC02" ], [ "0x0000", "0x0000", "0x0bda", "0x8176", 0, 0, "Realtek", "RTL8188CU" ], [ "0x0000", "0x0000", "0x0bda", "0xf179", 0, 0, "Realtek", "RTL8188FTV" ] ], "compatible": { "qca,ar9130-wifi": [ "Atheros", "AR9130" ], "qca,ar9330-wifi": [ "Atheros", "AR9330" ], "qca,ar9340-wifi": [ "Atheros", "AR9340" ], "qca,qca9530-wifi": [ "Qualcomm Atheros", "QCA9530" ], "qca,qca9550-wifi": [ "Qualcomm Atheros", "QCA9550" ], "qca,qca9560-wifi": [ "Qualcomm Atheros", "QCA9560" ], "qcom,ipq4019-wifi": [ "Qualcomm Atheros", "IPQ4019" ], "qcom,ipq6018-wifi": [ "Qualcomm Atheros", "IPQ6018" ], "qcom,ipq8074-wifi": [ "Qualcomm Atheros", "IPQ8074" ], "mediatek,mt7622-wmac": [ "MediaTek", "MT7622" ], "mediatek,mt7628-wmac": [ "MediaTek", "MT7628" ], "mediatek,mt7981-wmac": [ "MediaTek", "MT7981" ], "mediatek,mt7986-wmac": [ "MediaTek", "MT7986" ], "ralink,rt2880-wmac": [ "Ralink", "Rt2880" ], "ralink,rt3050-wmac": [ "Ralink", "Rt3050" ], "ralink,rt3352-wmac": [ "Ralink", "Rt3352" ], "ralink,rt3883-wmac": [ "Ralink", "Rt3883" ], "ralink,rt5350-wmac": [ "Ralink", "Rt5350" ], "ralink,rt7620-wmac": [ "MediaTek", "MT7620" ] } } 07070101AE21A2000041ED0000000000000000000000036A426C2800000000000000FE0000000000000000000000000000000C00000000usr/libexec07070101AE23B1000081ED0000000000000000000000016A426C2800003028000000FE0000000000000000000000000000001900000000usr/libexec/logread-uboxELF@4t4 (44@4@@@tt@t@p@@p@@@@$$/?@?@ @@ppQtdRtd/?@?@/lib/ld-musl-mipsel-sf.so.1 @ @ @@?@ ?@0@@@  p@@5p= @@ @0ppp@ ppBp(pB @2p?@oo @oo @%B"5#7:?8+<,@/6>;2-=&A*% 1    $)'03!4(9.WE0@@@!@"`> 7#4@@'8@@"jx*1@ ?/P!@"6<@@@@@GQOWf^fv@@m?@u{e__RLD_MAPuloop_doneuloop_fd_addblob_buf_initblobmsg_parseblobmsg_add_fieldustream_get_read_bufustream_consumeuloop_run_timeoutuloop_fd_deleteusock_finiuloop_timeout_setuloop_initustream_fd_initfputsstrlenstderrfclosememsetfopenunlinkopenlogfprintfwrite__stack_chk_failuloop_cancelledmallocmemcpy__stack_chk_guardsnprintfubus_freeubus_strerrorubus_lookup_idubus_invoke_async_fdubus_connectubus_complete_request_async__stat_time64__umoddi3__udivdi3__register_frame_info__deregister_frame_infogetpidsleepstrtoulsendrename__ctime64signalstrncatregcompgetoptregexecsyslogsprintffsyncexitatoi__libc_start_mainoptindoptarglibubox.so.20260213libubus.so.20251202libjson-c.so.5libblobmsg_json.so.20260213libgcc_s.so.1libc.soGLIBC_2.0ii 0@@~4@@~ 8@@~<@@~?@~4?@ ?@$?@(?@,?@0?@4?@8?@ ?@??@@?@A' 'dm lhjͶ"gJ* eҠ*ƲǴ( {Q `ZQ`Pql`QQ;`0qJ`Fq^`iQgdHAJ!Z`D3 m`ieoi _Sqa R`j@2H2@ۘk@@Bۜ@ۜ@BH2I````` gknmkL ӎjD`m@[nmkL Ӈz`xn_*` mBt%Lx @"t$|e"g "hegxggu|mji D qmod@ ZXg Dkhm 32gm3m0klMj am\ Q@*"Ұ48*`Cc4Ba0*BC-` xB"g², !ĵ gg0 gmn$ MRA `l N3jL볲@"Gkl" "g Ҭ@*#ggnog"gҥ@"#ggno\gg m`g "gIk@ram`nA@ " `n[  `i[g [ၵ  `i[g [y * `n[s  `n[ gkX@F"R`gg@K"fflNeL, jIKm^ AG@ra Y@?"GO)j oTnr? a `nc"eM@*HF k|oNF@"hnB]lL]aC,??+jLhn;laC,5J+"0 /gm` gJ%|de0@@lA@ @,A@(A@HA@@?@@A@0A@A@@@4A@@ kernel:%s.oldfailed to open %s: %m [%lu.%03u] <%u> : kernel: Failed to send log data to %s:%s via %s %s %s%s.%s%s %s authauthprivcrondaemonftpkernlprmailmarknewssecuritysysloguseruucplocal0local1local2local3local4local5local6local7alertcritdebugemergerrerrorinfononenoticepanicwarnwarningUsage: %s [options] Options: -s Path to ubus socket -l Got only the last 'count' messages -e Filter messages with a regexp -r Stream message to a server -F Log file -S Log size -p PID file -h Add hostname to the message -P Prefix custom text to streamed messages -z handle only messages with given facility (0-23), repeatable -Z ignore messages with given facility (0-23), repeatable -f Follow log messages -u Use UDP as the protocol -t Add an extra timestamp -0 Use \0 instead of \n as trailer when using TCP u0fcs:l:z:Z:r:F:p:S:P:h:e:tFailed to connect to ubus w+%dstreamoneshotlineslogFailed to find log object: %s logreadreadmsgidprioritysourcetimeD@ L@PX@H`@h@Xl@t@0x@@@8@ @(@@@@@@@@@@@@@@ @@@ @(@0@8@@@H@@@@@@@<??'#%x '@<$? $?%@/dev/null else cat /usr/lib/opkg/status fi ;; list-available) if [ $ipkg_bin = "apk" ]; then $ipkg_bin query --fields all --format json --available \* 2>/dev/null else lists_dir=$(sed -rne 's#^lists_dir \S+ (\S+)#\1#p' /etc/opkg.conf /etc/opkg/*.conf 2>/dev/null | tail -n 1) find "${lists_dir:-/usr/lib/opkg/lists}" -type f '!' -name '*.sig' | xargs -r gzip -cd fi ;; install|update|upgrade|remove) ( cmd="$ipkg_bin" # The apk package manager uses distinct commands for installing and removing packages. if [ $ipkg_bin = "apk" ]; then case "$action" in install) action="add" ;; remove) action="del" ;; esac fi # APK have --autoremove enabled by default and # --force-removal-of-dependent-packages as -r option if [ $ipkg_bin = "apk" ]; then while [ -n "$1" ]; do case "$1" in --autoremove) # Just shift and do nothing. # 'apk del' already cleans up orphaned dependencies by default. shift ;; --force-removal-of-dependent-packages) cmd="$cmd -r" shift ;; --force-overwrite) cmd="$cmd $1" shift ;; -*) shift ;; *) break ;; esac done else while [ -n "$1" ]; do case "$1" in --autoremove|--force-overwrite|--force-removal-of-dependent-packages) cmd="$cmd $1" shift ;; -*) shift ;; *) break ;; esac done fi if flock -x 200; then pkmcmd="$cmd $action $@" $cmd $action "$@" /tmp/ipkg.out 2>/tmp/ipkg.err code=$? stdout=$(cat /tmp/ipkg.out) stderr=$(cat /tmp/ipkg.err) else code=255 stderr="Failed to acquire lock" fi json_init json_add_int code $code [ -n "$pkmcmd" ] && json_add_string pkmcmd "$pkmcmd" [ -n "$stdout" ] && json_add_string stdout "$stdout" [ -n "$stderr" ] && json_add_string stderr "$stderr" json_dump ) 200>/tmp/ipkg.lock rm -f /tmp/ipkg.lock /tmp/ipkg.err /tmp/ipkg.out ;; *) echo "Usage: $0 {list-installed|list-available|update}" >&2 echo " $0 {install|upgrade|remove} pkg[ pkg...]" >&2 exit 1 ;; esac 07070101AE224A000081ED0000000000000000000000016A426C2800000122000000FE0000000000000000000000000000001500000000usr/libexec/login.sh#!/bin/sh [ -t 0 ] && { tty_dev=$(readlink /proc/self/fd/0) case "$tty_dev" in /dev/console|/dev/tty[0-9]*) export TERM=${TERM:-linux} ;; /dev/*) export TERM=vt102 ;; esac } [ "$(uci -q get system.@system[0].ttylogin)" = 1 ] || exec /bin/login -f root exec /bin/login 07070101AE224B000081ED0000000000000000000000016A426C280000066F000000FE0000000000000000000000000000002400000000usr/libexec/validate_firmware_image#!/bin/sh . /lib/functions.sh . /lib/functions/system.sh . /usr/share/libubox/jshn.sh include /lib/upgrade VALID=1 FORCEABLE=1 ALLOW_BACKUP=1 # Mark image as invalid but still possible to install notify_firmware_invalid() { VALID=0 } # Mark image as broken (impossible to install) notify_firmware_broken() { VALID=0 FORCEABLE=0 } # Mark image as incompatible with preserving a backup notify_firmware_no_backup() { ALLOW_BACKUP=0 } # Add result of validation test notify_firmware_test_result() { local old_ns json_set_namespace validate_firmware_image old_ns json_add_boolean "$1" "$2" json_set_namespace $old_ns } err_to_bool() { [ "$1" -ne 0 ] && echo 0 || echo 1 } fwtool_check_signature "$1" >&2 FWTOOL_SIGNATURE=$? [ "$FWTOOL_SIGNATURE" -ne 0 ] && notify_firmware_invalid fwtool_check_image "$1" >&2 FWTOOL_DEVICE_MATCH=$? [ "$FWTOOL_DEVICE_MATCH" -ne 0 ] && notify_firmware_invalid json_set_namespace validate_firmware_image old_ns json_init json_add_object "tests" json_add_boolean fwtool_signature "$(err_to_bool $FWTOOL_SIGNATURE)" json_add_boolean fwtool_device_match "$(err_to_bool $FWTOOL_DEVICE_MATCH)" # Call platform_check_image() here so it can add its test # results and still mark image properly. json_set_namespace $old_ns platform_check_image "$1" >&2 case "$?" in 0) ;; 74) notify_firmware_broken ;; *) notify_firmware_invalid ;; esac json_set_namespace validate_firmware_image old_ns json_close_object json_add_boolean valid "$VALID" json_add_boolean forceable "$FORCEABLE" json_add_boolean allow_backup "$ALLOW_BACKUP" json_dump -i json_set_namespace $old_ns 07070101AE244A000081ED0000000000000000000000016A426C280000010B000000FE0000000000000000000000000000001B00000000usr/libexec/syslog-wrapper#!/bin/sh . /lib/functions.sh main() { local log_file log_file="$(uci_get system @system[0] log_file "")" if [ -f "$log_file" ]; then cat "$log_file" return fi if [ -f /sbin/logread ]; then /sbin/logread -e ^ else /usr/sbin/logread -e ^ fi } main 07070101AE21A3000041ED0000000000000000000000026A426C2800000000000000FE0000000000000000000000000000001400000000usr/libexec/network07070101AE21A4000081ED0000000000000000000000016A426C280000175C000000FE0000000000000000000000000000002700000000usr/libexec/network/packet-steering.uc#!/usr/bin/env ucode 'use strict'; import { glob, basename, dirname, readlink, readfile, realpath, writefile, error, open } from "fs"; let napi_weight = 1.0; let cpu_thread_weight = 0.75; let rx_weight = 0.75; let eth_bias = 2.0; let debug = 0, do_nothing = 0; let disable; let cpus; let all_cpus; let local_flows = 0; while (length(ARGV) > 0) { let arg = shift(ARGV); switch (arg) { case "-d": debug++; break; case "-n": do_nothing++; break; case '0': disable = true; break; case '2': all_cpus = true; break; case '-l': local_flows = +shift(ARGV); break; } } function task_name(pid) { let stat = open(`/proc/${pid}/status`, "r"); if (!stat) return; let line = stat.read("line"); stat.close(); return trim(split(line, "\t", 2)[1]); } function set_task_cpu(pid, cpu) { if (disable) cpu = join(",", map(cpus, (cpu) => cpu.id)); let name = task_name(pid); if (!name) return; if (debug || do_nothing) warn(`taskset -p -c ${cpu} ${name}\n`); if (!do_nothing) system(`taskset -p -c ${cpu} ${pid}`); } function cpu_mask(cpu) { let mask; if (cpu < 0) mask = (1 << length(cpus)) - 1; else mask = (1 << int(cpu)); return sprintf("%x", mask); } function set_netdev_cpu(dev, cpu, rx_queue) { rx_queue ??= "rx-*"; let queues = glob(`/sys/class/net/${dev}/queues/${rx_queue}/rps_cpus`); let val = cpu_mask(cpu); if (disable) val = 0; for (let queue in queues) { if (debug || do_nothing) warn(`echo ${val} > ${queue}\n`); if (!do_nothing) writefile(queue, `${val}`); } queues = glob(`/sys/class/net/${dev}/queues/${rx_queue}/rps_flow_cnt`); for (let queue in queues) { if (debug || do_nothing) warn(`echo ${local_flows} > ${queue}\n`); if (!do_nothing) writefile(queue, `${local_flows}`); } } function task_device_match(name, device) { let napi_match = match(name, /napi\/([^-]*)-\d+/); if (!napi_match) napi_match = match(name, /mt76-tx (phy\d+)/); if (napi_match && (index(device.phy, napi_match[1]) >= 0 || index(device.netdev, napi_match[1]) >= 0)) return true; if (device.driver == "mtk_soc_eth" && match(name, /napi\/mtk_eth-/)) return true; return false; } cpus = map(glob("/sys/bus/cpu/devices/*"), (path) => { return { id: int(match(path, /.*cpu(\d+)/)[1]), core: int(trim(readfile(`${path}/topology/core_id`))), load: 0.0, }; }); cpus = slice(cpus, 0, 64); if (length(cpus) < 2) exit(0); function cpu_add_weight(cpu_id, weight) { let cpu = cpus[cpu_id]; cpu.load += weight; for (let sibling in cpus) { if (sibling == cpu || sibling.core != cpu.core) continue; sibling.load += weight * cpu_thread_weight; } } function get_next_cpu(weight, prev_cpu) { if (disable) return 0; let sort_cpus = sort(slice(cpus), (a, b) => a.load - b.load); let idx = 0; if (prev_cpu != null && sort_cpus[idx].id == prev_cpu) idx++; let cpu = sort_cpus[idx].id; cpu_add_weight(cpu, weight); return cpu; } let phys_devs = {}; let netdev_phys = {}; let netdevs = map(glob("/sys/class/net/*"), (dev) => basename(dev)); for (let dev in netdevs) { let pdev_path = realpath(`/sys/class/net/${dev}/device`); if (!pdev_path) continue; if (length(glob(`/sys/class/net/${dev}/lower_*`)) > 0) continue; let pdev = phys_devs[pdev_path]; if (!pdev) { pdev = phys_devs[pdev_path] = { path: pdev_path, driver: basename(readlink(`${pdev_path}/driver`)), netdev: [], phy: [], tasks: [], rx_tasks: [], rx_queues: map(glob(`/sys/class/net/${dev}/queues/rx-*/rps_cpus`), (v) => basename(dirname(v))), }; } let phyidx = trim(readfile(`/sys/class/net/${dev}/phy80211/index`)); if (phyidx != null) { let phy = `phy${phyidx}`; if (index(pdev.phy, phy) < 0) push(pdev.phy, phy); } push(pdev.netdev, dev); netdev_phys[dev] = pdev; } for (let path in glob("/proc/*/exe")) { readlink(path); if (error() != "No such file or directory") continue; let pid = basename(dirname(path)); let name = task_name(pid); for (let devname in phys_devs) { let dev = phys_devs[devname]; if (!task_device_match(name, dev)) continue; push(dev.tasks, pid); let napi_match = match(name, /napi\/([^-]*)-(\d+)/); if (napi_match && napi_match[2] > 0) push(dev.rx_tasks, pid); break; } } function assign_dev_queues_cpu(dev) { let num = length(dev.rx_queues); if (num < length(dev.rx_tasks)) num = length(dev.rx_tasks); for (let i = 0; i < num; i++) { let cpu; let task = dev.rx_tasks[i]; if (num >= length(cpus)) cpu = i % length(cpus); else if (task) cpu = get_next_cpu(napi_weight); else cpu = -1; set_task_cpu(task, cpu); let rxq = dev.rx_queues[i]; if (!rxq) continue; if (num >= length(cpus)) cpu = (i + 1) % length(cpus); else if (all_cpus) cpu = -1; else cpu = get_next_cpu(napi_weight, cpu); for (let netdev in dev.netdev) set_netdev_cpu(netdev, cpu, rxq); } } function assign_dev_cpu(dev) { if (length(dev.rx_queues) > 1 && length(dev.rx_tasks) > 1) return assign_dev_queues_cpu(dev); if (length(dev.tasks) > 0) { let cpu = dev.napi_cpu = get_next_cpu(napi_weight); for (let task in dev.tasks) set_task_cpu(task, cpu); } if (length(dev.netdev) > 0) { let cpu; if (all_cpus) cpu = -1; else cpu = get_next_cpu(rx_weight, dev.napi_cpu); for (let netdev in dev.netdev) set_netdev_cpu(netdev, cpu); } } // Assign ethernet devices first for (let devname in phys_devs) { let dev = phys_devs[devname]; if (!length(dev.phy)) assign_dev_cpu(dev); } // Add bias to avoid assigning other tasks to CPUs with ethernet NAPI for (let devname in phys_devs) { let dev = phys_devs[devname]; if (!length(dev.tasks) || dev.napi_cpu == null) continue; cpu_add_weight(dev.napi_cpu, eth_bias); } // Assign WLAN devices for (let devname in phys_devs) { let dev = phys_devs[devname]; if (length(dev.phy) > 0) assign_dev_cpu(dev); } if (debug > 1) warn(sprintf("devices: %.J\ncpus: %.J\n", phys_devs, cpus)); 07070101AE2437000081ED0000000000000000000000016A426C2800000555000000FE0000000000000000000000000000001A00000000usr/libexec/luci-peeraddr#!/bin/sh NL=" " function ifaces_by_device() { ubus call network.interface dump 2>/dev/null | \ jsonfilter -e "@.interface[@.device='$1' || @.l3_device='$1'].interface" } function device_by_addr() { set -- $(ip route get "$1" ${2:+from "$2"} 2>/dev/null) echo "$5" } for inbound_device in $(device_by_addr "$REMOTE_ADDR" "$SERVER_ADDR"); do inbound_devices="$inbound_device" inbound_interfaces="" for iface in $(ifaces_by_device "$inbound_device"); do inbound_interfaces="${inbound_interfaces:+$inbound_interfaces$NL}$iface" for peeraddr in $(uci get "network.$iface.peeraddr"); do for ipaddr in $(resolveip -t 1 "$peeraddr" 2>/dev/null); do for peerdev in $(device_by_addr "$ipaddr"); do for iface in $(ifaces_by_device "$peerdev"); do inbound_devices="${inbound_devices:+$inbound_devices$NL}$peerdev" inbound_interfaces="${inbound_interfaces:+$inbound_interfaces$NL}$iface" done done done done done done inbound_devices="$(echo "$inbound_devices" | sort -u | sed ':a;N;$!ba;s/\n/", "/g')" inbound_interfaces="$(echo "$inbound_interfaces" | sort -u | sed ':a;N;$!ba;s/\n/", "/g')" cat <N@N@\@@``QtdRtd>N@N@/lib/ld-musl-mipsel-sf.so.1 0@cw @ '@N@N@ @ @L@  p0P@5pM@P@ @ppp@ ppFp)pF @2pN@oo @ooX @CF#$C%5 ?-764 <8D/3@;'"20 .!B1A >,E ( &)+*:=9PX^N@ePP@"@/@" nty~$@ 28P/@"F}0P@ voD'@(4<E^LW^PJ__RLD_MAPuloop_doneblob_buf_initblobmsg_parseblobmsg_add_field_finiclosestrchrstrlen__errno_locationstrcmpmemsetunlinkstrncmpreadcallocpipe__stack_chk_failmallocmemcpygetenv__stack_chk_guardsnprintfwaitpidstrcpyubus_freeubus_lookup_idubus_connectubus_invoke_fd__register_frame_info__deregister_frame_infoputcharioctlstdoutstrerrorexeclputsdup2tolower__localtime64strtoulsplicefflushlseekstrncasecmpchmodisxdigitstrtolsendfilestrcatchdir__stat_time64strstrstrncpyforkexecvlinkatisalnum__time64gethostnamesprintfstrftimefwrite__libc_start_mainopenlibubox.so.20260213libubus.so.20251202libgcc_s.so.1libc.soGLIBC_2.0ii N@~PP@~ O@O@O@ O@O@O@O@O@ O@ $O@ (O@ ,O@0O@4O@8O@O@?O@@O@AO@BO@CO@DO@E' '@0d @@ gp ["eg [`n "< e p gg"ep g"@nmKGHI Jm ,mlFeh  e e"P g " el e"gJ#"'! e l gm G?m K7"`@m KJAZ.a e@ m l l   h eR` e     g  e eG K , jjon( mR`J* e@r`n g Zp g "(n  m ,mlFej h  9ҷӵe"((*"`1s'aAZXg #,۶ H ! g*״ g*ֶmlH ! g*Ѵ g*϶je" #Hg) g *  gg @ g gQ Lg *  elv  ggd ggg J`JI+ Jl *$jlr<` eg*%g@:r`!* Z`X`| g  ┴l *$jlr&`A@I* mllð * z * mlFh{P g"  e[s e"gJ>"K! ^ e-pp e%n em eV, jjon( mR`J* e@r`n g      e5!S mRg,am g *m gg e m " m  "h eR `  e ll R`  e1h lPg0pdePP@`,@l,@|,@,@,@*@,@)@,@-@ -@,@,@,@-@,@,@'@(-@L-@N@-@.@-@-@-@0+@D+@d+@l+@-@*@-@@,@P@-@,.@-@*@+@+@,@ .@.@%X@@@#% !(!<$$ ''@<$$'B$@<@<$  A$$(''@<`P @@

@,;:[]?.=%-Invalid characters in filename .;=/-Invalid characters in mimetypeFailed to open requested pathContent-Type: %s Content-Disposition: attachment; filename="%s" Content-Length: %llu sessionidpathfilenamemimetype/bin:/usr/bin:/sbin:/usr/sbincgi-uploadcgi-downloadcgi-backupBackup permission deniedFailed to spawn pipeFailed to fork process/Failed chdir('/')---create-backup/sbin/sysupgrade%Y-%m-%dOpenWrtContent-Type: application/x-targz Content-Disposition: attachment; filename="backup-%s-%s.tar.gz" cgi-execExec permission deniedInvalid command parameterOut of memoryPATH/%sAccess to command denied by ACL/dev/nullFailed execv(...)Executable not foundcommandstderr(bug)filemodefiledataapplication/x-www-form-urlencodedCONTENT_LENGTH,@ ,@(,@4,@,@D.@(,@4,@L.@'@@ // SPDX-License-Identifier: GPL-2.0-only // vim: set noexpandtab softtabstop=8 shiftwidth=8 syntax=javascript: //------------------------------------------------------------------------------ let NAME = "owut"; let VERSION = "2026.04.09~5d6760b5-r1"; let PROG = `${NAME}/${VERSION}`; import * as uloop from "uloop"; import * as uclient from "uclient"; import * as fs from "fs"; import * as mod_ubus from "ubus"; import * as ap from "utils.argparse"; import { cursor } from "uci"; let uci = cursor(); const default_sysupgrade = "https://sysupgrade.openwrt.org"; const default_upstream = "https://downloads.openwrt.org"; const issue_url = "https://github.com/efahl/owut/issues"; const forum_url = "https://forum.openwrt.org/t/owut-openwrt-upgrade-tool/200035"; const wiki_url = "https://openwrt.org/docs/guide-user/installation/sysupgrade.owut"; //------------------------------------------------------------------------------ const EXIT_OK = 0, EXIT_ERR = 1; const Logger = { _levels: [], _level: 0, set_level: function(lvl) { this._level = lvl; }, show: function(lvl) { return this._level >= lvl; }, push: function(new) { push(this._levels, this._level); this._level = new; }, pop: function() { this._level = pop(this._levels); }, stdout_is_pipe: ! fs.stdout.isatty(), GREEN: "0;255;0", YELLOW: "255;234;0", RED: "255;0;0", reset: "reset", clreol: function() { // Clear to end-of-line when appropriate. return this.stdout_is_pipe ? "" : "\033[K"; }, color: function(color_name) { // Suppress colorization when stdout is a pipe. if (this.stdout_is_pipe) return ""; return color_name == this.reset ? "\033[m" : `\033[38;2;${color_name}m`; }, colorize: function(color_name, text) { if (this.stdout_is_pipe) return text; return this.color(color_name) + text + this.color(this.reset); }, _n_lines: 0, mark: function() { this._n_lines = 0; }, backup: function() { // Reposition cursor up n lines and reset line counter. if (! this.stdout_is_pipe && this._n_lines > 0) { printf("\033[%dA\r", this._n_lines); fs.stdout.flush(); } this.mark(); }, _fmt: function(fmt, ...args) { let s = sprintf(fmt, ...args); this._n_lines += length(match(s, /\n/g)); return this.clreol() + s; }, _out: function(prefix, clr, fmt, ...args) { warn(sprintf("%s: ", this.colorize(clr, prefix)), this._fmt(fmt, ...args)); }, err: function(fmt, ...args) { this._out("ERROR", this.RED, fmt, ...args); }, wrn: function(fmt, ...args) { this._out("WARNING", this.YELLOW, fmt, ...args); }, log: function(level, fmt, ...args) { if (this.show(level)) { print(this._fmt(fmt, ...args)); fs.stdout.flush(); } }, die: function(fmt, ...args) { this.err(fmt, ...args); exit(EXIT_ERR); }, bug: function(fmt, ...args) { // Variant for errors indicating code issue, not a user error. this.err(fmt, ...args); assert(false, `This is a bug in '${PROG}', please report at\n` ` ${issue_url}\n`); }, }; let L = Logger; //------------------------------------------------------------------------------ let commands = { check: { help: "Collect all resources and report stats." }, list: { help: "Show all the packages installed by user." }, blob: { help: "Display the json blob for the ASU build request." }, download: { help: "Build, download and verify an image." }, verify: { help: "Verify the downloaded image." }, install: { help: "Install the specified local image." }, upgrade: { help: "Build, download, verify and install an image." }, versions: { help: "Show available versions." }, dump: { help: "Collect all resources and dump internal data structures." }, }; let _fstypes = ["squashfs", "ext4", "ubifs", "jffs2"]; let _fslo = 1; // See https://sysupgrade.openwrt.org/redoc#operation/api_v1_build_post_api_v1_build_post let _list_fmts = ["fs-user", "fs-all", "config"]; function parse_rev_code(version_code) { return match(version_code, /^r(\d+)-([[:xdigit:]]+)$/i); } // Add a custom validator for the '--rev-code' option value. ap.ArgActions["rc"] = function(self, params) { let rc = params.value; if (rc && rc != "none" && ! parse_rev_code(rc)) { this.usage_short(self, { exit: 1, prefix: `ERROR: invalid version code format '${params.value}'` }); } this.store(self, params); }; let arg_defs = proto([ ap.DEFAULT_HELP, ap.DEFAULT_VERSION, { name: "command", position: 0, one_of: commands, action: "store", help: "Sub-command to execute" }, { name: "version_to", short: "-V", long: "--version-to", action: "store", nargs: 1, default: null, help: "Specify the target version, defaults to installed version." }, { name: "rev_code", short: "-R", long: "--rev-code", action: "rc", nargs: 1, default: null, help: "Specify a 'version_code', literal 'none' allowed, defaults to latest build." }, { name: "verbosity", short: "-v", long: "--verbose", action: "inc", default: 0, help: "Print various diagnostics. Repeat for even more output." }, { name: "verbosity", short: "-q", long: "--quiet", action: "dec", default: 0, help: "Reduce verbosity. Repeat for total silence."}, { name: "keep", short: "-k", long: "--keep", action: "set", default: false, help: "Save all downloaded working files." }, { name: "force", long: "--force", action: "set", default: false, help: "Force a build even when there are downgrades or no changes." }, { name: "add", short: "-a", long: "--add", action: "storex", nargs: 1, help: "New packages to add to build list." }, { name: "remove", short: "-r", long: "--remove", action: "storex", nargs: 1, help: "Installed packages to remove from build list." }, { name: "clean_slate", long: "--clean-slate", action: "set", default: false, help: "Remove all but default packages (READ THE DOCS)." }, { name: "ignored_defaults", long: "--ignored-defaults", action: "storex", nargs: 1, help: "List of explicitly ignored default package names." }, { name: "ignored_changes", long: "--ignored-changes", action: "storex", nargs: 1, help: "List of explicitly ignored package changes." }, { name: "init_script", short: "-I", long: "--init-script", action: "store", nargs: 1, default: null, help: "Path to uci-defaults script to run on first boot ('-' use stdin)." }, { name: "fstype", short: "-F", long: "--fstype", action: "enum", nargs: 1, default: null, one_of: _fstypes, help: `Desired root file system type (${join(", ", _fstypes)}).` }, { name: "rootfs_size", short: "-S", long: "--rootfs-size", action: "store_int", nargs: 1, default: null, lower: _fslo, help: `DANGER: See wiki before using! Root file system size in MB (${_fslo}-[server-dependent]).` }, { name: "image", short: "-i", long: "--image", action: "file", nargs: 1, default: "/tmp/firmware.bin", help: "Image name for download, verify, install and upgrade." }, { name: "format", short: "-f", long: "--format", action: "enum", nargs: 1, default: null, one_of: _list_fmts, help: `Format for 'list' output (${join(", ", _list_fmts)}).` }, { name: "pre_install", short: "-p", long: "--pre-install", action: "store", nargs: 1, default: null, help: "Script to exec just prior to launching final sysupgrade." }, { name: "poll_interval", short: "-T", long: "--poll-interval", action: "store_int", nargs: 1, default: 2000, help: "Poll interval for build monitor, in milliseconds." }, { name: "progress_size", long: "--progress-size", action: "store_int", nargs: 1, default: 0, help: "Response content-length above which we report download progress." }, { name: "device", long: "--device", action: "store", nargs: 1, default: null }, // Undocumented: For testing foreign devices. ], ap.ArgParser); arg_defs.set_prog_info(`owut - OpenWrt Upgrade Tool ${VERSION} (${sourcepath()})`); arg_defs.set_bookends( "\nowut is an upgrade tool for OpenWrt.\n", `\nFull documentation\n` ` ${wiki_url}\n\n` `Questions and discussion\n` ` ${forum_url}\n\n` `Issues and bug reports\n` ` ${issue_url}\n\n` ); let options = arg_defs.parse(null, {attendedsysupgrade: "owut"}); L.set_level(options.verbosity); //------------------------------------------------------------------------------ let url; // See initialize_urls let build; // See collect_all for next three let device; let release; let server_limits; // Temporary and resource files. // We save them all with reasonably recognizable names to aid in debugging. let tmp_root = "/tmp/owut-"; let img_root = match(options.image, /(.*\/|)[^\.]*/)[0]; let tmp = { overview_json: `${tmp_root}overview.json`, pkg_arch_json: `${tmp_root}packages-arch.json`, pkg_platform_json: `${tmp_root}packages-plat.json`, platform_json: `${tmp_root}platform.json`, failed_html: `${tmp_root}failures`, req_json: `${tmp_root}build-request.json`, // The POST body we send. build_json: `${tmp_root}build-response.json`, // First response. build_status_json: `${tmp_root}build-status.json`, // Overwritten subsequent responses. rsp_header: `${tmp_root}rsp-header.txt`, firmware_sums: `${img_root}.sha256sums`, // Expected sha256sums from downloaded firmware. firmware_man: `${img_root}-manifest.json`, // Manifest of successful build. }; let packageDB = {}; // Dictionary of installed packages and much status. let pkg_name_len = 0; let packages = { // Dictionary of package lists. // Remove selected packages per // https://github.com/openwrt/openwrt/commit/451e2ce0 // https://github.com/openwrt/openwrt/commit/999ef827 non_upgradable: [ "kernel", "libgcc", "libc"], // Collected from this device. installed: {}, // All the name:version pairs. top_level: [], // Simple list of names. // Collected from upgrade servers based on to-version. default: [], // Another simple name list. available: {}, // The name:version pairs that are available for installation. changes: {}, // Changes extracted from overview; structure documented in apply_pkg_mods. // Logging of modifications replaced: {}, // Log of replacements and removals due to 'package_changes'. }; //------------------------------------------------------------------------------ const ubus = { init: function() { this._bus = mod_ubus.connect(); this.check(this._bus, "mod_ubus.connect"); }, term: function() { this._bus.disconnect(); }, check: function(result, fmt, ...args) { if (!result || mod_ubus.error()) L.bug("ubus: %s\n"+fmt+"\n", mod_ubus.error(), ...args); }, call: function(obj, func, args) { let result = this._bus.call(obj, func, args); this.check(result, " from: 'ubus call %s %s %s'", obj, func, args ?? ""); return result; }, raw_run: function(command, ...params) { // Dangerous: no error checking. return this._bus.call("file", "exec", { command, params }); }, run: function(command, ...params) { return this.call("file", "exec", { command, params }); }, }; //------------------------------------------------------------------------------ let sha256 = { cmd: [ "/bin/busybox", "sha256sum" ], save: function(file, sum) { // Create the checksum file from the image name and expected sum. let sums = fs.open(tmp.firmware_sums, "w"); if (sums) { sums.write(sprintf("%s %s\n", sum, file)); sums.close(); } }, saved_sum: function(file) { // Our saved sums is always just a single line let sums = fs.open(tmp.firmware_sums, "r"); if (sums) { let line = split(trim(sums.read("line")), /\s+/); sums.close(); if (line[1] == file) return line[0]; L.err("Invalid image: got '%s', but expected '%s' in sum file\n", line[1], file); } return null; }, sum: function(file) { // Return the checksum for the specified file. let data = ubus.run(...this.cmd, file); if (data?.code == 0) return substr(data.stdout, 0, 64); this._fatal("sum", data); }, verify: function() { // Run validation against the saved checksums. let data = ubus.run(...this.cmd, "-c", tmp.firmware_sums); if (! data) this._fatal("verify", data); return data; }, _fatal: function(where, data) { L.bug("Fatal error in sha256.%s:\n%.2J\n", where, data); }, }; //------------------------------------------------------------------------------ function sysupgrade(file, check, options) { // When sysupgrade performs the upgrade, it returns with shell status // of '10', so uc_ubus_call raises an error. '--test' is fine, it // returns proper status. return check ? ubus.run("sysupgrade", ...options, file) : ubus.raw_run("sysupgrade", ...(options ?? []), file); } //------------------------------------------------------------------------------ let dl_stats = { count: 0, // Number of files downloaded. time: 0, // Sum of wall time taken. bytes: 0, // Only includes content, not http headers. Mbits: (bytes) => (bytes * 8.0 / (1024*1024)), log: function(url, file, bytes, time) { this.bytes += bytes; this.time += time; this.count++; let Mbits = this.Mbits(bytes); L.log(3, "Downloaded %s to %s (%dB at %.3f Mbps)\n", url, file, bytes, Mbits/time); }, report: function() { if (this.count > 0) { let Mbps = this.Mbits(this.bytes) / this.time; L.log(3, "Downloaded %d files, %d bytes at %.3f Mbps\n", this.count, this.bytes, Mbps); } }, }; function _get_ca_files() { const cert_path = "/etc/ssl/certs"; try { return fs.glob(`${cert_path}/*.crt`); } catch (error) { L.wrn("Could not access SSL certificates: %s\n", error); return []; } } //------------------------------------------------------------------------------ function getenv_ic(envar) { return getenv(envar) || getenv(uc(envar)); } const url_parts = regexp("^([^:]+)://([^/]+)/?(.*)", "i"); function url_parse(url) { let parts = match(url, url_parts); return ! parts ? null : { scheme: parts[1], host: parts[2], // Includes any port spec. path: parts[3], }; } function get_proxy_url(url) { let parts = url_parse(url); let no_proxy = split(getenv_ic("no_proxy"), ","); if (no_proxy && parts.host in no_proxy) return null; return getenv_ic(`${parts.scheme}_proxy`); } //------------------------------------------------------------------------------ let _uc_uc = null; let _uc_cb = null; function _get_uclient(url, dst_file) { if (! _uc_uc) { _uc_cb = { url: "", // For error messages. dst_file: "", // Where to put result. output: null, // Handle for dst_file. rsp_headers: null, _disconnect: (cb) => { if (cb.output) { cb.output.close(); cb.output = null; } this.disconnect(); uloop.end(); }, header_done: (cb) => { cb.output = fs.open(cb.dst_file, "w"); if (! cb.output) { L.err("opening %s: %s\n", cb.dst_file, fs.error()); cb._disconnect(cb); } cb.rsp_headers = this.get_headers(); cb.rsp_headers.status = this.status().status; cb.rsp_headers.content_length = int(cb.rsp_headers["content-length"] || 0); cb.rsp_headers.content_read = 0; if (! this.redirect(cb)) { L.log(1, "Redirected to %s...\n", cb.rsp_headers.location); } }, data_read: (cb) => { // uc.read returns null on eof. let n_read = 0; while ((n_read = cb.output.write(this.read() ?? "")) > 0) { cb.rsp_headers.content_read += n_read; if (options.progress_size && cb.rsp_headers.content_length > options.progress_size) { let pct_read = 100.0 * cb.rsp_headers.content_read / cb.rsp_headers.content_length; L.log(0, "Download progress: %5.1f%% %8d/%d bytes" + (L.stdout_is_pipe ? "\n" : "\r"), pct_read, cb.rsp_headers.content_read, cb.rsp_headers.content_length); } } }, data_eof: (cb) => { cb._disconnect(cb); }, error: (cb, code) => { L.err("uclient error code=%s\n This could be due to the server being down or inaccessible, check\n %s\n", code, cb.url); cb._disconnect(cb); }, }; _uc_uc = uclient.new(url, null, _uc_cb); if (! _uc_uc.ssl_init({ca_files: _get_ca_files()})) { L.die("owut uses ucode-mod-uclient, which requires an SSL library to function:\n" + " Please install one of the libustream-*[ssl|tls] packages as well as\n" + " one of the ca-bundle or ca-certificates packages.\n"); } } let proxy_url = get_proxy_url(url); if (! proxy_url) _uc_uc.set_url(url); else { L.log(2, "Using proxy_url '%s'\n", proxy_url); _uc_uc.set_url(proxy_url); _uc_uc.set_proxy_url(url); } _uc_cb.url = url; _uc_cb.dst_file = dst_file; return _uc_uc; } function _del_uclient() { _uc_uc?.free(); _uc_uc = null; _uc_cb = null; gc(); } function _request(url, dst_file, params) { // uclient function for simple http requests // url = self explanatory // dst_file = result of request // params = dictionary of optional parameters: // 'type' = 'GET' (default), 'HEAD' or 'POST' // 'json_data' = json data, forces 'POST' implicitly let json_data = params?.json_data; let type = params?.type ?? "GET"; if (! (type in ["GET", "HEAD", "POST"])) { L.bug("Invalid request type '%s'\n", type); } let start = time(); let uc = _get_uclient(url, dst_file); if (! uc.connect()) { L.err("Failed to connect\n"); return null; } let headers = { "User-Agent": PROG, }; let args = { headers: headers, }; if (json_data) { type = "POST"; headers["Content-Type"] = "application/json"; args["post_data"] = json_data; } if (! uc.request(type, args)) { L.err("Failed to send request\n"); return null; } uloop.run(); if (_uc_cb.rsp_headers) { let elapsed = (time() - start) || 0.5; let bytes = fs.stat(dst_file).size; dl_stats.log(url, dst_file, bytes, elapsed); L.log(4, "Response headers = %.2J\n", _uc_cb.rsp_headers); if (options.keep) { let hdrs = fs.open(tmp.rsp_header, "w"); hdrs.write(sprintf("%.J\n", _uc_cb.rsp_headers)); hdrs.close(); } } return { ...uc.status(), type: type, headers: _uc_cb.rsp_headers }; } function read_tmp_file(file) { // Reads 'file', then optionally deletes it. // Return raw text. let fd = fs.open(file, "r"); let tx = fd.read("all"); fd.close(); if (! options.keep) { fs.unlink(file); } return tx; } function read_tmp_json(file) { // Read 'file' into a json object, then optionally delete the file. // Primarily used to parse downloads from /tmp. let txt = trim(read_tmp_file(file)); try { return json(txt); } catch (error) { L.err("Expected json, but '%s'\n", error); return txt; } } //------------------------------------------------------------------------------ //-- Source-specific downloaders ----------------------------------------------- function dl_json(url, json_file, keep_going) { let rsp = _request(url, json_file); if (rsp?.status == 200) { return read_tmp_json(json_file); } L.err("Response status %s while downloading\n %s\n", rsp?.status, url); return keep_going ? null : exit(EXIT_ERR); } function dl_platform() { // Get the starting point for the target build. return dl_json(url.platform, tmp.platform_json, true); } function dl_overview() { // Overview is the collection of information about the branches and their releases. // // Note that auc uses branches.json instead. Its content is all included // in overview.json at '$.branches', but we like overview as it has a few // more useful items. It can be found at: // url.api_root/branches.json return dl_json(url.overview, tmp.overview_json); } function dl_failures(feed) { // The build failures info is html that resides in odd, one-man-out URL // locations: // https://downloads.openwrt.org/snapshots/faillogs/mipsel_24kc// // https://downloads.openwrt.org/releases/faillogs-23.05/mipsel_24kc// let uri = feed ? `${url.failed}${feed}/` : url.failed; let htm = `${tmp.failed_html}-${feed ? feed : "feeds"}.html`; let rsp = _request(uri, htm); if (rsp?.status == 200) { return read_tmp_file(htm); } return null; // Expected result when no failures found. } function dl_package_versions() { // Download and consolidate the two sources of package versions into // a single object. let arch = dl_json(url.pkg_arch, tmp.pkg_arch_json, true); let plat = dl_json(url.pkg_plat, tmp.pkg_platform_json, true); return sort({ ...(arch ?? []), ...(plat?.packages ?? []) }); } function check_build_response(response, file) { // Check the build responses for errors and substitute appropriate // messages when the request has failed. if (! response) { return { status: -1, detail: "Error: unknown server error", }; } if (! (response.status in [200, 202])) { let txt = trim(read_tmp_file(file)); try { response = json(txt); } catch { response.detail = "Error: " + txt; } return response; } return null; } function dl_build(config) { // Start a build by POSTing the json build configuration. let rsp = _request(url.build, tmp.build_json, {json_data: config}); return check_build_response(rsp, tmp.build_json) || read_tmp_json(tmp.build_json); } let _use_HEAD = true; function dl_build_status() { // The response is considered valid even if status != 200 (usually 202), // as this is the ongoing status query. See switch cases in 'download' // function. let rsp = _use_HEAD && _request(url.build_status, tmp.build_status_json, {type: "HEAD"}); if (rsp?.status == 405) { _use_HEAD = false; } else if (rsp?.status == 202) { // Build a minimal response. let ib_queue = rsp.headers["x-queue-position"]; let ib_status = rsp.headers["x-imagebuilder-status"]; return { status: rsp.status, detail: ib_status ?? "queued", queue_position: ib_queue, imagebuilder_status: ib_status, }; } // Otherwise do a full GET. rsp = _request(url.build_status, tmp.build_status_json); return check_build_response(rsp, tmp.build_status_json) || read_tmp_json(tmp.build_status_json); } //------------------------------------------------------------------------------ function to_int(s) { // Must be an int or there's a bug in caller. if (! match(s, /^[0-9]+$/)) L.bug("Invalid int '%s'\n", s); return int(s); } function ck_int(s) { // If empty, NaN or not fully converted, return null. if (! s) return null; s = ltrim(s, "0") || "0"; let n = int(s); return n == s ? n : null; } const standard = regexp("^([0-9.]+)(~([0-9a-f]+)){0,1}(-r([0-9]+)){0,1}$", "i"); const pre_bits = regexp("^[-a-z.]+", "i"); const ver_bits = regexp("^[0-9.]+", "i"); const ver_splt = regexp("[^a-z0-9]", "i"); const rev_bits = regexp("-[r]{0,1}([0-9]+)$", "i"); const apk_bits = regexp("^_[a-z]+([0-9]+)$", "i"); function version_parse(version) { // Two forms are parsed incorrectly: // 1) Those with all dashes '-', no hash and no rev. The final number // is interpreted as the rev number: // ct-bugcheck: 2016-07-21 // ver=[2016, 7], hsh=null, rev=21 // 2) Those starting with a hash, and the initial digits are decimal: // open-plc-utils: 1ba7d5a0-6 // ver=[1], hsh="ba7d5a0", rev=6 // // #1 is only aesthetic and ends up working fine; #2 was fixed in // the apk version cleanup and only appears in 23.05 and earlier. let ver, hsh, rev, extra; let parts = match(version, standard); if (parts) { // Standard n.n.n~h-rn sequences with optional hash and rev. ver = map(split(parts[1], ver_splt), to_int); hsh = parts[3]; rev = ck_int(parts[5]); } else { // Some odd ones: // luasoap: 2014-08-21-raf1e100281cee4b972df10121e37e51d53367a98 // luci-app-advanced-reboot: 1.0.1-11-1 if (parts = match(version, pre_bits)) { // adb: android.5.0.2_r1-r3 // libinih: r58-r1 // luci-app-dockerman: v0.5.13-20240317-1 // luci-mod-status: git-24.141.29354-5cfe7a7 (23.05) version = substr(version, length(parts[0])); } if (rev = match(version, rev_bits)) { // Extract and strip rev number from version, in case // it's one of those with lots of dashes. version = substr(version, 0, -length(rev[0])); rev = to_int(rev[1]); } if (ver = match(version, ver_bits)) { version = substr(version, length(ver[0])); ver = map(split(rtrim(ver[0], "."), ver_splt), to_int); } if (length(ver) == 1 && index(version, "-") == 0) { // pservice: 2017-08-29-r3 for (let ns in split(substr(version, 1), /[-.]/)) { let n = ck_int(ns); if (n == null) break; push(ver, n); version = substr(version, length(ns)+1); } } if (extra = match(version, apk_bits)) { // For apk underscore-named versions: // openssh-ftp-server 9.9_p1-r3 9.9_p2-r1 push(ver, int(extra[1])); version = null; } // Anything left over must be the "hash" (if we can call it that). hsh = version || null; if (index(hsh, "-") == 0) hsh = substr(hsh, 1); } return { ver, hsh, rev }; } function pkg_ver_cmp(old, new, strict) { if (old == null) return -2; if (new == null) return 2; let v1 = version_parse(old); let v2 = version_parse(new); // Ensure format changes are respected: jansson 2.14-r3 2.14.1-r1 let len = max(length(v1.ver), length(v2.ver)); while (length(v1.ver) < len) push(v1.ver, 0); while (length(v2.ver) < len) push(v2.ver, 0); for (let i, n1 in v1.ver) { let n2 = v2.ver[i]; if (n1 < n2) return -1; if (n1 > n2) return 1; } if (v1.rev < v2.rev) return -1; if (v1.rev > v2.rev) return 1; // Ignore the hashes unless we're being strict if (strict && v1.hsh != v2.hsh) return 99; // 99 means "I don't know" return 0; } function _vmangle(v) { v = replace(v, "-SNAPSHOT", ".999"); v = replace(v, "SNAPSHOT", "999"); v = replace(v, "-rc", "-r"); if (substr(v, -2) == ".0") v += "-r999"; // After the -rcN return v; } function version_cmp(v1, v2) { // Compare two versions and return cmp value based on their relative // ordering. We want to make sure RCs are before any release, and // SNAPSHOTs are after, hence the string mangling. return pkg_ver_cmp(_vmangle(v1), _vmangle(v2)); } function version_older(new_version, base_version) { // Use version_cmp to see if new_version < base_version. Useful to detect // if the user is attempting to downgrade their installation. // // version_older('23.05.2', 'SNAPSHOT') -> true // version_older('23.05-SNAPSHOT', 'SNAPSHOT') -> true // version_older('23.05.0', '23.05.0-rc1') -> false return version_cmp(new_version, base_version) < 0; } function branch_of(version) { // Extract and return the branch for a given version. // SNAPSHOT -> SNAPSHOT // 23.05.0-rc1 -> 23.05 // 23.05.3 -> 23.05 // 23.05-SNAPSHOT -> 23.05 if (version == "SNAPSHOT") return "SNAPSHOT"; let m = match(version, /\d+\.\d+/); return m ? m[0] : ""; } //------------------------------------------------------------------------------ //-- Package management -------------------------------------------------------- function is_installed(pkg) { return pkg in packageDB; } function is_default(pkg) { // Return status if package is in the defaults for this device, i.e., it // will be present as part of the standard install. // Don't attempt to do the following, because we care about things that // may not be installed, e.g., 'dnsmasq' replaced by 'dnsmasq-full'. // return pkg in packageDB && packageDB[pkg].default; return pkg in packages.default; } function is_top_level(pkg) { // We only check in the installed packages. return is_installed(pkg) && packageDB[pkg].top_level; } function is_available(pkg) { // Search for a given package in the combined platform/arch package list. return pkg in packages.available; } //------------------------------------------------------------------------------ const SrcType = { ALL: 0, USER_ONLY: 1, DEFAULT_ONLY: 2, }; function what_provides(pkg) { // Attempt to find the package provider, if it exists. This is a // hacky workaround for https://github.com/efahl/owut/issues/10, see // that issue for current progress towards a proper solution. let result; result = ubus.raw_run("opkg", "whatprovides", pkg); if (result) { let m = match(trim(result.stdout), /What provides.*\n *(.*)/); if (m) return m[-1]; } result = ubus.raw_run("apk", "query", "--installed", "--format", "json", "--match", "provides", pkg); if (result) { let j = json(result.stdout); return length(j) == 1 ? j[0].name : null; } return null; } function top_level(src_type) { // Return only the installed top level packages, i.e., those upon which // no other package depends. 'src_type' specifies how the top-level list // is to be filtered. let tl; switch (src_type) { case SrcType.ALL: tl = is_top_level; break; case SrcType.DEFAULT_ONLY: tl = (pkg) => is_top_level(pkg) && is_default(pkg); break; case SrcType.USER_ONLY: tl = (pkg) => is_top_level(pkg) && ! is_default(pkg); break; } return filter(keys(packageDB), tl); } function with_versions(pkg_list) { let versioned = {}; for (let pkg in pkg_list) { let ver = packages.available[pkg]; if (! ver) { // Hackery because of packages historically missing from the indexes. if (pkg in ["kernel", "libc"]) continue; L.wrn("Package '%s' has no available current version\n", pkg); } versioned[pkg] = ver; } return versioned; } function removed_defaults() { // Return the list of default packages that have been removed. return filter(packages.default, (p) => ! is_installed(p)); } function add_package(pkg, force) { // 'force' is used during package_changes processing to ensure that // the replacement is added, irrespective of availability (e.g., a // broken build for the package being added would otherwise fail). if (is_installed(pkg)) { packageDB[pkg].top_level = true; return true; } if (! force && ! is_available(pkg)) { L.err("Package '%s' is not available on this platform\n", pkg); return false; } packageDB[pkg] = { version: null, new_version: packages.available[pkg], top_level: true, default: is_default(pkg), }; return true; } function remove_package(pkg, silent) { // pkg - the package to remove, if possible. if (! is_installed(pkg)) { if (! silent) L.err("Package '%s' is not installed and cannot be removed\n", pkg); } else { if (! is_top_level(pkg)) { if (! silent) L.wrn("Package '%s' is a dependency, removal will have no effect on the build\n", pkg); } else if (is_default(pkg)) { L.wrn("Package '%s' is a default package, removal may have unknown side effects\n", pkg); } delete packageDB[pkg]; return true; } return false; } function replace_package(old_pkg, new_pkg) { // Do optional replacements. If 'old_pkg' is not installed, then we // have nothing to do but report success. if (is_installed(old_pkg)) { remove_package(old_pkg, true); return add_package(new_pkg, true); } return true; } function clean_slate() { for (let pkg in keys(packageDB)) { if (! is_default(pkg)) { delete packageDB[pkg]; } } for (let pkg in packages.default) { if (is_available(pkg)) { add_package(pkg); } } return true; } //------------------------------------------------------------------------------ function collect_defaults(board, device) { // Use both board json for its defaults, then add the device-specific // defaults to make one big defaults list. let defaults = []; // Must filter out any device-specific removals. for (let pkg in board) { if (! ("-"+pkg in device)) { push(defaults, pkg); } } for (let pkg in device) { if (! match(pkg, /^-/)) { push(defaults, pkg); } } for (let pkg in packages.non_upgradable) { if (! (pkg in defaults)) push(defaults, pkg); } packages.default = sort(defaults); } function parse_package_list(opt) { // Return array and null as-is, parse strings into array of string. // String separators are any of comma, space or newline sequences. // Allows use of either "list" or "option" in config file. if (type(opt) == "string") { opt = split(opt, /[,[:space:]]+/); } return opt; } function apply_pkg_mods() { // 1) Handle 'overview.package_changes'. // 2) Generate any clean-slate request. // 3) Apply user-specified removals. // 4) Apply user-specified additions. // // Package names in changes are already in canonical form. // changes = [ // { // source: "name-from", // Required string - name of package in target version // target: "name-to", // Optional string - if present, name of replaced package in installed version // revision: 123, // Required int - revision at which package change was introduced // mandatory: false, // Optional bool - if true, then force add/remove of target/source, respectively // }, // ... // ]; // // For a case of simple removal, see 'kmod-nft-nat6', which was merged // into 'kmod-nft-nat' in rev 19160. let errors = 0; // TODO think about downgrades, i.e., when to.rev_num < from.rev_num... let ignored = parse_package_list(options.ignored_changes); let rev_num = build.to.rev_num(); for (let chg in packages.changes) { // Upgrades if (chg.source in ignored) { // Allow user to retain old packages on demand, but inform them when changes are skipped. L.log(1, "Ignoring package change %s to %s\n", chg.source, chg.target); continue; } if (chg.revision <= rev_num) { if (chg.target) { if (is_installed(chg.source)) packages.replaced[chg.source] = chg.target; if (! replace_package(chg.source, chg.target)) errors++; } else if (is_installed(chg.source)) { // No target, only source, so remove it. packages.replaced[chg.source] = null; if (! remove_package(chg.source)) errors++; } } } if (options.clean_slate) { clean_slate(); } // Do removals first, so any conflicts are suppressed. for (let pkg in parse_package_list(options.remove)) { if (! pkg) continue; if (! remove_package(pkg)) { errors++; } } for (let pkg in parse_package_list(options.add)) { if (! pkg) continue; if (! add_package(pkg)) { errors++; } } for (let pkg in ignored) { if (! add_package(pkg)) { errors++; } } return errors == 0; } function collect_packages() { // Using data from rpc-sys packagelist, build an object containing all // installed package data. // // packageDB = { // "pkg1": { // version: "version-string", // new_version: "version-string", // top_level: bool, // default: bool, // }, // "pkg2": { // ... // }, // }; let installed = ubus.call("rpc-sys", "packagelist", { all: true }); let top_level = ubus.call("rpc-sys", "packagelist", { all: false }); packages.installed = installed.packages; packages.top_level = sort(keys(top_level.packages)); packages.available = dl_package_versions() ?? {}; // Might be null in ancient versions. for (let pkg, ver in packages.installed) { packageDB[pkg] = { version: ver, new_version: packages.available[pkg], top_level: pkg in packages.top_level, default: is_default(pkg), }; } if (! apply_pkg_mods()) { L.die("Errors collecting package data, terminating.\n"); } } //------------------------------------------------------------------------------ function initialize_urls() { let sysupgrade = rtrim(uci.get_first("attendedsysupgrade", "server", "url"), "/") || default_sysupgrade; let api = sysupgrade + "/api/v1"; let build = api + "/build"; let status = build + "/{hash}"; let static = sysupgrade + "/json/v1"; let store = sysupgrade + "/store"; let overview = static + "/overview.json"; url = { sysupgrade_root: sysupgrade, // sysupgrade server base url api_root: api, // api for builds and other dynamic requests build: build, // build request build_status: status, // build status, same as build appended with hash static_root: static, // json static api root url store_root: store, // api database directory for build results platform: null, // release platform json overview: overview, // Top-level overview.json, contains branch info pkg_arch: null, // Generic arch package list, containing most of the items pkg_plat: null, // Platform packages, built specifically for this platform upstream: null, // upstream build server base url, from overview.json download: null, // upstream with directory at which the "to" build can be found failed: null, // Failure list html }; } function show_versions(check_version_to) { // Using the ASU overview to get all the available versions, scan that // for version-to and report. L.log(0, "Available 'version-to' values from %s:\n", url.sysupgrade_root); let branches = release.branches; let installed = build.from.version; let selected = build.to?.version ?? options.version_to; let found_to = false; for (let branch, details in branches) { L.log(0, " %s %s branch\n", branch, branch == "SNAPSHOT" ? "main" : "release"); for (let version in details.versions) { let suffix = []; if (version == details.latest) push(suffix, "latest"); if (version == installed ) push(suffix, "installed"); if (version == selected ) { push(suffix, "requested"); found_to = true; } suffix = length(suffix) == 0 ? "" : " (" + join(",", suffix) + ")"; L.log(0, " %s%s\n", version, suffix); } } if (! found_to) L.log(0, "\nYour specified version-to '%s' is not available. " + "Pick one from above.\n", selected); else if (check_version_to) L.log(0, "\nYour version-to '%s' appears valid, so either:\n" + " 1) This build has been removed from the server, or\n" + " 2) The ASU server is having issues.\n", selected); } //------------------------------------------------------------------------------ const BuildInfo = { is_snapshot: function() { return this.version == "SNAPSHOT"; }, is_rel_snapshot: function() { return match(this.version, /.*-SNAPSHOT/) != null; }, is_downgrade_from: function(from) { if (version_older(this.version, from.version)) return true; // Same or newer version, so check revision number. return this.rev_num() < from.rev_num(); }, rev_num: function() { // Extracts the revision number from the revision code: // "r23630-842932a63d" -> 23630 let m = parse_rev_code(this.rev_code); return m ? int(m[1]) : 0; }, }; function collect_device_info() { let sysb = ubus.call("system", "board"); let efi_check = null; if (options.device) { // Allow test cases (or "cross" downloads?), using '--device' // option. tegra is one with 'sdcard' sutype, use as follows: // owut ... --device tegra/generic:compulab_trimslice:squashfs let bv = split(options.device, ":"); sysb.release.target = bv[0]; sysb.board_name = bv[1]; sysb.rootfs_type = bv[2] || "squashfs"; efi_check = bv[3] || "no"; // Default to no, if unspecified. } let target = sysb.release.target; let platform = replace(sysb.board_name, /,/, "_"); let ver_from = sysb.release.version; let sutype; // Sysupgrade type: combined, combined-efi, sdcard or sysupgrade (or trx or lxl or ???) // Generic efi targets are: // armsr - EFI-boot only, see https://github.com/efahl/owut/issues/21 // loongarch - EFI-boot only // x86 - EFI- or BIOS-boot let efi_capable = match(target, /^(armsr|loongarch|x86)\//); if (efi_check == null) { efi_check = efi_capable ? "check" : "no"; // one of: force, no, check } // See also, auc.c:1657 'select_image' for changing installed fstype to requested one. // Wait, is there also "factory"??? See asu/build.py abt line 246 if (efi_capable) { // No distinction between "factory" and "sysupgrade" for the generic devices. sutype = "combined"; } else { // Could be that sutype = "sdcard" for some devices, but // assume it is "sysupgrade", which might be wrong. We'll // fix this after we get the profiles for the device, see // 'collect_all'. sutype = "sysupgrade"; } if (efi_check == "force" || (efi_check == "check" && fs.access("/sys/firmware/efi"))) { sutype = `${sutype}-efi`; } device = { arch: null, // "x86_64" or "mipsel_24kc" or "aarch64_cortex-a53", contained in platform_json target: target, // "x86/64" or "ath79/generic" or "mediatek/mt7622", from system board platform: platform, // "generic" (for x86) or "tplink,archer-c7-v4" or "linksys,e8450-ubi" fstype: sysb.rootfs_type, // "ext4" or "squashfs", what is actually present now sutype: sutype, // Sysupgrade type, combined, combined-efi or sysupgrade or sdcard }; build = { from: proto({ version: ver_from, // Full version name currently installed: "SNAPSHOT" or "22.03.1" rev_code: sysb.release.revision, // Kernel version that is currently running kernel: sysb.kernel, // Current build on device }, BuildInfo) }; } function collect_build_info() { let ver_to = options.version_to ? uc(options.version_to) : null; if (ver_to) { if (index(ver_to, "RC") > 0) ver_to = lc(ver_to); if (ver_to in release.branches) { // User specified a branch name, not a specific version, // so coerce to latest in that branch. ver_to = release.branches[ver_to].latest; } } else if (index(build.from.version, "SNAPSHOT") >= 0) // Any snapshot stays on the same branch. ver_to = build.from.version; else { // Any unspecified non-snapshot gets latest from same branch. let b = branch_of(build.from.version); ver_to = release.branches[b].latest; } let ver_to_branch = branch_of(ver_to); if (! (ver_to_branch in release.branches) || ! (ver_to in release.branches[ver_to_branch].versions)) { show_versions(true); exit(EXIT_ERR); } let fstype = options.fstype || device.fstype; build.to = proto({ version: ver_to, // Full version name of target: "22.03.0-rc4", "23.05.2" or "SNAPSHOT" rev_code: null, // Build number from target kernel: null, // Kernel version of target build, extracted from BOM fstype: fstype, // Requested root FS type img_prefix: null, // Prefix of image being built img_file: null, // Full image name to download and install date: null, // Build date of target }, BuildInfo); } function age(from) { let delta = time() - from; let hours = (delta+1800) / 3600; if (hours < 48) return sprintf("~%d hours ago", hours); return sprintf("~%.0f days ago", hours / 24.0); } function complete_build_info(profile, board) { let dt = gmtime(board.source_date_epoch); build.to.date = sprintf("%4d-%02d-%02dT%02d:%02d:%02dZ (%s)", dt.year, dt.mon, dt.mday, dt.hour, dt.min, dt.sec, age(board.source_date_epoch)); build.to.rev_code = board.version_code; build.to.img_prefix = profile.image_prefix; // First, only allow legitimate "sysupgrade" types through. let images = filter(profile.images, (img) => img.filesystem && img.filesystem != "initramfs" && ! match(img.type, /factory/)); let valid_fstypes = uniq(sort(map(images, (img) => img.filesystem))); if (! (build.to.fstype in valid_fstypes)) { L.die("File system type '%s' should be one of %s\n", build.to.fstype, valid_fstypes); } // Next, reduce candidate images to just those with desired fstype. images = filter(images, (img) => img.filesystem == build.to.fstype); // Here is where we fix our guess for 'sutype' made above in // 'collect_device_info' (look for "sdcard" there). let valid_sutypes = uniq(sort(map(images, (img) => img.type))); if (! (device.sutype in valid_sutypes)) { if (device.sutype == "sysupgrade" && length(valid_sutypes) == 1) device.sutype = valid_sutypes[0]; else L.bug("%s:%s Sysupgrade type '%s' should be one of %s\n", device.target, device.platform, device.sutype, valid_sutypes); } for (let img in images) { if (img.filesystem == build.to.fstype && img.type == device.sutype) { build.to.img_file = img.name; break; } } } function collect_overview() { // When building the versions list, refer to // https://openwrt.org/docs/guide-developer/security#support_status collect_device_info(); let overview = dl_overview(); url.upstream = overview.upstream_url ?? default_upstream; server_limits = { max_rootfs_size: overview.server?.max_custom_rootfs_size_mb || 1024, max_defaults_length: overview.server?.max_defaults_length || 20480, }; if (options.rootfs_size && options.rootfs_size > server_limits.max_rootfs_size) { L.die("%d is above this server's maximum rootfs partition size of %d MB\n", options.rootfs_size, server_limits.max_rootfs_size); } let bad_releases = [ "23.05.1", ]; release = { branch: null, // Release branch name: "SNAPSHOT" or "21.07" or "23.05" dir: null, // ASU and DL server release branch directory: "snapshots" or "release/23.05.0" branches: {}, }; for (let branch_id, data in overview.branches) { if ("enabled" in data && ! data.enabled) continue; if (! length(data.targets)) continue; release.branches[branch_id] = { latest: null, // Determined below. versions: filter(data.versions, (v) => !(v in bad_releases)), }; } // Put everything in order, select 'latest'... release.branches = sort(release.branches, version_cmp); for (let data in values(release.branches)) { data.versions = sort(data.versions, version_cmp); for (let version in data.versions) { if (index(version, "-SNAPSHOT") >= 0) continue; if (data.latest == null || version_older(data.latest, version)) { data.latest = version; } } } collect_build_info(); release.branch = branch_of(build.to.version); let active_branch = overview.branches[release.branch]; if (! active_branch) { // TODO Should probably check: // || ! (build.to.version in release.branches[release.branch].versions) // but the versions list we got from the overview is incomplete // (i.e., ASU server will build a lot more than is shown) and // we catch that when trying to fetch board_json below. show_versions(true); exit(EXIT_ERR); } release.dir = replace(active_branch.path, "{version}", build.to.version); packages.changes = active_branch.package_changes; } function collect_platform() { // ASU platform.json often updates days after upstream profiles, so the // 'version_code' is wrong and build requests fail. As of 2024-06-09, // this appears to have been solved, see ASU commit 1e6484d. // // Previously, to solve this issue we'd look at the download server: // url.platform = `${url.upstream}/${release.dir}/targets/${device.target}/profiles.json`; // let profile = platform.profiles[device.platform]; // // Use upstream as much as possible, per @aparcar's comment: // https://github.com/efahl/owut/issues/2#issuecomment-2165021615 url.platform = `${url.upstream}/${release.dir}/targets/${device.target}/profiles.json`; let platform = dl_platform(); if (! platform) { L.die("Unsupported target '%s'\n", device.target); } if (! (device.platform in keys(platform.profiles))) { // This is a mapped profile, e.g.: raspberrypi,model-b-plus -> rpi let found = false; for (let real_platform, data in platform.profiles) { for (let alias in data.supported_devices) { alias = replace(alias, ",", "_"); if (device.platform == alias) { found = true; L.log(2, "Mapping platform %s to %s\n", device.platform, real_platform); device.platform = real_platform; break; } } if (found) break; } if (! found) { if ("generic" in keys(platform.profiles)) device.platform = "generic"; else L.die("Unsupported profile: %s\n Valid profiles are %s\n", device.platform, keys(platform.profiles)); } } let profile = platform.profiles[device.platform]; device.arch = platform.arch_packages; complete_build_info(profile, platform); collect_defaults(platform.default_packages, profile.device_packages); if ("linux_kernel" in platform) { build.to.kernel = platform.linux_kernel.version; } } function collect_all() { collect_overview(); collect_platform(); let location = build.to.is_snapshot() ? "snapshots/faillogs" : `releases/faillogs-${release.branch}`; url.failed = `${url.upstream}/${location}/${device.arch}/`; url.pkg_arch = `${url.static_root}/${release.dir}/packages/${device.arch}-index.json`; url.pkg_plat = `${url.static_root}/${release.dir}/targets/${device.target}/index.json`; let prefix = "openwrt-"; let starget = replace(device.target, /\//, "-"); if (! build.to.is_snapshot()) prefix = `${prefix}${build.to.version}-`; if (build.to.is_rel_snapshot()) prefix = lc(`${prefix}${build.to.rev_code}-`); url.download = `${url.upstream}/${release.dir}/targets/${device.target}`; collect_packages(); if (! build.to.kernel) { // Fall back to pre-"linux_kernel" scanning of packages. build.to.kernel = "unknown"; for (let pkg, data in packageDB) { if (data.new_version && index(pkg, "kmod-") == 0 && is_default(pkg)) { build.to.kernel = match(data.new_version, /^\d+\.\d+\.\d+/)[0]; break; } } } pkg_name_len = max(...map(keys(packageDB), length), ...map(packages.default, length)); } //------------------------------------------------------------------------------ function dump() { // Send forth a json representation of all the stuff we've collected. let comma = (l) => L.show(l) ? "," : ""; let inst = sort(packages.installed); let urls = sort(url); let tmps = sort(tmp); let pkgs = sort(packageDB); L.log(-1, '{\n'); L.log(-1, '"version": "%s",\n', PROG); L.log(-1, '"options": %.2J,\n', options); L.log(-1, '"server_limits": %.2J,\n', server_limits); L.log( 1, '"url": %.2J,\n', urls); L.log( 1, '"tmp": %.2J,\n', tmps); L.log( 1, '"build": %.2J,\n', build); L.log(-1, '"device": %.2J,\n', device); L.log( 0, '"release": %.2J%s\n', release, comma(2)); L.log( 2, '"packageDB": %.2J%s\n', pkgs, comma(3)); L.log( 3, '"packages": %.2J\n', packages); L.log(-1, '}\n'); } function list() { // Generate a list formatted for use with firmware-selector or // source build. let packages; switch (options.format) { case "config": packages = top_level(SrcType.USER_ONLY); let ctype = "y"; // "y" to install, "m" just build package. for (let pkg in sort(packages)) { L.log(0, "CONFIG_PACKAGE_%s=%s\n", pkg, ctype); } break; case "fs-all": packages = top_level(SrcType.ALL); L.log(0, "%s\n", join(" ", packages)); break; case "fs-user": default: packages = top_level(SrcType.USER_ONLY); push(packages, ...map(removed_defaults(), (pkg) => "-"+pkg)); L.log(0, "%s\n", join(" ", packages)); break; } } function show_config() { // Pretty-print the major configuration values. let downgrade = build.to.is_downgrade_from(build.from) ? L.colorize(L.RED, " DOWNGRADE") : ""; let hash = split(build.to.rev_code, "-")[1]; L.log(0, `ASU-Server ${url.sysupgrade_root}\n` `Upstream ${url.upstream}\n` `Target ${device.target}\n` `Profile ${device.platform}\n` `Package-arch ${device.arch}\n` ); L.log(1, `Root-FS-type ${device.fstype}\n` `Sys-type ${device.sutype}\n` ); L.log(0, `Version-from ${build.from.version} ${build.from.rev_code} (kernel ${build.from.kernel})\n` `Version-to ${build.to.version} ${build.to.rev_code} (kernel ${build.to.kernel})${downgrade}\n` ); if (hash) L.log(1, `Build-commit https://git.openwrt.org/?p=openwrt/openwrt.git;a=shortlog;h=${hash}\n`); L.log(1, `Build-FS-type ${build.to.fstype}\n` `Build-at ${build.to.date}\n` `Image-prefix ${build.to.img_prefix}\n` `Image-URL ${url.download}\n` `Image-file ${build.to.img_file}\n` ); L.log(1, "Installed %3d packages\n", length(packageDB)); L.log(1, "Top-level %3d packages\n", length(top_level(SrcType.ALL))); L.log(1, "Default %3d packages\n", length(packages.default)); L.log(1, "User-installed %3d packages (top-level only)\n", length(top_level(SrcType.USER_ONLY))); L.log(1, "\n"); } function check_updates() { // Scan the old and new package lists, return the number of changed // packages and the number of missing packages that would cause a // build failure. let changes = 0; let missing = 0; let downgrades = 0; L.log(1, "Package version changes:\n"); let w0 = pkg_name_len + 2; let w1 = 0; for (let pkg, v in packageDB) { if (! (pkg in packages.non_upgradable)) w1 = max(w1, length(v.version)); } let f0 = ` %-${w0}s %s%-${w1}s %s%s%s%s\n`; let new = ''; for (let pkg, data in sort(packageDB)) { if (pkg in packages.non_upgradable) continue; let old = data.version; let new = data.new_version; if (old == new) continue; let cmp = pkg_ver_cmp(old, new, true); if (cmp == 0) continue; changes++; let c1 = ""; let c2 = ""; let suffix = ""; // Downgrade or whatever switch (cmp) { case -2: // Old is null. // This happens when you '--add' a new package. c1 = L.color(L.YELLOW); old = "not-installed"; // fallthrough case -1: c2 = L.color(L.GREEN); break; case 1: downgrades++; c2 = L.color(L.RED); suffix = " (downgrade)"; break; case 2: // New is null. if (! is_top_level(pkg) && ! is_default(pkg)) c2 = L.color(L.YELLOW); else { missing++; c2 = L.color(L.RED); } new = "missing to-version"; break; case 99: // They are different (hashes usually), but we // can't tell if one is older than the other. c2 = L.color(L.YELLOW); suffix = " (indeterminate)"; break; } L.log(1, f0, pkg, c1, old, c2, new, suffix, L.color(L.reset)); } if (missing) { L.log(0, "%d packages missing in target version, %s\n", missing, L.colorize(L.RED, "cannot upgrade")); } if (downgrades) { L.log(0, "%d packages were downgraded\n", downgrades); } if (changes) { L.log(0, "%d packages are out-of-date\n", changes); } else { L.log(0, "All packages are up-to-date\n"); } if (length(packages.replaced)) { let f0 =` %-${w0}s %s\n`; L.log(1, "\nAutomatic package replacements/removals:\n"); L.log(1, f0, "Package", "Replaced-by"); for (let chg, to in sort(packages.replaced)) { L.log(1, f0, chg, to ?? L.colorize(L.YELLOW, "removed")); } L.log(1, "Details at %s\n", url.overview); } L.log(1, "\n"); return { missing, changes, downgrades }; } function check_missing() { // Mostly silent check for missing packages. Used when generating a // package list for external uses, 'list' or 'blob'. L.push(-1); let updates = check_updates(); L.pop(); if (updates.missing) { L.err("There are %s missing packages in the build package list, run 'owut check'\n", updates.missing); return false; } return true; } function check_defaults() { // Scan the package defaults to see if they are // 1) missing from the installation or // 2) modified/replaced by some other package. let ignored = parse_package_list(options.ignored_defaults); let changes = {}; let count = { ignored: 0, retained: 0, replaced: 0, removed: 0 }; for (let pkg in packages.default) { if (pkg in packages.non_upgradable) continue; if (pkg in ignored) { count.ignored++; changes[pkg] = L.colorize(L.GREEN, "user ignored"); } else if (is_installed(pkg)) count.retained++; else { changes[pkg] = what_provides(pkg); if (changes[pkg]) count.replaced++; else { count.removed++; changes[pkg] = L.colorize(L.YELLOW, "not installed"); } } } L.log(1, "Default package analysis:\n"); if (length(changes) == 0) { L.log(1, " No missing or modified default packages\n\n"); } else { if (! L.show(1)) L.log(0, "There are %d missing and %d modified default packages\n", count.removed, count.replaced); let wid = pkg_name_len + 2; let fmt = ` %-${wid}s %s\n`; L.log(1, fmt, "Default", "Provided-by"); for (let p, a in changes) { L.log(1, fmt, p, a); } L.log(1, "\n"); } return count; } function check_pkg_builds() { // Scraping the failures.html is a total hack. // Let me know if you have an API on downloads (or other build site) // that can give this info. // // The lines we're scraping look like: // gummiboot/-Tue Apr 23 07:05:36 2024 let info = regexp( '([^<]*)/' + '[^<]*' + '([^<]*)', 'g' ); let n_failed = 0; let n_broken = 0; let html_blob = dl_failures(); let feeds = map(match(html_blob, info), (f) => f[1]); if (! html_blob || ! feeds) { L.log(1, "No package build failures found for %s %s.\n\n", build.to.version, device.arch); } else { L.log(1, "There are currently package build failures for %s %s:\n", build.to.version, device.arch); for (let feed in feeds) { let shown = 0; L.log(1, " Feed: %s\n", feed); html_blob = dl_failures(feed); if (html_blob) { let fails = match(html_blob, info); let fmt = ` %-${pkg_name_len}s %s - %s\n`; for (let fail in fails) { n_broken++; let pkg = fail[1]; let date = fail[2]; let msg, level; if (is_installed(pkg)) { n_failed++; msg = L.colorize(L.RED, "package installed locally, cannot upgrade"); level = 1; } else { msg = "not installed"; level = 2; } L.log(level, fmt, pkg, date, msg); if (L.show(level)) shown++; } if (shown != length(fails)) { L.log(1, " %d unshown\n", length(fails)-shown); } } } let prefix = n_failed ? L.colorize(L.RED, `${n_failed} of ${n_broken} package build failures affect this device:`) : L.colorize(L.GREEN, `${n_broken} package build failures don't affect this device,`); L.log(n_failed ? 0 : 1, "%s details at\n %s\n\n", prefix, url.failed); } return ! n_failed; } function check_init_script() { // If // 1) the user has an immutable image, and // 2) that image contains an ASU generated custom defaults file, and // 3) the user has not mentioned or overridden it, // then warn them and have them read the documentation. const asu_defaults = "/rom/etc/uci-defaults/99-asu-defaults"; if (options.init_script) { if (options.init_script != "-" && ! fs.access(options.init_script)) { L.die("The specified init-script '%s' does not exist\n", options.init_script); } } else if (fs.access(asu_defaults)) { L.wrn(`You have a custom uci-defaults script at\n` ` ${asu_defaults}\n` `and have not referenced it with the 'init-script' option.\n` `Please read:\n` ` ${wiki_url}#using_a_uci-defaults_script\n\n` ); } } function blob(report) { // Exclude default packages unless explicitly listed in 'packages'. When // moving between releases, default packages may be added, deleted or // renamed, which can result in bricks if something important is missed. let contains_defaults = true; let log_level = report ? 1 : 2; // We try to use 'packages_versions' in our server request, but can // only do so if all packages have valid versions. We fall back to // using 'packages' when any version is undefined. let package_list = { packages: top_level(SrcType.ALL) }; package_list["packages_versions"] = with_versions(package_list.packages); package_list["type"] = null in values(package_list.packages_versions) ? "packages" : "packages_versions"; let init_script; if (options.init_script) { let inits_file = options.init_script == "-" ? fs.stdin : fs.open(options.init_script); if (! inits_file) { L.err("Init script file '%s' does not exist\n", options.init_script); return null; } else { init_script = inits_file.read("all"); inits_file.close(); if (length(init_script) > server_limits.max_defaults_length) { L.err("'%s' is over the ASU server's %s byte maximum\n", options.init_script, server_limits.max_defaults_length); return null; } } } let rc = (options.rev_code == "none" ? "" : options.rev_code) ?? build.to.rev_code; L.log(log_level, "Request:\n Version %s %s (kernel %s)\n", build.to.version, rc || "none", build.to.kernel); if (build.to.fstype != device.fstype) { L.log(log_level, " Change file system type from '%s' to '%s'\n", device.fstype, build.to.fstype); } let blob = { client: PROG, target: device.target, profile: device.platform, // sanitized board name version: build.to.version, version_code: rc, filesystem: build.to.fstype, diff_packages: contains_defaults, }; blob[package_list.type] = package_list[package_list.type]; if (options.rootfs_size) { if (options.rootfs_size > server_limits.max_rootfs_size) { L.die("This server allows a maximum rootfs partition size of %d MB\n", server_limits.max_rootfs_size); } blob.rootfs_size_mb = options.rootfs_size; L.log(log_level, " ROOTFS_PARTSIZE set to %d MB\n", options.rootfs_size); } if (init_script) { blob.defaults = init_script; L.log(log_level, " Included init script '%s' (%d bytes) in build request\n", options.init_script, length(init_script)); } return blob; } function json_blob() { let b = blob(true); return b ? sprintf("%J", b) : null; } function show_blob() { let b = blob(); if (b) { L.log(0, "%.2J\n", b); } } function select_image(images) { for (let image in images) { if (image.filesystem == build.to.fstype && image.type == device.sutype) { return image; } } return null; } function verify_image() { // Verify the image with both the saved sha256sum and by passing it // to 'sysupgrade --test'. // // Failed images will be delete, unless '--keep' is set. let image = options.image; if (! fs.access(image)) { L.err("Image file '%s' does not exist\n", image); return false; } let info = fs.stat(image); L.log(1, "Verifying : %s (%d bytes) against %s\n", image, info.size, tmp.firmware_sums); let result = sha256.verify(); if (result?.code == 0) { L.log(1, " Saved sha256 matches\n"); } else { let file_sha = sha256.sum(image); let expected = sha256.saved_sum(image); L.err(`sha256 doesn't match:\n` ` calculated '${file_sha}'\n` ` saved '${expected}'\n`); if (! options.keep) { fs.unlink(image); } return false; } result = sysupgrade(image, true, ["--test"]); if (result?.code == 0) { L.log(1, " %s\n", join("\n ", split(trim(result.stderr), "\n"))); } else { L.err("sysupgrade validation failed:\n"); if (result.stdout) L.log(0, "stdout =\n%s\n", result.stdout); if (result.stderr) L.log(0, "stderr =\n%s\n", result.stderr); if (! options.keep) { fs.unlink(image); } return false; } L.log(1, "Checks complete, image is valid.\n"); return true; } function download() { // Use the json_blob to create a build request, run the request and // download the result. // // On success, return true. // // Certain failures often indicate that the ASU server has fallen // behind the build servers. For example, // // Error: Received incorrect version r26608-blah (requested r26620-blah) // // When we see one of these cases, we display one or more error // messages, increment an error counter and use the counter to fall // out of the main build-polling loop, and then generate a final // message "wait a bit and retry". // // Other inexplicable or better explained errors simply show the error // message and then immediately return false. let blob = json_blob(); if (! blob) return false; if (options.keep) { L.log(2, "Saving build blob to %s\n", tmp.req_json); let save = fs.open(tmp.req_json, "w"); if (save) { save.write(blob); save.close(); } } let response = dl_build(blob); let t_start = time(); let t_build_start = t_start; let hash = response?.request_hash; if (hash) { L.log(0, "Request hash:\n %s\n", hash); url.build_status = replace(url.build_status, "{hash}", hash); } let errors = 0; let prev_status = ""; let poll_interval = 500; // Check first response right away. while (response && !errors) { let status = response.status; if (response.detail == prev_status) { L.backup(); } else { L.log(0, "--\n"); L.mark(); prev_status = response.detail; } let t_now = time(); let highlight = status in [200, 202] ? L.GREEN : L.RED; L.log(0, "Status: %s", L.colorize(highlight, response.detail)); switch (response.detail) { case "queued": L.log(0, " - %d ahead of you", response.queue_position); t_build_start = t_now; break; case "started": L.log(0, " - %s", response.imagebuilder_status ?? "setup"); break; default: break; } L.log(0, "\n"); let t_total = t_now - t_start; let t_queue = t_build_start - t_start; let t_build = t_now - t_build_start; L.log(0, "Progress: %3ds total = %3ds in queue + %3ds in build\n", t_total, t_queue, t_build); switch (status) { case 202: // Build in-progress, update monitor at user-specified interval. sleep(poll_interval); poll_interval = options.poll_interval; response = dl_build_status(); break; case 200: // All done. let req_version_code = response.request.version_code; L.log(0, "\nBuild succeeded in %3ds total = %3ds in queue + %3ds to build:\n", t_total, t_queue, t_build); L.log(2, " build_at = %s\n", response.build_at); L.log(1, " version_number = %s\n", response.version_number); L.log(1, " version_code = %s (requested %s)\n", response.version_code, req_version_code); L.log(1, " kernel_version = %s\n", build.to.kernel); L.log(1, " rootfs_size_mb = %s\n", response.request.rootfs_size_mb ?? "default"); L.log(1, " init-script = %s\n", response.request.defaults ? options.init_script : "no-init-script"); L.log(3, " images = %.2J\n", response.images); L.log(3, " build_cmd = %.2J\n", response.build_cmd); L.log(3, " manifest = %.2J\n", response.manifest); L.log(1, "\n"); let image = select_image(response.images); if (! image) { L.err("Could not locate an image for '%s' and '%s'\n", build.to.fstype, device.sutype); return false; } let sha = image.sha256; // LuCI-ASU uses sha256_unsigned for something... let dir = response.bin_dir; let bin = `${url.store_root}/${dir}`; let img = `${bin}/${image.name}`; let dst = options.image; L.log(1, "Image source: %s\n", img); let rsp = _request(img, dst); if (rsp?.status != 200) { L.err("Couldn't download image %s\n", image.name); return false; } L.log(0, "Image saved : %s\n", dst); sha256.save(dst, sha); // Create the manifest, and validate against request. let manifest = response.manifest; let manifest_file = fs.open(tmp.firmware_man, "w"); if (manifest_file) { manifest_file.write(sprintf("%.2J\n", response)); manifest_file.close(); L.log(1, "Manifest : %s\n", tmp.firmware_man); } if (req_version_code && response.version_code != req_version_code) { L.err("Firmware revision mismatch: expected %s, but got %s\n" + "If you determine this is acceptable, simply 'owut verify' " + "and 'owut install'.\n", req_version_code, response.version_code); errors++; } for (let pkg in top_level(SrcType.ALL)) { if (pkg in packages.non_upgradable) continue; if (! (pkg in manifest)) { L.err("Firmware missing requested package: '%s'\n", pkg); errors++; continue; } let expected_version = packageDB[pkg].new_version; let received_version = manifest[pkg]; if (received_version != expected_version) { L.err("Firmware package version mismatch: '%s', expected %s, but got %s\n", pkg, expected_version, received_version); errors++; continue; } } return errors == 0; // Everything else is "failure - we're done" cases. case 400: // Invalid build request. case 422: // Unknown package. case 500: // Invalid build request. default: // ??? L.log(0, "\nBuild failed in %3ds total = %3ds in queue + %3ds to build:\n", t_total, t_queue, t_build); if (response.error ) L.log(0, "%s =\n%s\n", L.colorize(L.RED, "ASU server error"), response.error); if (response.stdout) L.log(0, "%s =\n%s\n", L.colorize(L.RED, "ASU server stdout"), response.stdout); if (response.stderr) L.log(0, "%s =\n%s\n", L.colorize(L.RED, "ASU server stderr"), response.stderr); L.err("Build failed with status %s (--version-to %s --device %s:%s:%s)\n", status, build.to.version, device.target, device.platform, build.to.fstype); errors++; break; } } if (errors) { L.log(0, "The above errors are often due to the upgrade server lagging behind the\n" + "build server, first suggestion is to wait a while and try again.\n"); } return false; } function run_pre_install_hook() { // Execute a user program just prior to doing the final installation. if (options.pre_install) { if (! fs.access(options.pre_install)) L.die(`Cannot access pre-install script '${options.pre_install}', aborting upgrade\n`); L.log(1, "Executing pre-install script '%s'...\n", options.pre_install); let result = ubus.run(options.pre_install); if (result?.stdout) L.log(0, result.stdout); if (result?.stderr) L.log(0, result.stderr); if (result.code != 0) L.die(`Pre-install script '${options.pre_install}' failed with status ${result.code}, aborting upgrade\n`); L.log(1, "Pre-install script successful, proceeding with upgrade\n"); } } function install() { // Run sysupgrade to install the image. // Probably need some more options reflected from sysupgrade itself. // '-n' = discard config comes to mind first, maybe '-f' = force, too. run_pre_install_hook(); // Run user's pre-install hook. sysupgrade(options.image, false); L.log(0, "Installing %s and rebooting...\n", options.image); } //------------------------------------------------------------------------------ if (options.verbosity > 0 && ! (options.command in ["dump", "blob", "list"])) { arg_defs.show_version(); } uloop.init(); ubus.init(); initialize_urls(); let updates, counts, details; let exit_status = EXIT_ERR; // Assume failure, until we know otherwise. function terminate() { // system("grep -E 'VmRSS|VmPeak' /proc/$PPID/status"); if (uloop.running()) uloop.end(); uloop.done(); ubus.term(); _del_uclient(); exit(exit_status); } signal("SIGINT", terminate); // Ensure ctrl-C works when inside build loop. switch (options.command) { case "versions": collect_overview(); show_versions(false); exit_status = EXIT_OK; break; case "dump": L.push(-1); collect_all(); L.pop(); dump(); L.push(-1); exit_status = EXIT_OK; break; case "list": collect_all(); list(); if (check_missing()) exit_status = EXIT_OK; break; case "check": collect_all(); show_config(); updates = check_updates(); counts = check_defaults(); if (check_pkg_builds() && ! updates.missing) exit_status = EXIT_OK; check_init_script(); if (counts.removed) L.wrn("There are %d missing default packages, confirm this is expected before proceeding\n", counts.removed); details = L.show(1) ? "\n" : " (re-run with '--verbose' for details)\n"; if (exit_status != EXIT_OK) L.err("Checks reveal errors, do not upgrade%s", details); else if (updates.downgrades) L.wrn("Checks reveal package downgrades, upgrade still possible with '--force'%s", details); else if (updates.changes == 0) L.log(0, "There are no changes, upgrade not necessary%s", details); else L.log(0, "It is safe to proceed with an upgrade%s", details); break; case "blob": collect_all(); check_init_script(); show_blob(); if (check_missing()) exit_status = EXIT_OK; break; case "download": case "upgrade": collect_all(); show_config(); updates = check_updates(); details = L.show(1) ? "\n" : " (run 'owut check --verbose' for details)\n"; if (updates.downgrades && ! options.force) { L.err("Update checks reveal package downgrades%s", details); break; } if (updates.missing) { L.err("Update checks reveal errors, can't proceed%s", details); break; } counts = check_defaults(); if (! check_pkg_builds()) { L.err("Package build checks reveal errors, can't proceed%s", details); break; } if (counts.removed) L.wrn("There are %d missing default packages, confirm this is expected before proceeding%s", counts.removed, details); if (updates.changes == 0) { if (options.force) L.wrn("Forcing build with no changes%s", details); else { L.log(0, "There are no changes to %s (see '--force')\n", options.command); exit_status = EXIT_OK; break; } } check_init_script(); if (! download()) break; // fallthrough case "verify": case "install": if (verify_image()) { exit_status = EXIT_OK; if (options.command in ["upgrade", "install"]) { install(); } } break; default: L.err("'%s' not implemented\n", options.command); break; } dl_stats.report(); terminate(); 07070101AE2DAB0000A1FF0000000000000000000000016A426C2800000012000000FE0000000000000000000000000000000C00000000usr/bin/ssh/usr/sbin/dropbear07070101AE2320000081ED0000000000000000000000016A426C2800001018000000FE0000000000000000000000000000001200000000usr/bin/getrandomELF@4t4 (44@4@@@tt@t@p@@p@@@@ @@T@@PPQtdRtd@@<</lib/ld-musl-mipsel-sf.so.1 @ @ @@@@d@d@ p @5p @p@ppp@ ppp'p@P2p@ooP@oo.@    E @@"MT @ -@"ek @@s@z__RLD_MAP_init_fini__register_frame_info__deregister_frame_infosyscallisatty__stack_chk_failwritefprintfstderratoi__libc_start_mainfputs__stack_chk_guardlibgcc_s.so.1libc.soGLIBC_2.0ii  @~@~ @@@@@@@ @ @@' ' d,@tgI`* )Tgg(\ejI`n9"LeHl"XRg`iIP`0goglD J* Tg Pl." HHP` wde @@ @@D@d@@@%@ @@#% !(!<$$ ''@<$$B$@<@<$@ $$(''@<0  @@<B$@$@<< $$0  '@<B$ @@<'@<4 $8 $ '' 'Usage: %s => return bytes from getrandom() Not outputting random to a tty Invalid param (must be > 0) getrandom() failed: %m write() failed: %m @<'#%x '@< %@< %@< %`e;ee@`e;ee@`e;ee@`e;ee@`e;ee@`e;ee@`e;ee@@`@@@@@@@@@@@07070101AE21460000A1FF0000000000000000000000016A426C2800000011000000FE0000000000000000000000000000000D00000000usr/bin/time../../bin/busybox07070101AE2449000081ED0000000000000000000000016A426C2800003117000000FE0000000000000000000000000000001100000000usr/bin/luci-bwcELF @4t4 (44@4@@@tt@t@p@@p@@@@**/?@?@3l@@88QtdRtd/?@?@/lib/ld-musl-mipsel-sf.so.1 @ P @ &@?@?@@l@@  p@@5p= @@ppp@ pp>p'p8 @2p?@oo @oo @%>0:#%7 $ * "5,' 6/8& .-!<(4+)=2;139$)@" P @ Q)@"@@&@t%@%@%@g%@:%@%@%@p%@`%@AP%@@%@0%@z %@%@s%@J$@l$@f$@]$@W$@M$@F$@A$@:p$@3`$@XP$@,@$@0$@ $@$@ $@#@#@#@#@#@#@#@#@ip#@`#@P#@@#@0#@ #@#@#@"@"@ "@v"@p"@__RLD_MAP_init_fini__fixunssfsi__register_frame_infostrlen__mulsf3memset__deregister_frame_infomemcpypopen__dlsym_time64sigemptysetstrerrormemmovepclosesnprintfmunmapgetpidfscanffgetsglobperrorsleepreaddirmmapdlclose__stack_chk_failwritefprintfkillchdir__stat_time64strstrdlopenunlinkforksscanfsigactionfreadstrtoullfopengetoptfcloseopendirstrcmp__time64stderrglobfree__errno_locationexitatoi__libc_start_mainclosedirmkdiroptarg__stack_chk_guardlibgcc_s.so.1libc.soGCC_3.0GLIBC_2.0P&y  ii ?@?@?@' 'j @2iedgX`%gHhjK jX HdbapPؘ%Ng@:eRe"`PP𸘰gEM@8ej#H2Iယ0\@:e KI eJlr4`mR`cr)`ira@$H@8ewdrr`tra@P@@:exeD۪@$HH@8eD He% @ @@#% !(!<$$ ''@<$$&B$@<@<P $  q $$(''@< A @@<)B$@$@<|  )$$ A '@<)B$ @@<'@<$A$x  )$ '32mm3m4l ejV @2iegdҡO?e@eg@gpgddj @2iegXd`ڠj @2iedg@@  ҂gpL(nm@:ee!B@*0XmnM@:eRe*#:7$+;9?<   &. -/%"6 41/@"yg00@ @"ir340@;80@!g:80@ Vz @ b[0@"<80@!'S~8N0@" GD@@ /@PO-9J__RLD_MAPblobmsg_format_json_with_cbblobmsg_add_json_from_string_finifreestrlen__stack_chk_fail__stack_chk_guardsnprintfjson_object_get_objectjson_object_new_int64json_object_to_json_stringjson_object_get_int64json_tokener_parsejson_object_new_booleanjson_object_new_doublejson_object_new_arrayjson_object_get_booleanjson_object_get_doublejson_object_new_stringjson_object_get_typejson_object_get_stringjson_object_object_addjson_object_array_addarray_list_get_idxjson_object_putjson_object_get_arrayarray_list_lengthjson_object_new_objectstrchrstderrstrcmpreadfprintfstrtodcallocavl_findblob_buf_initavl_initavl_insertfputsfclosefopenstrtok_r__register_frame_info__deregister_frame_infostdoutfflush__fstat_time64getoptisalnumputcfwriteatoi__libc_start_mainatolloptarg__environlibblobmsg_json.so.20260213libjson-c.so.5libubox.so.20260213libgcc_s.so.1libc.soGLIBC_2.0JSONC_0.14 ii `/@~00@~40@~ 80@~ /@~/,/@0/@4/@8/@/@?' 'dvwown`l2I@/* m,"gj@i‚/,hi7k6aB #or `pR1`ir`nr`Rr>`Xh7`` L\h\ Pg{dL=m"JGOg HJҼrr `wrn`praNN@M@۴Ijg FmDg"gJ*g?D gJ*g?8TghX * Zag5 lB*g1 gRaC3*N # g(XjXgTg g;g@g * g;ggh3i1e80@t0@a@@x@ /@@40@0@`0@@@$@@@`@/@t@%X@@@#% !(!<$$ ''@<$$B$@<@< $ 1$$(''@<@0 @@<0B$@$@< $$@0 '@< B$ @@<'@|-R |-o |-p |-w p:nir:R:o:wH@@@8@4@$@@,@@<$/$/'#%x '@<@/ @/%@JG*.VEFZ'a,9=T1LdwKy|hifp^2UAng+6X`[# YC?hmB%Pia6 `AN.< +g`RWewl5-g"Q  @ ~ #z7FB"E3t=$0uB&0uB!<8uBEr#Y`FlmBMFB"G55BK@uB--LpmB^Y Jr56uYl__RLD_MAP_fini__libc_start_mainstrchrnulstrncmpstrtolstrcmpmemcmpstrlenstrnlengetenvmemsetinflateInit2___stack_chk_failinflateinflateEndfputcfwrite__stack_chk_guardstdoutstrchrfnmatchunlinkat__errno_locationputchargetuidopenatuncompressmemmemmemcpy__assert_failreallocqsort_rvsnprintfqsortstrptime__mktime64strtoulreadlinkatstrcasecmpmallocstrdupmemrchrcallocisalnumatoiatexitpsa_crypto_initisattyaccessumasksetvbufsignalfclosemkdirat__time64fputs__gmtime64_rstrftimestrstrfdopenstderr__environgetpidfflushfgetcsyncreadstdinputenvexecvpmbedtls_md_info_from_typegetrandommbedtls_psa_crypto_freebsearchstrrchr__fstatat_time64fchownatfchmodat__fstat_time64munmap__futimens_time64mbedtls_mdmbedtls_md_initmbedtls_md_setupmbedtls_md_startsmbedtls_md_freembedtls_md_updatembedtls_md_finishrenameatmbedtls_pk_write_pubkeymbedtls_pk_freembedtls_pk_verifydeflatedeflateEndstrlcpymemchrstrerror_exitforkfchdirgetgidunsharemountchrootmkdirexecvelseekfdopendirclosedirreaddirfgetpwentendpwentfgetgrentendgrentmmapdeflateInit2_memmove__utimensat_time64symlinkatmknodatfsetxattrflistxattrfgetxattrfcntlfilenoioctlvfprintfstrcpymemfd_createfaccessatwaitpidpipe2pollstrpbrkmbedtls_pk_initmbedtls_platform_zeroizembedtls_pk_parse_keymbedtls_pk_parse_public_key__gmtime64posix_spawn_file_actions_initposix_spawn_file_actions_adddup2posix_spawnpposix_spawn_file_actions_destroyreallocarrayrealpathfstatfs_Exitflocksigactionalarmsetmntentgetmntentendmntent__register_frame_info__deregister_frame_infolibmbedcrypto.so.16libz.so.1libgcc_s.so.1libc.soGLIBC_2.0XXXXXXXXii hmB~0uB~W8uB~clmB~vpmB~|mBmBmBmBmBmBmBmB mB mB mB mB mBmBmBmBmBmBmBmBmBmBmBmBmBmBmBmBmBmB mB!mB"mB#nB$nB%nB& nB'nB(nB)nB*nB+ nB,$nB-(nB.,nB/0nB04nB18nB2" gJE J jraA*`Z`r `r'`#glZXgMAbA*Dq* "jjjDC EF^jzdj j g+*g CaDJDC E ." 8*]9"!D4" D"1"D,*j " "gB B*gBJj"F^ n*jjjjKPATAXA\A adg БgDdja Kedg0Ee@,yL`wBvdgD`VGg`vD`V`D&zjK7vD`klkklM+v,`V`vaBk'N.BkmB%gg*eg"De *BkklBfjmFjudBkmBBk@km@@kdA|AAdPC@هAY0n]gmc-LXEIKهAcjLJj8oE/m%LTOI"ABRcEeY`nl"$eAm %LA%LLHHraPJrajB@"BCaI*. gJIHF**Dg*) ltg gngIJI BHFgD"Dg"FPGgjl"Dg"gjl"Dg"gjL#ede8uBBAAHAAAlmBAAAAd .$g gVgZ@ahzh PgudeBd jel*b6g*`l#ARLjudjAHAdg .g R$LBJBdd jFklꢯg*nWegeAHAdg .g R$LAJAdd jBklg" mWnmAHAAdBH5M@RaEd`uBAAAd?>@!AC;# dȜll$ "v +kvaVC5L`ܓe}djHg?e<V = ` 9g@jLV#Z!B8"a`3l Ӆd4mf`3`3뇢4m ԉh4mjK`3`3@2m ?!14AkngMe  hjl F@@' ҈njGMe g ; %;!jKlDr`CEeAPAAA0A,Adj LF'B@IL2ICaPgvd@/mg * n*jLIedg:cDgG"B H"djl2"@kl)*IRa"A.mRL@djl**""HnR!`|e@ra""nHeBB"Bz[L+Bb+{l"!cd@@tp2iL2JIC`n7Ra"D"J Je&gg"gnnmggepAHAd$g`g! AB5Mp`H p`N( lud`uBDAAAAd$ggB5MBRaH BRaN( ludDAAAKdg$g% BRaH ( ludAB5MeBADA` #Egd񄚦gGhoDd j ju@dg g$B *jB@H*"DJ"DAJn*B*Fkl<""2A7g_4" BRLjKvd@~jl *k@_l"Fl "k@Fl *nWeAJgg hgęm8@gemC@AHA:@ dDg 'jBA%g "@*A@"g@:ewd@*Ira hgIR a  BAK mRL GhgjeAD@AAAC@d*gGAJ IRaAmRLj 02g7RaiS a fg  RgjxdgB K+ks`DAAA dGEJg%g0 "ajmAejl*ajmAؠ-//dl RL`|e +goR %&Rg ydG@J(nmgX C"B@HH2I C%`@ gmR dlo  Kg "oR  RTeHj eA AHALB,A|Ado@Oj^alnZkXgn#$emd8uBpBd%gg"-@Aog " kR`IR aAmR$LCJCwd jeDgm "ԝUgM'Ban*`xRӝI㙘cxg@XyjILe@ADAO,"Ndg%"@g CŚ4g @@kl*IRa@AO mRL @@km꣘ @=5evd j j|AdgagDdeL&Fdg"`$gCiLS `F5O Rm}d jaH&g u"B@~?jLh2iH2I@AgB@KL2I j  Ca  Hjfe A ;*dBj?ajC AJ a[ "kLl* l1" hHjfer`r ` J ҵ m  7e  *|d j K$1P Q f g mDd dgi n  f *zdj o3n*a @r` n XeEgig jKABAAdg$g R a`BaOQ`edj@Aeda ր #EgJm-H2@maJIFg=m/au_`c`7Wno8e9gOw avG`UĦ06 ;a7Ʀu0 :aC=r<`2#%>eJKޣg- g 0eg08e9gg-706 ?ŸB=r`j@A 6gmAiA@k@5deBA "` #dgeF2kDd l j jed !gkl".XXgknudjedj ԑ E GdeA(A@Q@dXnXm.@ /D'B`Id2iH2ICLa' 'ggj l [q`) I$KRamRg'$@2@2aC%8g nmXEv q/D'B`Id2iH2IjCBaSkh"Kwd0"@J%`$ `Tkl*.{Zl*Pqm".6g"$RIc$'%J'&xgJ%& I,J0"@J` `Tkl{*.{Zlv*Pqmr".6gl" IRaH)a8@mA@ 3BAHAdg@dde3B dGEJ Dg G%g*YFZGajl " l@ p pki@raED* @E"eIRa <Rmyd:T9Ab`gC\*5nԑLG@J Tx @@ @2@2mCyXgi0nmLX GAJH&IN OR SG@JQ 'B IH2IC`9pgIΘS HkhC* @djl"ajl *Ta g M<m@BILCeAA3BB@@A@X@ dDIkEH KmHtP$gmg *XkL#³PtDAgdneD Dٟ@gb`фnԑLDgB@KH2Iҗ c``Xl"g"h$B5OmT@jfl "nDddGEJ @FHH2I j%g C7`@$nmX dl*Ѣg KgIRXgTxg " " Rm "oRe  Rm " J H ~dDA|AAGdB@:eDdevdgZ`V%g `v+`v-`&v!`zh Pgvdvn`V`vIa Dkva Dkklk  Dkkl Dh Dkm D@k Dkklkm D nXm!@BSjC؀jDEaG$YeX&ajP D kdl*g$YeXajPoRgA RL٪ DkAWAdBXAHAd##m g0*" )Dr-a~2+}.#j,-0j,"m g*j,"m g*j,"m g"m g"raZXgZXgJudb+jez@0BB.@X0BtA/B4@/B.@dg> n@ddeD d@"XDgc"VDg "UDgR*`jDib6gO*jLjL!Kh9 @$JjE  @r`kBl" h'BI@C4a Xggg P E`01RPg}d.Dg.*iih, @*kBl*h6"hz oP  I *B@H2IRhj Hn!gPah h AAA<@3BAHA\AA`` kdDg  BEd0d@%[DgJ ag zIJZ` ALC`IC``iC @ A B aE$bgi eJ`}IR`ұg8"lllk emy,jlrak Dlr`rw`*  g8"g @kN4lklZ`h$  g2B7e"gB"NJNj @ km @NrYak Dl "dh E aBIe/kx$jNgDp` " "ajٶM< b EJEۀ) Ek Eͳ[`n"$e  g8"g @kl"jҍjik Dl"CEa`3낢44mc`3,l+e`3놢44mg`3*+h4mjK`3`3@2m+n_"mhtDhr gg8"g"LkmL}g D@@jlrb`r`"h8!ap `P`HX`qpan,jlrp `P`Xap `D)h,jlrAh Ú a Б_") jL#,jlraao( r?a njБ?",(@k Dl&"jj!X`bLlJ2 s,`@s,`s,ak`6m*ja$}IM *)Ah$Ұgj ґs ra nKranIkkkG 01gg$BAOgEL= g[*,jlrO`AkCB@_l9"k Dl"Ba`3낢44mc`3l+e`3놢44mg`3*+h4mjK`3`3@2m+n"Mh Oߧ=׻"xhzLZ`Uhuehsn 5g (L0pd j8uBa@AAAdD'E5H5Ig,g*gDgud@d"@"DdAAed *2RudDRa%EgRajUd`eYeDde`b2r abjKCxgs dglLje? dJ KGeH@nmXA"xjL HGg gj YoҀ Xa/gj g @B3s a'@L L Il" oq$@ tmkL# r!`rZ`-* Za@[* ga"gRgOajN _XgM j  * gGZXg j I j&g@:eRgaGHҀ2rajKLL gx "jL o jAB o/ " B"A`n"$e sd Gg8uB??dB d]XYV Բ @OaEgg;k$gEl>"C  nmXgV"ȲVlC5 @ V* Z'a²`n#*AHC J gg"ogO`n@"$ejh  h nmX- "xjL V*nDGRgan *CjҝjGmZ `@B2r`j Gg *B3s aL ӌl* tmm" r\`r`o*p gB RA aDGgRga@*-gPBamX xgm a "qj#  !g@:eRgzajB3sakBkl[xHoRg`cj Xj{ jGZgV` * g-gGZXg  0n@m BCX >#$ Oc2Ca7* c4` aPg@ C2xgKk' &g@:egRg`N@""jABg !"jҦ K`XjAlpPa h ( "B" h  h h h h Pg zde8uBADB.??dBB2 d@gDهAjM٣GHIJKL٬njm TX1L@Z"`JN2}gL2KeÙVgZgNaEZ`YgD`n"$eoEBGA5JDjҥAO*nogVePgde8uBI@@dg*@@'FIH2I C(`@dlng> cmgl4>   g "oR  B RL xdIj eB|AHAEgn %n%+l kLDCCaBi"@lgBKcabM#@ ajj ke 0d_>eggg_"gcagg-C aka-#akCgudjKeDgn$n$'+lF!a!&`a` lFa&` lFa&`knkdeggggg j  fer`knZXgidjKdgFgn%+! dEcab# &0 amڤڀb1dkbcdڀneCC`B5 @ jdg_gDdXecC%gC ` jrXg CF`g"V"@JZa- nAJ`* ni`[`['`$@n#K[`C @g:e@ g g@:e * *" BBaj~dgg*Jҝ BALAABAdg%g Ø zdedg   nm X jog -   nm X jog"gi giØvde2@dgCmH6X B jCude d6B@cgMj L@H0lIjjKٓ,jmJ#$e@hj`& n%&:AeLgigGAEJҴo3nCADGAEJғ O3nDC"CAFELGIǙCAL@:e*A@r`n Xeeyde8uBTB@BAAAdg$t` ggnXmude dbFgJiglꃜc`!`%gpA`+k`%K@I#l mbvdddE ;"$g+Ajmg i jmgA 7 #*n mgA gBZ8A Hal`Ca?mgD@aBJH2`Qyd j dgi&gP 5a4! Jg7"Jwd@nM J#` C`C` Cgg bZ8geqBd&ggng g`)C`C`)Cgg ud d%gnMg)`C``)Cggj@Pgvded,egPgwdI_*gpBg#I `C``Cgg j@e,A dgp%gg" `)C`C`)Cgg udied%gggg@g" /`!#BKmK@ہjvdjedggg$gg" R`jvd@iOIA`jed322h2;e3BakH2sN`s7`sL`2*B2x2db2V2n&xB3b3 n! 1c77`3-mHx@b7`3|3b6`3t3h6yygy44a`3@n x@B3@2\2mxNlkeQ-̓5dkTk5d$gx2#egIoKJag{dIj jg ҡ H  a d{+gL2I @ jamhl A aBAHa@1 BJHB)"` 4a n1*ABi Ag Б*i J jaJl" @ BgA؇ HJa edj @u abÞi  aoE jdZag Nj o"g\j oe-wd dg"jong3g*m e$dmEde dggZeg "  mgede%d 'ojn Fd m Fg `ojn 0 d gӅg gQP" jK zd j,r` Ze "jo3n *migq` migq`#7OggmigEgdgngDdd$gg` Б * udgd>eggggg fde d%ggggcaji@!Pgvde+] `dgg2 I@UW]o+#3?Qiq  !jd @g}LjejfdD.kmDkkl̓eP3Oh3hjL3P lmPjP3lP^]xg`3jemEjjjjjj j@jj\3lPmPȬتjX3AlPD.kkD.@kAkvDakkjT3QalmQg@y2ܓejKv Plkm Pj̓eJevDakgkjI_"JIXV@guLO@gyLKLjD3lQjL3lQ̓en3jH0.IJ@ mRL̓eGzjzj KȌBALǍBAAdc$ k @l%"GDJgg gr`OgAK"@Ln  j BXmAcde`AXA,ALkl*d@eDd j jeIdR`@xqd i# @$J tp2iL2JICa@xgm$$@n  /@Rkl"#IR aZY V RmI I #IRa\ RmlAdAA`AAdggg_?eӐggPgedAdggg_?eӐggPgedAdngn mgCg*l) !Pg|dgj+ " g @" 7e gAAA,Ad@c@  AH2I@j@.r.`djJl)*g5nBB"BRa mA@iLD"S aA&H2I@&RmjCcdAH2ISaRmAH2IӠ  o:nR`A*JDReD AH2In@B  eBAAAAA A dg$@%g`j@Aud `)C``)CgA)A@' .d,g@R -a*z  r aH'UAB5M@Ra!"dnCL3h3mc`a-h 21-8g4,?:1-?i,․n,ӧr4gj7p360oi @Y=j[AJA@J@ثj@AܧeAB`d@$Eg$J 2ggQ Ҁ %zogP"k@Mll@lm * \.ra@Lr`r` ٶٵRxg"h ѳْ`n"$eвK*j@Lxl""ȶ m ggA@e5m<Aj#"BXk=m Lm L1n1 Mg=eAhjlr:ad\g@ @𭥂j$gGN#q+kg@l[˙`h3 m`  Rm|d jmj je4BAAdS~cg @g\)m j ,g* `n"$eE<J#yagnUROn B]ij."B#j0m "PZ`*H2I`OJ. %Rm Ra  l]gV1bJikvI Jca $)m$n$j LOiUR"* Jrcjd K8uBA B4BA$d4.%gG@J ndm (X)bIRa`()dlg*g KRg `JJ "oReUVRg qd jPklg *PnԑLPkklPAgB@KL2Ic`@ajuaBB`CLn"iSag@5K8EgB@KH2ICZ`@BgB@KH2I*("I (RmJc0` 14gAjN#q+kg\3`h4〛dCoN#mjJҢJ~,ABA|AHAݱ@A4B`AAdg'g-@Pg|dj  n*@A  jm  #"+@!   gg,AAAdg 'g . @Pgxd # "+@! ggAA"`Sa%j@ AJKA`ܠed3jn;e a/2d fg `gXYKHaeFgIg#gB dg m% g *gOgdd dgm% g *gOgdd d gҦg n*)%}dg% m   Ҡz " I0J0a 2x i ygOABlBdg2 * m)  "kJ   *jK|d* j   * a @:eRa ` U m% A "e(B,A8B0Ba<# dEg5B1amgn=eBaRg`n6u`a`D2K@3dgO 堠-01e!gNj@AeB$dgkg =np !"jl" ydjZ*]`g % "RH m *j" wdjZ*,dX` gg%OP"Nm e@da!ggБg *E!k@jvdjedA$gg "@RaA1r`2r>`j@A@A61lgj`@JAQsJ@-`Xsa@g% @ra@raA` i@r`jl1@@AN j mg % xd1lgj@g @ra@raA` i@r`j@1l@AN j mg  BBX| *nXe|h6g"RjK0}d{D:e"`Bd2iHH2IjC@aPj l [ `SIRg @pjl*@kPl@*mgJ"A@kmAQN@2@2aCOXgi nm@X>?DEI>Q{HDgBK`d2iH2Ijc aDES>>kghڀAKlAi2A7\`"{DgBK`d2iH2IjC ai|A}L@k`+s`#gBKfjl@" n!vf n!vf@ kl`"4gZ a nm&X&jtmkL@ +jK@JKrkaCggB@KH2IC`@`TV2P2Ja@RaĘgkkLZҠ`T@"@mBj$҂joN""U%"#"#Mn`*U[gK4TB@HH2IC``@nK4 HK4g>B9M gA`!"ԣgjL` ,gҩ#m@_@_PKqCgoҋJ Hi,JjpXgg nA >҇BA nLԑҠ(!!og!!gggA (@pjl*IRcagggm"jg.)fIR aҡRmW`jXg_j.)fIRaRC`a aRmIia `j񐫌 "djl*! e!|!$!kkLYs` r`J "xBb6g"{n!gRa"IRaRm@."Bk@^lKB2@ $J nUP LJS!* A*Ha ja AH "T amA44졚 @m҈2H2IDHISG@djl*`aUVWX &"#HFVHFW>gk@^kl@km@^@"Cg Jg3HcdH2IC`H &a@kKl"`tjLH +`r+{+=:dBB2^2nkl"H,gr`r=`r>`iJ  JҡIR?alBB2^2LH ֠` ա @m҈2H2IDDEHIjkFGA" $k@mBB2^2l?kl@~m@^Zm=hPqm*?*nURgh@^L 0ZUgj>NKgg5g n"on6gmDg "&ngBgrgahn " %&n6gmDgnA" U@"G@MJgmjUnBOgRgZXgrxgiB J"eAgo@j"eAgy@j"eAge@RR` RJPB@HH2IC`@HK4K4nv4"eAg@j"eAge@6g ggP`*|e@K"DgR`#oR䶶Rg4gg൐g4gACۀA kl"۵4ggB!*ص4geZga*"eAge@ϵ4ggZ`nmC>ggjUҿVoҽҀgtkgnK4gv4g#Cg"eAge@nm"eAgϛ@K4nJ"eAgA@tmkl,"\1`v4e"X `gnjmv4gg"g\`v4e TJKrka7?*gm`lCg*j*Qm "r`@~RLe:"R6ayy nU&'-(u+ Plm*pmRa nUpg ra njБUZXgT*jccb@BЙ@Bdjl "Ixggij)f.IRaBXB\gLRm"eAge7@r_agCRmBAAAHAAݸ@AAPAA3Baf@3@AxAy3@AK@A3@A%L@$A3@PAAtAAlmBpmB3@AAA A$A0AA\A8AHAAAAA$AA A@aZ@d@~c"$J jh$g! "AҋjP|JDB@HH2I C(`@gz jogP"PR` "IRa stR Hj B`Hd2iH2Ij C-a "@kmę@mXgS"IRa_^R h@kkl@cPgd@gj> ҢggQ %" AgB@KL2I  c` @{# Hnhe " Wnj H J "i *@j "Sa2@l@Sa -Rmę9&gRga*0EgIRa "Rm!\e \eH0pg@`C`C`c@j\̑R ,le3BHAqBXAAAAA(AXAABBAAHA dDgb $gh6g "@^^RLh Pgxd6*@ljm Bbg +p#BkL#hnbg#`+F2 K*Lg"hlkl*x  '(Bkl6*@"Bkl*JL 6hg( 8@gg|JB."g mgBK2H2I(C`ta K ngEK aC+` Xn@AB@HL2I:eYgC`[L'D2H2IJN KHN$@ݐ Վe3BAHAa:@qBB$A"g@:egZ8gAȘBg Ai E'B@ID3IH2IC/a@R4aj{+B * $eGC`Jh3mc`J`Cᛰg@?ei@gBAi ICgBK`d2iH2I C'aDgBK`d2iH2I C`@ Jg-EgB@KD1E(1%#7a Jm`HR2rPgggmPGCJg-EgB@KD1E(1%#a Jҫ- J- Jҽ[}M{`r+`z`r1L_ *lncPPEgBK2H2IC?` KjD}QPg{dh dZ@ QDgJ @ @ JQ Jn p0a 0`ntAX%!g` |Ao@@;g!"+ p3 l3mmOB2R mhi"J#`i'jKg[X*}QHI lmtʚ; mp9;* i+y\ IRa P2i L2I  X  R$LQ`n"$eQg {d8uBAAAGd@?eDded:eDded:eDded:eDded&gh#` R `"|e PgudAe d|g䓀n N  "l: lnAd_c  ҡgҸ@ ցҀH@ @g{R A@ "Яn j A@TOg"oRg ңARL=h `n "$eHASmS@,B@gjC `SSMj@H@ !"@҄EjS↷,@gjC `SSMj@H@ЀAjmteRCa,*@m`m`m@YTB@BYTL@BYT Ldl("a:e@` YTg@YTL@YT L@Tmg^J*|e oRg OKdjlw*kBl4"k@l)"0e CPg*BB. *AA.e*ng"<<Pe"Pkl8"8e3"6ARa m3e o/0nR`,oggjL( m&e o##nș đNTcPgd8uBAAHAAAA AA(A0ADALAdA@`AAAAAxAAAAAARaŜdg&D:MeN #RajKa+Addejdc;g\ h"B9n @e"gJ ҤgfN*jØdlNl "|e@ra IJa R `A*|e@KAj ҂T aTeR`A*|e@KAؤ!%\*ƘfN)ØNgR`|e +gAcQgdj "nHNAEdIZ$gga;e*Xa :gN" RajKa+AudEBL C` C` ` C gEjejTd&g@A`GD]J<*  eRg'a`gRagp"gpgC3Ja#Ra|ek`Tg|eTgl@Azd Dgj@A@3" d$g1*AH nԑg`d2iH2IC a(21wd H ggg2ܘ2eŹ@Tdg`GD]J*"&g gR"g`|e Pgwd0gR"ganogg"B@~?jLh2iH2E{@l "hHne*hPgvdedg@ABL@BLdde3Bdg/ePgvd'g`@GR`al.*@M!c`Cgmk xxLXh gXMg3B dg&`a@lC`g >n"g@" A@LMX`C``Ce@@gPgudDdgGR`=hmjP@ "7)`mhl"g @"TUVE A'"AkklAb@ Jb@ BpPBIcxgBt"hBP"@DA"H؁b@ۥ>nDQgvd3B@dJ%g `n1g >nHQgudAdL>_`BG>]Dd@jed$g al`Cag?mg@@J@L2Q Audvd$gg7a%% A?RҠkm B`Hd2iH2ICa ,g?Re CRM ,gA)TL xd gQl l" g ?l HeA3B%@A@ggčB3B d@YDgJ@%g @$JDgJ @ Bz k!\L#kkl ԛ\Re@/r`pg@D*n g"ng "Ēg*Ēg/"IRa Hag T"@ nԑL t 8Ҁ*T@ IRaRm@AҀO ƙ4B ] AB5H gJ $%7gRg aj"k@_m@_IRa (AH2i'&`  "$e ` aTlnZ\gbglm\JJra)mG@IJ'On>mTj"Jc`PT@"@M3g* " JaCdؠtd jFjgJe04BAkLdg#+kmAb"@D"nm>"@"D,B"D@DAn *" nԑL"@vd蠙j!Ie@@klO"db6gH"CegB@KH2I j c,` [{l#*`Tkl*`R*Pqm**4gZ` bgR aK4nRaJ"v4gwd蓘Hnj j mPi*𐘀@/<mj" gIJ#agj  n*Jpd,Adgg>mAjBdd3Bde A%g "g3@'AkklAb@pJb@BPocBTgBpBTߴ'@3LGEJ2I؄c`J@B L@BILG@MJgB G@J$eJ n*gBwd d @MҀH&*jH؀LG@Jgxi@@AMC@:eR"g a@@1NmLAE*i+{L!B,qie#`JHjL؀Hqic`i^L'@rEI a@g1L@YNmg@@ng  @jPURePu"Lrqanm(XBAAmEL=J"g=gg1D*jmnAE@:e"gJB! M`nK"$e i+'@mI@gYLngURng mgm" ""mm"g*RaP]gN1I2€LJL؀Lqic`HCiQg yde8uBhB3B@dgƚ&7eAdd@3B"ddLC "dDgI dBӀ+Ee@,Be@Be@y\e@Be@Bee,e@$&Ee@Be"@Be@&Ee@&EeB@&Ee2@&Ee@&Ee@@ L@L@-L% oYnMlWؓTaTeTaTewd蠚mDlaQg,Cn3Bdj ( =='g dB (B@HL2EEZa5n55Xe$ @g Rg aL2xJim )M<J*$nԑL@L2xJiĚ%&@:e*H#aj'BI 0 ahB ard聙I 2IHT3B t3BLBXB Aչ@P kld,D*g- EgP kmPQgwdMMg 5g@ A:ra BONgQ֐"r|J$a*( A>Mg fq`gQ^`Rq`SQ`Fq`Mq` @ejl " j@Rh*(dZq `aqa " " m%:m % m%:m %m%jm%ր" % J @Q  4 Msa ETrq`sQ `gq?`qqa m%@\Dsqa 6?kL@l@^m@^2jejKko:e &` I@sr `tRz`Sr`fr{` @El|*OORjKnf * *ECR Bg'iKE^" " 5g @D  @PmB K" @gC"1% u a@_kl" jTm11B@ oQNPxra@_m@^g@^ J k@_g@_@_FiaiRiZi0}de8uBAABHAABj dS$gaLp0a 0Egrm#L`tAXʙ Eoud jKedj]g aEgwd&g pg *@9eRg`gYgADR{a dgiS*Qc`ggvd C` )CT g @/)@D*ØG3A` g:e@gR"gaB`lO-,iA/ - blw,:eؠ@gR"ga@)AؠAJ`"`"g )ҧ`C`ja#DZgmked&gGg."mgudjedD2*"A/[g!ajLexg IAbgg[g@?eRg`*mg ceN)jKAvdeDRadg%g@aO# `MGg"RajKude@adjg&gaMGe`AgN $ kC`DgaM@`judDRajKedc$ %g L @ %"DgJ J/m ;" kaB z$$ <2 hjlr`$jl* Hn"|e@r `K#cPgdkșj r@` Zt`r`Z`r `r `j$ jl * ƙ ZșjgNj"  "jMhjlr"`P"@"  R aPgBK `d2i H2I caThjlr`Jk j "jMyr`ra gR!ajJj LR`|ep` Wr(o m Rg`|e4>eZg?`$Z1`DEj _ Caj"a C` wxgk*U`$vG""aB+K+#a+Av4gRg?` Hn"#ggK4Ra  C2cxgII Ҵ $"/mJJg &" aBPggz"$$ <2g j ҰglgR`gk$jl-*Lm h $@jl"n * šj\R`jM J jM h"eBd\&aDgxdxg+k*U` vG * C3Igeg%Ca*aCaPghi ee &dgĝxHgYgdd jedg@* XklbIA@ʘFg"xHeDRajddedjGgZ"g`@ i@Qgudgge` db2rgga&lr?a%cn=*c $J djKg6"gjn5g8*b6e*"`Tkl%*Z{lZXggo Z"g!aJ" A s`?S``_>m"gGR8`_>mGR2`_>mGR,`_>m GR&`_>mgnmX %@FG H I KLMNOPQxdqB3Bdng%gLXmEFGHIؐg}Q ud3BHEJ4Zd g`D3 m`ie!iGqa/ e8gC "jB A J A P A O A L A KDo NgP "AkmA`\m`\AkmAjudDyM%  m% Tuت m% RsأDoNgP "AkDoNgP "_>m A M؂ A Nz m% Vws A Qk m% `XdM] a`\km`\AkmAAkj jKeDgegd`eDd訛gr`knZXgjK@J @ЍBAdgg3QE'B`Id2iH2I Cawd@g3Q IedEgJ Z&`$g /kbA@B`IC``ICi1@EjBPgvdNjKT`@DBZ`D2I@ ideDd@B(9Bd/mg"BPgddNdMgLkL#%+kl"|gLkklL@wd菖m  Kba L   4g|ggLkmBBdBAEdg%g"-MgLkklLmMg$gMvdLkl"|ed^c`2IG`"@gDbgjJl`* $JQ6Ҹh@An@Axij tmkL# P2i L2I Țxi J TCaj jl%" 6gg"j [o5g* mIU??@}i [gA[gxiB jl"!mIUCDC}imj?R męmgMCRgj jlo"?R"mEIU EF}imjACgB@KH2I  cN`@AgB@KL2I  @DgBK `d2i H2I c a J ca J  kHl* "B" Qgkl" $ Kl"zC`ZD gg@:e J jB * lbgKmB2cd赲 l_"mIUGGH}imj EgB@KH2I cA` jĘ["N@DYURZBB@HH2IC%`["NZURY @[BIxiJ R a @dCgBJ ik~H J һj l," T@("mIUKKL}i Tj TB@HH2I C `zMMNxiHjm l<" kJ B IH$KJ a-#mIUOOP}i m`#MJ a\j[ @ "zQQRxi HJ aj @\"N l"mIUSST}i o@ܪjsi V@"B l"mIUUUV}iCng ?e@ﶚ9 lB"mIUWXW}imj j0 mYxiZ @^R` j* m[xi\ k@_l" j$ m[xi\ k@_l" j m[xi\j k^2l@A |ABAB @""cXBm*j@H"WN@EM@:e*Akl*  *jW@I ]Jң@ MPl*h7B1ADg$d]gDd jedD>cg&gm\nXcŲ!'()*Bgm, jkBc@kL#`+jkBcطL7"gcQgd豴m"zi+kgl$kӪkl"GAJ@H2I $ C6`@gz o2gP "R`kAl" B iLR+ҡ234jJAkl*mgXg"g&*gB@KD0A0`a+ Jmj2345672@:e""ggC?Al*d')GAJ @ H2I i c_`@ j\bjl" @/ra 2h "@:e?*j\@klH"j& Gn2   j`P@B rBaaC_*&]*7ւg"`\*@:e*&*I J Ҍ' ZXgr Xg z& QP"Be k `™7"trBA3BBHA};ABqB BdcjDGG JOB>erF` rF`KKD%BCgoAmjga)C}`DgCb` Ҡ)%@nԑLjB@HH2I CK` Az5MxiHjF..9%-nԑLj'B@IH2I C`#nH aI@AIg@`[`Kn3]gl3keVgZI aHcK`n~"$eoH@FHkl"ș@9agHHR `oRg@g44RLVX|m*01X|șA*!O@geJRH;aJjJgB@KH2IEjhGEhC`@ jDƙ_gMjgHJHj|XsxgOmKmgB2LhHexd8uBAHA3Beec/@"d&gnK4gRjKa oggtklRanK4gC2wd jAAdcj,g j%gm  @joNm " jm aCz5M jm H I@"jym I jsm  kҘZ"jmm  kИZ"jfm N j`m M jZm J K@"jSm  !K L@"jKm" #L Tum"jCm$ % jԘZ"O@"j;m& 'O `P "m4  j`ШoZ"/m  .A*jKAلjK)In*,[ggK4 R`A"jmnØag*Řag*Ęag*cdjKAeBBBB B$B(B,B0B4B8B<B@BDBAHBLBPBdkTgL #jmk %kl"jmkTkl"DD6#^a Xn K4NTkklTedeAlB$7BTBlB(rB dkTgmTbm km kkmTkmTfd jBBdkTgmTm&gby`/R`-r`jJ Z`@Z8araj@رg,dg{R``r`@Z`jDإj@AJA@J@xd~ra@Z`ML@ـ O3nD"j@Z`MLـj@Z`LM@١ O3n,ج@hr/`iR`cr-`dR`ar+`br+`jA؛grai rr$`sr$`praT"ai$3maAd3iN1]  *!ji iiiiii i@Z`jmg % _"jgFBEBBdg mhl"mlh"gҀ"HgM=F gR `|ej L  `"T oB jC ah A2Lg0g` lJgh D" pg N |e T ܒ  T i"Ē" >"j  o ܒg  Ah2L  h A2L*= !GQg~d h i+eB5@d Jaud3g@2Lgg ejKLL \%`2 I@Q'C3+7;##??/ eABBABBBB,ABBdj,dZaknZGd Xgpded`H %/j@/j=ji,d j ,d  JbaX`p'`X`(*`p#`jK r`ggR#`j~d@0r`@0ra`@c5C4 mlg.Caa.c`j*pd   pd  Ҙra *paZ paZara Zaaejrdg`k2lgfe ZXgknkl knedjed"g@A"%@=eCZaH3qL$@on MgB`QgwdJied'gb`eRganԑL@ngB@KH2IC`K``Pgvd;A@d$m  g #m PgfdB,A@ d`E *!!"X\nA$g`{+Kh3i( p%` K@E@:e*aH2I` #t`a+`@%@=eBJBwdDgEBBBdg *%@nyd xg i w Ra BwI 3B2J2M0q 0a(3iQ@aK + @n ^x@neA@F:lBBBd&grg `r`r%a@nggLkl)fgLkl" g @mg@!PgwdeBTAA don$gԒg*jud gg" gfgdc$g|g@r`jK!cd/mg"J` B^`gd nvfgRa"ggejd"j"j"o$n  ` #JGd  BBBBXA,AAdg%g%*``aa@A@"jvdjedg 8&g n n n!@@ oL "gYTg@YTL@YT L+pde0uBd&gn "R ajFdgnNjKe$B0B;d@%gcg@*8$m*4j@/mgZ"JX`+aB[/aNjKAcd)j@J()@@ ggf *Bo Rg6`|e@ra Hjar` n  Bo eRgaj4>Z`B$c|¯jB8BBIAT`GD]J" DgdfnDddg@%gPg`G@]J"Pgudgfgtd@a'`T `h p`L($gt`tagRefdgReg g ge BBuBHBhBBB %`EkL+km`EJJJܠ@dD1EEH(1%#audHkl*@h #ZJ1Z*@%X HegDK2H2InCa舣,$M K`Dkkldg`DWEgB@KD1E(1%#a Wgvd W J `dDgkᝀfeGd jgD2KH2ICa` KF2H2IdšÚD_>BDdedg@ @A%]g@ n  oO#$eZqd Xg8uBjdg@Apg " gDG"gR`gud !@edg*agg "Xagwd 1%⇙$eH 0@Gdg al`Ca? mg@`AC@d2iH2Q B C Ddd$$Tdi,rgag l*JklkmlJ16g@WN%wd8 B0d$g ԑ j" R`jT /`0qdg`"g"jgT "`6*6j a7ja:ja;j`j  mMmD@+@7e&nԑLAkmADgB@K jja@zd H2I@ &!jL!FPR`j mWj mWjFjmW&A BAdcj^ 8 `gg bgR`a'@@ *V@"jm 4 5V`*j߶m 6 7@\"jڶm 2 3 j@ܨoZ" jѶm 0 1@^?i, "jͶm . /@~,h2iH2IК jm , -@~jlC"jm * +@^R`jm ( )@_kl"jm & '@_kl"jm $ %@_kl"jm " #jm   !EgB@KH2I C`jm  Ę "N jm  ֌Ř@"Mm5  In *8[g j%K4eRaj 8 B'B@IH2I C`kLl*jsm  ֭@N  jam  h˜@"am5 LZacjm  Ҍ14@gN "jMm   Inf*8[g c-jKIH2I LMn C#`@K4 R`AR`a]+AY K4Ra In)K4ngBK `d2i H2I /#g C` * `j6 m(  7g\  Imn3mnK4eRaj 8 I8 J K4nRacde,AA B$A B BA`BdA BčB BB BA Bd|c@dL@KkK"X|m*'jkX|4>lg@`[`Kn3]gl3keVgZK aGdL`n"$eoIjG@JEH@DvLIJHIh@H2ICjGChC`@I@/r `AeM"GAeJIJAbAMNhZZJKR" jgXIU"ijl"AmIU-LΙ}i֙xiW"ijl"AmIU5LЙ}iؙxiJ "ę_gj!jKٍAmIU=Lҙ}ij:mSxiJ *67RGJGHJH~2@RaX"0Jj0HaI?@C =DHOc2Ca8*c5`a=Pg <@C2xgKkGF @:e" *Y< @Gj! gxHoR" `VKH jAX_* nGrg"`ude8uB3BP BX BAh Bd Bp B B BBdg%$Yeg nXmvd,2G,3i‚@Gi*IDCae@iedg$gml o&Z5agaH Aam@ABR5Okl *;gZ a iR am<&"j˜ l&*aš"G@Jl ##ҫ !$nC2J% $nm@X `Ug1  GA oJ K҂g*F lcde8uB)rAAHADA B`4BD dg'g "` +R`aajKyd A " @iAjMGgg"R` g@A`Aak@BA@e@dh@o n$J mg4ao@nРm4gA@ F"klr a @kDl*@km@ "z"n #mX nmX jt Jx Uـ| `}񈚠t~٠xqjlr^aLX*LnZxg ml3h2V2H2m m`m @,o L*T"@ @@kl"} jm] $Pkl* Fbgjl"H2I C`z  !84Hk qjf3L k!lPF2l`T2m@P@*jm84ր@ km@jҀPkBmayUր@kl* kPl " Dbgjl*oaԒnZAxgl|3mꑙAoAԒnZlBxgmBA[lxgLd3mB`!l!n E*PlR3ategJ-"(P B4ؓe*Zg `FebnL gR`|e@r`Ljl "A OB2m@ـ@kl!*mR wanLpgRna H2RgT jNk@kl @= H kFl "Ao! RgRH` kFly*|e oR Rg0Ee"eAgeSA$mZXg@2\2m mB3ol@~3m@~hhmR1` G" IRaR(nmX@ (ҁLglI mRalnLl ?%A Fe jPۀLn>m`Lj* ggS@T ҀaPkm P(3"|e P}`jmA l0 j m!l0ҡjm!l0ҡ M<9lgjl%lg%lg%lg%lg%ll$Alg%@l# Yfgk#kl"QoLg "jW IRa   R$L@kDL7#kklD=lgj$X%'` >e $%&pg*L&'(p/n* mg5 Yg@pkFlpr`j @@ F6 g gR `|e *B@@* kFl " ltm~m^ kJr a Fbgjl*@k@l"b6g "*nogEg Fbgjl`*L h_B@HH2I C `z&&'oUHLMg?"g " D" oL*LjaMja  g` W"Y"oLj jMnl"jWh |e` lP*s`ke gRS` nvf gRS `@fjl* jKS(@)Lg.dl @ @@M @jlr* Lf*` <egb*LM.4o(@`(P)Mg jl!* * n@Eg(bB#g* Fg(bB#g kl** gJ#" mAAÀ/ne(bB#gT   *h h* gonJmgjK^ٗ |JAB@HH2I C`z($% Uojn$(LfM*H FbgjJl* ( ʹeIn  ǶE j dmgneI@ l$Jmtd@jl"j P2L2IlRL $lv+kl" orKn J" *\J\ P2iL2Ilrrj ҚP a n7LggֲP\aoLg j4X(3O` nmX+˲g)) K*g@* >* p3ひl3mm򒣭Ûm{ @pp#g$f3Jy Rݚ n\L ([)#*h P2bL2IlR" @J@ " ZmZӝdlj( |XJX IRa ] oR>ьmR J J J < TCaRm FbgjJl*\"Dg1z{7e.b6e " Fbgjl*t'he@kkm@AkL # iS akl""iiERAkL # iS akl"`a<R hPg@xd\e\[h Z"eAgAW"eAgeA`wBčBBxBxBAA BwB BBPA@ B B B|AHA B B,A@@ 4 B< BH B@u%AT B BAABnum_bucketsptrschema->kind == ADB_KIND_ARRAYo->schema->kind == ADB_KIND_ARRAYlib/apk/commit_hooks.detc/apk/commit_hooks.dDownloading %d packages...download(%*i/%i) Downloading %s-%.*s%s-%.*s: %squery failed: %s%s policy: %.*s: %s/installed %.*s%s%.*scoffeeGo and fetch your own coffee.fetch, hold<%s> Package: %s Version: %.*s Depends: Provides: Status: install ok %s Description: %.*s License: %.*s Installed-Size: %llu Size: %llu %s %.*s %s-%.*s %.*s {%.*s}{%s} [installed] [upgradable from: %s-%.*s] %.*s <%.*s> %s%.*s (%.*s -> %.*s) %s%.*s (%.*s)%Y-%m-%d %H:%M:%SPurging %sWorld updated, but the following packages are not removed due to: %s:audit does not support usermode!%s: relative path skipped.OK+etc @etc/init.d -dev -home -lib/apk -lib/rc/cache -proc -root -run -sys -tmp -var unable to read protected path file: %s: %ssynccleanpurgebad dependency: %sUnable to select packages. Run apk fix./bin/busybox/bin/bbsuid/bin/busybox-extras(schema->kind == ADB_KIND_OBJECT || schema->kind == ADB_KIND_ARRAY)schema->kind == ADB_KIND_OBJECT || schema->kind == ADB_KIND_ARRAYschema == tmpl->schema!"invalid object field kind"o->db == no->dbmipselapk-tools 3.0.5, compiled for mipsel./etc/apk/config.apk-new${arch}/${name}-${version}.apk${name}-${version}.${hash:8}.apk/etc/apk/interactiveapk_#APK_CONFIG/lib/apk/configconfigcommand line'%s' is not an apk command. See 'apk --help'.noarchTERMdumbAPK_PROGRESS_CHARLANGUTF-8█etc/apk/cache/usr/sbin/uvolUnable to open root: %s--usermode not allowed as rootUse --usermode to allow creating database as non-rootvar/log/apk.logvar/logUnable to open log: %saAPK_PATH=/usr/sbin:/usr/bin:/sbin:/bin Running `` at %s Failed to open apk database: %s%s%s%sOK:ERRORS;%d unavailable, %d stale;%s %d distinct packages available%llo!!%.*s%s%.*s%s%.*s%s/%sSkipping: %s %sExecuting /%s %sexecuting %s %sExecuting %s %s * %s-%.*s %s: %s: descriptionwebpage%s: %.*s %s-%.*s installed size: %.*s depends onprovides%s-%.*s contains: %s%s%s %s-%.*s triggers: %s: trigger has auto-install rule%s-%.*s affects auto-installation of: replaceslicenseADB block, size: %llu, compat: %d, ver: %dsig v%02x h%02x %02xdata block, size: %lluunknown block %d, size: %llu00123456789abcdefghijklmnopqrstuvwxyzQ1packagename([<>~=]version)%Y%m%d.%H%M%S%s: bad package specifiervirtual meta packagecreating empty virtual package'%s' is not a valid %s dependency, format is %sunknown%s%s%s:%.*s %s%s%s%s:%s %s%s%s%s:%.*s %s%s%s=%.*s=(%d bytes)(%ld bytes)disk space will be freedadditional disk space will be used(?)InstallingPurgingReinstallingUpdating pinning[APK unavailable, skipped] ReinstallingReplacingUpgradingDowngrading../src/commit.cNot committing changes due to missing repository tags.NOTE: Consider running apk upgrade with --prune and/or --available. The following packages are no longer available from a repositoryThe following packages will be REMOVEDThe following packages will be DOWNGRADEDThe following NEW packages will be installedThe following packages will be upgradedThe following packages will be reinstalledNeed to download %.*s of packages.After this operation, %.*s of %s.Do you want to continue [Y/n]? Proceeding with upgrade...(%*i/%i)%s %s %s%.*s (%.*s)%s %s %s%.*s (%.*s -> %.*s)lib/apk/dbetc/apkRefusing to write db without write lock!etc/apk/archtriggersscripts.tarscripts.tar.gzetc/apk/worldSystem state may be inconsistent: failed to write database: %ssyncing disks.../proc/2/stat%d error%s;%s %d packages, %d dirs, %d files, %.*s%s %.*s in %d packages/proc/self/exeIgnored invalid preupgrade dependencies from: %sFailed to perform initial preupgrade, continuing with a full upgrade.This simulation might not reliable as a preupgrade is available.Preupgrading:Continuing with the main upgrade transaction:APK_PREUPGRADE_TOKEN=laiNgeiThu6ip1TeAPK_SELFUPGRADE_TOKEN=laiNgeiThu6ip1Te--no-self-upgradePANIC! Failed to re-execute new apk-tools!Not continuing with upgrade due to missing repository tags.../src/apk_defines.hnum <= hdr->numnameaclsizemtimetargetmodeuserxattrsversionmatchfilestriggerpre-installpost-installpre-deinstallpost-deinstallpre-upgradepost-upgradehashesoriginmaintainerurlrepo-commitbuild-timeinstalled-sizefile-sizeprovider-prioritydependsinstall-ifrecommendslayertagsinfopathsscriptsreplaces-prioritypackagespkgname-specpre-commitpost-commit${}BKiBMiBGiBTiBsha1sha256sha512sha256-160 %s: %sworld[%s%s%s%.*s%.*s]%s-%.*s[%s%s%s%.*s]../src/crypto_mbedtls.c!"valid alg"%s%s%s%.*s.listuvol = .SIGN..PKGINFO.INSTALLDESCRIPTIONAPKINDEXuvol(%s)uvol(%s): %s: uvol run exec error: %screaterowriteremoveupdown%s (virtual)note:please select one of the 'provided by' packages explicitlyprovided by:%s (no such package)required by:alg != APK_DIGEST_NONEdctx->alg != APK_DIGEST_NONE/.apk..apk.replaces_priorityfailed to update directory %s: %s%.*s/tmp/run/uvol/.meta/apk../src/database.c!"invalid layer"The repository tag for world dependency '%s%.*s' does not existNot continuing due to stale/unavailable repositories. Use --force-missing-repositories to continue. (not removing)%s%s%s%sAPKINDEX.${hash:8}.tar.gz${name}://Repository %.*s has %d packages without hash%s: %s /proc/self/fd/%d%s: process init: %sAPK_SCRIPT%s=%sAPK_PACKAGE%s: fork: %sfchdir0 %d 1/proc/self/uid_mapdeny/proc/self/setgroups/proc/self/gid_mapproc/procdev/devunsharechrootexecvefile:test:%.*s/%.*s/%s%.*s*%.*setc/passwdrootetc/groupsatisfies:breaks:unable to select packages:error:uninstallablearch:depends:provides:install_if:masked in:--no-networkconflicts:Huh? Error reporter did not find the broken constraints. %s-%.*s: ignoring malicious file %s%s-%.*s: %.*s: no dirent in archive%s-%.*s: %.*s: no hard link target (%s) in archive%s-%.*s: overwriting %s owned by %s-%.*s.%s-%.*s: trying to overwrite %s owned by %s-%.*s.%s-%.*s: failed to preserve %s: %s%s-%.*s: failed to extract %s: %s%s (dir)etc Installing file to %s%s%s%s%s-%.*s: failed to commit %s%s%s: %s../src/io.cctx.index < ARRAY_SIZE(source)lib/apk/keysetc/apk/keysThis apk-tools is too old to handle installed packagesFDB format error (line %d, entry '%c')user.failed to read repositories: %s: %sADBfetch %.*s%s-%.*s: unable to cache package7%3i%% 8,../src/serialize_yaml.cdt->nest < ARRAY_SIZE(dt->flags)@...7[%s] * failed to prepare dirs for hook scripts: failed to execute: %s/%s-%.*s.%sdev/nulldev/zerodev/randomdev/urandomdev/console%s-%.*s: failed to create initial device nodes: %s%sExecuting %s-%.*s.%s%s-%.*s.%s: %s%s%s:%d: undefined variable: %.*s%llu/%llu %s %*s%.*s %*s%.*s %.*sexited with error %dkilled by signal %dstopped by signal %dcontinuedstatus unknown %xAPKINDEX.tar.gzPackages.adbset-default%s:%d: invalid option: %.*s%s:%d: invalid variable definition: %.*sndxv2v3%s:%d: unrecogized keyword: %.*s%s:%d: invalid url: %.*sjsonyamldefault../src/serialize_query.c systembroken-filesbroken-scriptbroken-xattr'%s' is not a valid world dependency, format is name(@tag)([<>~=]version)*%s*?*C: P: V: A: S: I: T: U: L: o: m: t: c: k:D:p:i:../src/serialize_json.csizeof pad >= 2*dt->nest"":dt->nest < ARRAY_SIZE(dt->end)sizeof pad >= 2*dt->indent- #%%SCHEMA: %08X# %d items# empty object# -?:,[]{}#&*!|>'"%@`'|pkgnamepkgverpkgdescdependinstall_ifbuilddateprovider_priority!"adb error"ustar -r-----BEGIN <=<~~>=>~>><? hash=../src/hash.ch->ops->compare_item != NULL%llu %s%.1f %s%#llo owner permission mtime xattrs%s.tmp.%d%s.tmp/proc/self/fd%s: unrecognized option '%.*s'%s: ambiguous option '%.*s'%s: option '%.*s' does not expect argument (got '%s')%s: option '%.*s' expects an argument%s: invalid argument for option '%.*s': '%s'%s: setting option '%.*s' faileddatahashvar/cache/apko->schema->kind == ADB_KIND_OBJECTi > 0 && i < o->schema->num_fields%s-%.*s %s: %.*s (unknown)././@LongLink-X1 g:q:f:R:Z:F:symlink target owner not found%s: Could not find owner package%s %sis owned by %s-%.*s ustar%.*s/%.*slinkpathSCHILY.xattr.APK-TOOLS.checksum.SHA1wget-q-T--no-check-certificate-ODownloading %s-%.*sfetchingopeningopening from cacheupdating and openingupdatingare not installablemight not function properlyInvalid open flags (internal error)Unable to setup the cacheUnable to read databaseUnable to lock databaseAPK_ARCHproc/self/proc/self/proc/sys/vm/memfd_noexeclib/apk/db/lockWaiting for repository lock+etc@etc/init.d!etc/apketc/apk/protected_paths.d/proc/mountsrootfsUnable to find cache directory mount pointetc/apk/repositorieslib/apk/repositories.detc/apk/repositories.d%s %.*s: %sThis apk-tools is OLD! Some packages %s.The indexes contain broken packages which %s.verifystatssearchupdatequerypolicymanifestlistfixextractdelauditaddadbdumpA@@Iz@LApBTABXAppB`A0pBA@pBhA@pB B BEH@,B4BpApBxApBApBALBLApBAPpBAppBEH@dBlBLApBTABABpBTBB J@B r@H@ BpckghBpBApBApBApBApBApBApBApBBLA`pBAPpBA@pB8ApBXApBApBApBApBApB A@pB,A0pB8A pBHA pBTAppBhADBADBADBpADB|ADBAppBA,B\BB hBpBEH@BBEH@hBEH@pBABABAB`AxBAppBAB8ApBABApBB8BHB2 (kthreadd) apk_solver_commit_changesetAA>?456789:;<=  !"#$%&'()*+,-./0123>  ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/AAAadb_wa_append_obj~@y@BAAA AAadb_wa_append_fromstringindxBidbBpckghBadb_wa_sortadb_ro_cmpadb_ro_cmpobjadb_ro_objadb_w_raw@)@q"A_apk_array_truncate5@@}@AAA$A,A5@/@@@@ @ @isAqA<5AiAAَA AAQA\moFg b -{񌼲g Ėkdؤm޺Mn}8dTWSU߼?dz%}hzsw5xoÇsxݚZm 6Vy/ROv 4e H`S$UQ3ѣES :_|0NSIhOReat]T[XUhvD\@j/L/uJ^AnT`TR-܁ <( 8 +B/5Kj`J- x8kC\Jx̳"I1wv4 o_+aM"g`CYv Fƨ'mDVKXd毭|j3z'uS$}f@s@JܤZv~L_ kF ؠ &za'pNp>gŦL*S*ƨRhfSҶ?c6ȩ6wkm,bT$s>9 V׺K(UX'E:M9]5:UqcTu Pc$Ma0ၐf·Vi>, }CkYT$ S+PHuhި4j`u?N4=gn6񯯸_^F6hV~~cQe_Qx;ܟDэdh$۝GģhԤ')^ZvO>JṎeSԳ6_ 嚸wP nw17Ej9YP CU# 0`JD15x*1؋-E=/OeR'ĤHD][̛CMuuyhZu"i fCa=& 34vrR'g#R. UB3`>Y+ 3AD7anp'+FDPGI0SGDf['z@4?` &6LhAۻ)YIyXNb`RF`THȦQgJ!?1oRFE3(!#E-PeS34ԅQ&Y| N6*m{%GG'aH•@q):M GF-尪gz])s`]b8 )`4:HL{ЙR 2o9FnUVE ))s_Eof7Fv_D>nǎ  UBg CGFC~ py?afE\5heoEm3d^=*(F[E$lj);F N/h$ &M~{]1u\IY"[0#BOAfM2 RFz -|8I9+XbXR[9پ%?$]-Ab[8?Ciq!aC<2h";ēܛ`m/ϓ-;ע-l|jEẒs |PRpU h)M:L*u;qt؀MPڋ(i:b|AgB{0EE\6HPp 2+ lq``7I࠺mZsfOLedzw^;) WPZ41Y43mןlWЩ6EI[m$9N];V ":_ ~Ib; _G`Vf6` Bc+i} tMQ5/vF‡n1a*zYaA3D r28=K*9\l[=tp Y/t XjbcT֮rmU= &n&揢x5d}\ *?YERt8HzCMTiS?bOsϕrB`>HnDTŽʹp:x9M?ݾգ_;35EN\U`FQcD7Ρ򂀒lDكcaXG,E՝ -ۗSE[ŬV2ɼ ,э<7Ě4e)JZ#+CIZOL_.w!A^r#[ec,k:k%7(.;A2◼?/un >\l+HcsYtBO61O[r,AN|a3r֟-L*YlcL=8)Amoq{E5,1zCy7Қ-VQ~\dÉ%4MqjP  }?E*`gc?CS!>G|twa&y&f9Kh @#瑍ARfV3~b˪4| ~;Pd _E>O="[`/~+h`JK[4" q}xĻ~ ul1?w!&6웭D!|vNT'wPe {o%OFXķ'. d뢸7DץԿ+uZ"Aێ{!B 5'%3s9d|G,ͱ9 a~2)4 b,ƈ0l fxZOb3,Lp-lb?0zdm( >tnm`V[,d6Ɣ@h b;Qh|}9]ݽdIOwʂc>!%9rtUفm I2B7:c=hUWis3,ĵ>ƻvaHFG?헷 &b'_= C+L**Xɕ(X bjCE.ۛəl,MH#m@Fl?M? ޥֺ#R.짆9OSe ǜ7p$,9%/Оh?&fђl_S piETxڏb񿩊Y`Gp?>rH킩0l Uovj$:LQBLuxWbK/!#]ȽPǏl_k׺P!U:]=pe=o^ٟL9EAywypS2te;-7@F8vZb#H43ւx QvӢ#IRwpo'7` 8'N+ZV*<#,*~3ʭ^{$ }@@SSv+59@{JuLX7>c⿨ B) Mq;E%a߲ɲlA&0E7,ȀpCFEi7~PVCGO0~XŮ}d,'O*4BL !`'KSaקԅX19k|LZ$yV 9Hʩ'V ]E+>$,au4gQ/iJ2t,Z5s2`{'tNG[ 5p< 0y\9Wj /k['Hi,ְhcm.{ cg55b L7mޥIP՞l].mtH<;&tMO: kGE&#sʕ_$Rs9RIiC OAS՗q⍮a̍_Ί>{^ȇblތ`> uRan;~'c ݾ]c$mmYʶ=?2tYW4A䉥D *vmmߧ5]»;2ݒ \e.Z> ԙQ{/Ѣgg.tjb}(OV.9T/'(.:tJsҫl e`EOnbǏ=[є|]^E eX^y]Wptw/p=D)t9VIa)z]N6Xp?N[MGt_?E?J ?$W:'5L97 cR,O回ylN ~ewӣ/=:%GmD%AEʴ[&Q;.Ǘ0Ƈċ0Sett3o+]iR؟hбp^rckt<wRvE~jp!Ikf$86球ؒT/2M16w<;t݃$){mm:5>Mv(|.ԓsQwb4wX+ב;{I<@W[DT.u6bz67|l =ܒGT,ӛ `= N$EMgr9/9+ 0/Φ7MPU@\A\A]A 2A\A]]A^A@ɴ@@@ͯ@z@E7@@@E7@=@z@E7@@ccompressionsign-keyall-matchesavailableFfieldsformatfrominstalledmatchRrecursivesearchsummarizeupgradableworldorphanedclean-protectedcommit-hooksinitramfs-diskless-bootoverlay-from-stdinscriptsssimulateallow-untrustedarchcachecache-dircache-max-agecache-packagescache-predownloadcheck-certificatefforceforce-binary-stdoutforce-broken-worldforce-missing-repositoriesforce-no-chrootforce-non-repositoryforce-old-apkforce-overwriteforce-refreshhhelpiinteractivekeys-dirlegacy-infologfilenetworkpreserve-envpretty-printpreupgrade-dependsprint-archprogressprogress-fdpurgeqquietrepositories-fileXrepositoryrepository-configprootroot-tmpfssynctimeoutUupdate-cacheuvol-managervverboseVversionwaitAA J@I@_apk_array_truncate=@@m@$A}+A=@@@@y@@@!@=@apk_dir_foreach_config_file@@Y*A@@@5@%A@)Aٰ@ݰ@@@Y@@@ɰ@5@Ͱ@Ѱ@հ@Q"A@IA@]A/..//./apk_db_layer_name?APA?AJHJJHkkkkkkkkkkHPjjjjjjjjjjjjjjjjjjjjjjjjjjHHjoooooonnnnnnnnnnnnnnnnnnnnapk_digest_ctx_finalapk_digest_ctx_updateapk_digest_ctx_reset_algapk_digest_alg_to_mbedtls_type @ser_yaml_start_indentser_yaml_indentQueryErrorPath-TargetOwnerPackageNameVersionHashDescriptionArchLicenseOriginMaintainerURLCommitBuild-TimeInstalled-SizeFile-SizeProvider-PriorityDependsProvidesReplacesInstall-IfRecommendsLayerTagsContentsTriggersScriptsReplaces-PriorityStatusRepositoriesDownload-URLReverse-DependsReverse-Install-Ifser_q_start_indentser_json_start_indentser_json_indent8A5AUA2AIAAAfv#;Vs +DWp@x)Hnlib/apk/execBP$BV,BTAUXAIALXAA4BD<BiApAoAmHBtAcTBkAAAAAAAaallccheckIindexesllimitttestaallddescriptionexexacthas-originooriginrrdependsaavailableignorellatestpreupgradepreupgrade-onlypruneself-upgradeself-upgrade-onlyaddependsImanifestfullooriginOPprovidersuupgradeableaallLcontentsRdependsddescriptioneexistsinstall-ifinstalledlicensePprovidesrrdependsreplacesrinstall-ifssizettriggerswwebpageWwho-ownsddependsdirectory-permissionsrreinstalluupgradexxattrbuilt-afterllinkpkgname-specooutputsimulatesstdouturldestinationno-chownrrdependsadd-dependenciesaavailableignore-conflictllatestuupgradessimulatebackupcheck-permissionsdetailsfullignore-busybox-symlinkspackagesprotected-pathsrrecursivesysteminitdbllatestno-chownforce-reinstalluupgradeusermodetvirtualformatadb_w_erroradb_ro_kindadb_wo_blobadb_wa_append_apk_array_truncate}@@#A1ATARAmA@apk_hash_delete_hashedalphabetaprerccvssvngithgp  #%;0DzR| A,AB " info\n' + '\tiwinfo scan\n' + '\tiwinfo txpowerlist\n' + '\tiwinfo freqlist\n' + '\tiwinfo assoclist\n' + '\tiwinfo countrylist\n' + '\tiwinfo htmodelist\n' + '\tiwinfo nl80211 phyname

\n'); return 1; 07070101AE217C0000A1FF0000000000000000000000016A426C2800000005000000FE0000000000000000000000000000000D00000000usr/bin/utplucode07070101AE213D0000A1FF0000000000000000000000016A426C2800000011000000FE0000000000000000000000000000001200000000usr/bin/sha256sum../../bin/busybox07070101AE21C1000081ED0000000000000000000000016A426C2800005018000000FE0000000000000000000000000000000E00000000usr/bin/usignELF` @4p4 (44@4@@@tt@t@p@@p@@@@0C0CpOp_@p_@@@XXQtdRtdpOp_@p_@/lib/ld-musl-mipsel-sf.so.1 @@Tb @ 7@p_@t_@@@L@ t p`@5p]`@@0ppp@ pp&p(p&@2p_@ool@oo @%&$ %"! #   x_@W `@A@"#$`@ i @ -B@"|_@`@z1 7@8_@E*__RLD_MAP_init_fini__register_frame_info__deregister_frame_info__libc_start_main__stack_chk_guard__stack_chk_failmemsetmemcpystdinfopenstdoutstderrfprintfexitfwritefputsfclosefreadb64_encodefgetsstrchrb64_decodefeofsnprintf__fstat_time64mmapmunmapperrorgetoptoptargstrlenstrcmpsprintflibubox.so.20260213libgcc_s.so.1libc.soGLIBC_2.0Tii jx_@~ `@~$`@~ |_@~_@~_@_@_@_@_@_@_@ _@ _@ _@ _@_@_@_@_@_@_@_@_@_@_@_@_@_@ _@!_@"_@#_@$_@%' ''8@<@ `%4(@<@<<0,$D%%¯%;1&$ <&%0 %( % @SB$3C,`!B@@<\`"[@@<$d`BCC,h`$~C$qC@<@<_D@< x7$$ď `%D@<840,($H'@<$`C@<\`C@<$`C@<P`C@<$h`C@<$`C@<X`C@<$`V@<$`C@<``C@@ +@!3%0h %(@"!C06`"#%`.@&%0|s&!S%@%(0 % "&B$"R&0|2!U@$&+@!+D@!T3%0h %(@"!T"40,($ 8'3B%0!3!@%&0 % #%`'$% 0!$$$$% F@CA$#0%(! $ qR. @@2&@2&%(@0 % % @x$ %("%@=D|8|@{D|z|@D||C|% # 0 %(@% @ &RLF:4.  & $$ (''@<@ Commands: -V: verify (needs at least -m and -p|-P) -S: sign (needs at least -m and -s) -F: print key fingerprint of public/secret key or signature -G: generate a new keypair (needs at least -p and -s) Options: -c : add comment to keys -m : message file -p : public key file (verify/fingerprint only) -P : public key directory (verify only) -q: quiet (do not print verification result, use return code only) -s : secret key file (sign/fingerprint only) -x : signature file (defaults to .sig) untrusted comment: %s %016llx %s /dev/urandomCan't open /dev/urandom Can't read data from /dev/urandom private keypublic keyPremature end of file Cannot open message file Failed to decode signature %s/%016llxFailed to decode public key verification failed OK Failed to decode secret key Password protected secret keys are not supported Cannot open message filesigned by key%016llx FGSVc:m:P:p:qs:x:-Need signature file when reading message from stdin %s.sigNeed one secret/public key or signature @ @ @ @ @ @ @ @ @ @ @ @ @h @ @ @P @ @ @ @ @ @ @ @ @ @ @ @ @< @ @ @ @ @ @ @ @ @ @0 @ @ @ @ @ @ @ @ @ @ @ @"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl\cX֜%`-Vɲ%`,i\1Sn6i!XfffffffffffffffffffffffffffffffݷmRQw }dNfev_gxYMuAAM pywy@njso+lRɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[Y&V0V$@<__'#%x '@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%@<_ _%,@ @@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@@A@07070101AE21410000A1FF0000000000000000000000016A426C2800000011000000FE0000000000000000000000000000001000000000usr/bin/strings../../bin/busybox07070101AE21310000A1FF0000000000000000000000016A426C2800000011000000FE0000000000000000000000000000000F00000000usr/bin/logger../../bin/busybox07070101AE21490000A1FF0000000000000000000000016A426C2800000011000000FE0000000000000000000000000000000D00000000usr/bin/uniq../../bin/busybox07070101AE216C000081ED0000000000000000000000016A426C2800002028000000FE0000000000000000000000000000000F00000000usr/bin/fwtoolELFP @4t4 (44@4@@@tt@t@p@@p@@@@/@/@@@PPQtdRtd/@/@hh/lib/ld-musl-mipsel-sf.so.1 @ @ @/@/@@@@ 2 p0@5p- 0@<@8ppp@ ppp(pt@2p/@oo @oo@    c/@00@'@"\U40@jq{ @ =@"80@/@0@@/@ "__RLD_MAP__bswapsi2_init_finifree__register_frame_info__deregister_frame_infomallocmemcpystdoutfflushftruncate__stack_chk_failfprintfstdinfreadfopengetoptfclosestrcmpstderrfwritefileno__libc_start_mainfputsoptindoptarg__stack_chk_guardlibgcc_s.so.1libc.soGCC_4.3.0GLIBC_2.0`_' ii (/@~00@~40@~80@~ /@~/@~/@/@/@/@/@/@ /@ /@ /@/@/@/@/@/@/@/@/@/@/@' 'd@$ggldgnjlKf3NN.Lt`Ma㶰g\gaB +@"2aPir!`jR `Sr`Tr!`Iranٲٴ sr`tr`qraֲnҲմle"h*nnвk`ϲϳ`K#ɳ`#Ƴ` #Ų@*ȴthPg}dH2A"eg$`e$`e$`emX@ *@*te` #`n*@*l@e җ"j Jh Ҝ@D"D nmlg ng nTm si `n  g  }@*wti9ҹ(l@e*h}n "o@*iztih Jhg=" ngg N9']@/"ih^@""bnlm"] lmk!Y jCE` gglngnmlW @Rtii"a>@*9K g  3@"i-@k @0*._'#a nle( !*p 7HgRg`@*-Px xxra_ ' J @ * BLZ`nge`0@ @80@/@@40@h4@`4@l4@b4@a4@0@@d4@@/@@/@@FWx0@@P@\@h@@%X @ @@#% !(!<$$ ''@<$$B$@<@< $8 1$$(''@<@0 @@<B$@$@<4 $$@0 '@<B$ @@<'@ Options: -S : Append signature file to firmware image -I : Append metadata file to firmware image -s : Extract signature file from firmware image -i : Extract metadata file from firmware image -t: Remove extracted chunks from firmare image (using -s, -i) -T: Output firmware image without extracted chunks to stdout (using -s, -i) -q: Quiet (suppress error messages) Cannot append/extract metadata and signature in one run Cannot truncate file when reading from stdin unable to extract trailer header Data not found CRC error Size error unable to extract trailer data @@>@<@@``QtdRtd.>@>@$$/lib/ld-musl-mipsel-sf.so.1  @ @>@>@@ @,@  p@@5p=@@@8ppp@ ppLp$pL@2p>@oo|@oo @CL AF?$<H/738%,6@!;B92K#I CG1.D=J0)   *'+" (&>:-E45 M>@D2 @@"--(@"+;$@@M%Ue@ r C(@"(@@[>@@@aho $@ *>@<kTQ_vj{xjyt__RLD_MAPucv_array_pushucv_putuc_vm_freeucv_from_jsonucv_object_deleteucv_getuc_vm_scope_getuc_vm_invokeucv_object_adduc_source_new_fileucv_string_newucv_to_stringbuf_formatteduc_program_writeuc_vm_executeuc_stdlib_loaduc_search_path_inituc_vm_initucv_typeuc_vm_trace_set_finiucv_string_lengthuc_source_new_bufferucv_array_newuc_compileucv_int64_get_ucv_string_getuc_vm_gc_startvasprintffputsstrchrstrlen__errno_locationfwritestderrstrcmpfclosememsetfopenstrdupfreadreallocfprintfstrrchr__stack_chk_failabortmemcpy__stack_chk_guardstrerrorstdoutjson_object_get_objectprintbuf_freejson_tokener_parse_exjson_tokener_newjson_tokener_freeprintbuf_newjson_tokener_get_parse_endjson_object_is_typejson_object_putjson_tokener_error_descjson_tokener_get_error__register_frame_info__deregister_frame_infostdinstrtokfdopengetoptatoi__libc_start_mainoptindoptarglibucode.so.20230711libjson-c.so.5libgcc_s.so.1libc.soGLIBC_2.0JSONC_PRIVATEJSONC_0.14 ii  >@~ @@~$@@~(@@~>@~>@~7>@>@?@?@?@ ?@?@ ?@ ?@ ?@ ?@ $?@(?@,?@0?@4?@8?@?@??@@?@A?@B?@C?@D?@E?@F?@G?@H?@I?@J?@K' 'Dd@n N <m n@ m j H I K \ r8g@ /mt g"B&)8 gjh  ) e  D H <a`n "` ea  gQ*  KjA`A` A aBG+ A @H2Ig j@ <d < g <<d X ggl g !d <gx ggl gj ҕ g*Sr_`TR `Lr%`Rra j KäTkn*  Kà $ eg" gB*  HÀl`*m g"g8y g"I/lJ#g@8 g@8 ` j JK g*  I÷ g hpR`iP7`cp `dP%`Fp8g!Up`DjNm  gJ* `* @H2I ) ep,`gpa` Rpp0`qP `lp8g`!opa@@sp `tpam < h8   gg  g Ҧ gg g jғ<@d =m "g"J  @  *e  B  g* cg0,   !@* g g ecx ggl e!@" L lgl gh ?(h#  m"  lL gl g  h<@d =m g"J  >* , e@@ e"j nm g6"  r"g`,  &! @5!` `h`  * e < @ gi  m" @" L lgl g   lL gl gd <賂gT =m@g g"J x gn<h D "g)>_ "d <g gв$ eg(˲m=m g"g"j@Iܵ g*!ɲgٵ iյ lgԵ g *)gҵ ϵ g *!$ Jgȵjb g*@*  ek`ڜ @H2I < ggj Ґnm "g$" Ig *e qC`)Ca`)C`Y`P g y *e j  s`"K` " g'*@k@b9aD  Dj  ;*o  D D [p gnm gJ * e_< gvuv e H2Ix 0 g@J@ٴ""k g j N h %$ <  <r`Z`;*"V ra  gng gr'`g4 eg*/K \ ej jҰg<| o n g h eI(11 c)6"eAge@Pg@rd @@@%@>@P@@%@(@@ &@&@t@%@<@$@@%@%@%@%@%@>@%@'@ &@0&@@&@d&@&@&@H@&@&@&@\@'@ '@$'@0'@\'@d'@'@'@(@'@'@>@(@@(@D(@ @4@%@@@@#% !(!<$$ ''@<$$B$@<@<$(  1$$(''@<0@ @@<(B$@$@<$  L($$0@ '@<(B$ @@<'@<4@$  L($ 'Dg-F3iC`d  aB+ \ eEd>@ @d e* \ eDde>@ @d \ ee>@ @d$glgg2M'aeH5g *e@6m q@vd idg$L "g@@J@ude' 'Out of memory ucode./uc.outJSON parse failureNot a valid JSON object/usr/bin/env ucodeUsage: %1$s -h %1$s -e "expression" %1$s input.uc [input2.uc ...] %1$s -c [-s] [-o output.uc] input.uc [input2.uc ...] -h Help display this help. -e "expression" Execute the given expression as ucode program. -p "expression" Like `-e` but print the result of expression. -t Enable VM execution tracing. -g interval Perform periodic garbage collection every `interval` object allocations. -S Enable strict mode. -R Process source file(s) as raw script code (default). -T[flag,flag,...] Process the source file(s) as templates, not as raw script code. Supported flags: no-lstrip (don't strip leading whitespace before block tags), no-rtrim (don't strip trailing newline after block tags). -D [name=]value Define global variable. If `name` is omitted, a JSON dictionary is expected with each property becoming a global variable set to the corresponding value. If `name` is specified, it is defined as global variable set to `value` parsed as JSON (or the literal `value` string if JSON parsing fails). -F [name=]path Like `-D` but reading the value from the file in `path`. The given file must contain a single, well-formed JSON dictionary. -U name Undefine the given global variable name. -l [name=]library Preload the given `library`, optionally aliased to `name`. -L pattern Prepend given `pattern` to default library search paths. If the pattern contains no `*`, it is added twice, once with `/*.so` and once with `/*.uc` appended to it. -c[flag,flag,...] Compile the given source file(s) to bytecode instead of executing them. Supported flags: no-interp (omit interpreter line), interp=... (over- ride interpreter line with ...), dynlink=... (force import from ... to be treated as shared extensions loaded at runtime). -o path Output file path when compiling. If omitted, the compiled byte code is written to `./uc.out`. Only meaningful in conjunction with `-c`. -s Omit (strip) debug information when compiling files. Only meaningful in conjunction with `-c`. utplucc%s/*.so%s/*.uc, no-lstripno-rtrimUnrecognized -T flag "%s", ignoring he:p:tg:ST::RD:F:U:l:L:c::o:sARGVSCRIPT_NAME[-e argument][-p argument]Invalid -D option value "%s": %s Invalid -D option value "%s": Not a valid JSON object -The stdin can only be read once rUnable to open definition file "%s": %s Invalid definition file "%s": %s require,no-interpCompile flag "%s" takes no value, ignoring interpCompile flag "%s" requires a value, ignoring dynlinkUnrecognized -c flag "%s", ignoring Require either -e/-p expression or source file [stdin]Failed to open "%s": %s Unable to open output file %s: %s wb#!%s @<>>'#%x '@<? ?%@@`e;ee>@`e;ee?@`e;ee?@`e;ee?@`e;ee ?@`e;ee?@`e;ee?@`e;ee?@`e;ee ?@`e;ee$?@`e;ee(?@`e;ee,?@`e;ee0?@`e;ee4?@`e;ee8?@`e;ee0;  !$.,*5"6 2}xoXP@x`2@"#p2@ P@ @ 2@"wO@opP@ib)\UN@G`&@X@O@0i/("B5@__RLD_MAP_init__calloc_a_finifputsstrlen__errno_locationstderrstrcmpfclosememsetfopenstrdupfreadstrncmpfprintfcalloc__stack_chk_failmallocmemcpy__stack_chk_guardsnprintfstrcpyjson_object_get_objectjson_object_to_json_stringjson_object_get_int64json_object_array_get_idxjson_object_array_lengthjson_tokener_parse_exjson_tokener_newjson_object_get_intjson_tokener_freejson_object_new_arrayjson_object_object_get_exjson_object_get_booleanjson_object_get_doublejson_object_get_typejson_object_get_stringjson_object_array_addjson_object_putjson_tokener_error_descjson_tokener_get_errorstrerror__register_frame_info__deregister_frame_infoputcharisxdigitstrtolstdinregcompgetoptregexecisalnumfputcexitatoi__libc_start_mainregfreeoptarglibubox.so.20260213libjson-c.so.5libgcc_s.so.1libc.soGLIBC_2.0JSONC_0.147 ii M(WP@~ P@~O@~O@~.$O@(O@,O@0O@4O@8O@' ' d@}g] t@gGjSو2JN2L2Oef}gKeE٠ag gir_`jR;`ar`bR%`?r@`Fr~` gaB+M"񙰙AENLـ*ә  ~jer `hrag gjHzqrT`rR `lra`\ Ksr:`traj@h3q䠝܆m@JJJjM٭   N٤* @L Q љ g}jH]`n" e@Pق@"`#Oy tjQqGNjJOjPMKjjLjIـHJijaL"8 gN"Gnn" g<IfH2M`heI@gMP*ղ۴h PhZXgMIhJIPC^"˲Ҵ@gh QPCbBI#R`dB!#J?"khPlCG "<#Ƶdz2i⑙ kH pa< l J*h e͙ h hPBBah ejDDP٠< -lHPAIODPA` s=aDQHtrNaAn QLGAIJ"Q" gTl BKMGAd@IJn", eMR`QD* lTBHGAdDIJn"p eAg Bj H2gA9K8Ji⇴ eMJHMljVGAIJ"Q"` x MT BKHGAd@IJn*u eHRa r`Z `rd`rS`rC`HHJr%`ra͙AQM g:T B"ccb #@͙AQMQC CjQqCB`͙AQMM QJ͙AQM E g͙AQM0 g? g͙AQM@ g8 gKHQGAd@IJn?"QR?a Z` *QHJra   gjHeqdP@O@&@l,@O@|,@P@P,@T,@&@,@,@&@P@-@,@,-@@-@P-@,@,@&@@.@T-@&@`-@d-@h-@l-@t-@%@@@#% !(!<$$ ''@<$$`&B$@<@<$  $$(''@<P @@<2B$@$@<  02$$P '@<`2B$ @@<'@ | -s "json..."] {-t | -e } -q Quiet, no errors are printed -h, --help Print this help -a Implicitly treat input as array; useful for JSON logs -i path Specify a JSON file to parse -s "json" Specify a JSON string to parse -l limit Specify max number of results to show -F separator Specify a field separator when using export -t Print the type of values matched by pattern -e Print the values matched by pattern -e VAR= Serialize matched value for shell "eval" == Patterns == Patterns are JsonPath: http://goessner.net/articles/JsonPath/ This tool implements $, @, [], * and the union operator ',' plus the usual expressions and literals. It does not support the recursive child search operator '..' or the '?()' or '()' filter expressions as those would require a complete JavaScript engine to support them. == Examples == Display the first IPv4 address on lan: # ifstatus lan | %s -e '@["ipv4-address"][0].address' Extract the release string from the board information: # ubus call system board | %s -e '@.release.description' Find all interfaces which are up: # ubus call network.interface dump | \ %s -e '@.interface[@.up=true].interface' Export br-lan traffic counters for shell eval: # devstatus br-lan | %s -e 'RX=@.statistics.rx_bytes' \ -e 'TX=@.statistics.tx_bytes' rFailed to open %s: %s ahi:s:e:t:F:l:qFailed to parse JSON data: %s Out of memory Syntax error: Unexpected character String or label literal too long Invalid escape sequence Unterminated string In expression %s Near here ----^ export %s=%s; %d%lld%fnullbooleandoubleintobjectarraystringtruefalseEnd of file'&&''||'',''=''!=''>''>=''<''<=''~''!'Label'$''@''.''*''['']'BoolNumberString/.../'('')' <=>=!=&&||.[](),$@<>=~!*'"_azAZ-09x-@-@-@-@-@-@-@&@P.@T.@ X.@\.@`.@d.@h.@l.@p.@t.@x.@|.@.@ .@.@.@.@.@ .@ .@.@D.@!@.@y@.@y@ .@@ .@@ .@@.@@.@@  !""#$$%%%%%%%%&&&&&&&&]]]]]]]]]]]]]]>=<;]T]]JGD]]]:FSRQPON\[ZLIYXWVUMKHEC@BA?942.-,%)'8850111137LJ   & !"#$%& !"#$%&%&&!"#$%&#$%&  &&&&''&'& 8$)-,+*$.(' $2$$1('$/%$('0'^5$433$$$#$&$7"! _6__@<OO'#%x '@'F ,D+"KH1*G%;J 6 2ABL=83 (#.7 /&!-I:wqe`q@"jP@b@ Spq@"qU%T@]:>Mv`@`d0@zLMqE2<pS@ D+lg$,:Kb__RLD_MAPuuid_generateuuid_parsestrlen__errno_location__time64strcmpmemset__fstat_time64strtoulmemcpyioctlf2fs_get_f2fs_infof2fs_str2encoding_flagswrite_inodeget_kernel_uname_versionf2fs_dentry_hashget_kernel_versionf2fs_finalize_devicef2fs_str2encoding_initf2fs_set_bitf2fs_get_usable_segmentsdev_fill_blockf2fs_checkpoint_chksumf2fs_release_sparse_resourcelog_base_2f2fs_get_device_infocalc_extra_isizedev_read_block_finitest_and_set_bit_letest_and_clear_bit_lef2fs_reset_zonesf2fs_encoding2strf2fs_init_configurationutf8_to_utf16dev_read_versionf2fs_devs_are_umountedfreeatoiexitdev_fillstrtokdev_write_blockcallocmallocputsf2fs_cal_crc32printf__fixunsdfsi__umoddi3__udivdi3__floatunsidf__register_frame_info__subdf3__muldf3__divdf3__deregister_frame_info__ledf2__lshrdi3__adddf3__ltdf2__gtdf2__eqdf2getopt_longatoffallocatestrdupsrand__libc_start_mainatolloptindoptarglibuuid.so.1libf2fs.so.10libgcc_s.so.1libc.soUUID_1.0GCC_4.2.0GCC_3.0GLIBC_2.0 ' ``' P&y ii P@~T@~ `@~(@@@@@@@@@ @ @ @ @ @ @$@(@,@0@4@8@<@@@D@H@L@P@T@X@\@!`@"d@#h@$l@%p@&t@'x@)|@*@,@-@.@/@0@1@2@3@4@5@6@7@8@9@;@<@=ď@>ȏ@?̏@@Џ@Aԏ@B؏@C܏@D@E@F@G@H@I@J@K@L' 'dPeJHAJ8Z``D3 m`ieG)/C}m)_iqmkk xj|"gJ*`@rxg+Pl`|k mlLؽ+kmPؠPkL#ktkL #kmkPؠtkL +kL# XR aDhm*@el@T X۝  (Qa XR aDhm* ee@gXAZa XRaDhm*@mpeAA He(3-p3aH]T XS  LI` P?  ?*`k``0@kh*@XgZ  a xSadHm*@ kc ggۧ"g@*&H@ r`0g@ " r`,raj@Ii $ g* a #p)l} J xS adHm*pgl*A@k`ڪ@iXgIa@ja!g Te\Tg@؏:ta#gKTP`mgVjBnTQeT@@[nmXj\LPBT`\C2]6` XRaDhm *````pelDe ` g R` XRaDhm*  Tl   " XRaDhm_* opjmP XR_aDhm_*gW kL# XRaDhm* @kL# XRaDhm*kKL# XRaDhm *޴kl" XRaDhm*ֲִ@ba XRaDhm*ϴH2IHɲ@Jb` hSa XRaDhm*H2I`Z{B"j@@C"pjmP XRaDhm *pe XR adXmhm*e U aDhm*pe L" XR aDhm*e P" XR aDhm*e@" XRaDhm*pe XRaDhmr"`@ra XR aDhm*~epjl" XRaDhm *Lerpgpjl" XR aDhm*jepjl" XR aDhm*aej@HheR#`@e@r` XR aDhm*TeeJ@@"OPpeNeR:aheRadC # * XRaDhm*B"@@ * XRaDhm*; eRaeRa XRaDhm"iQgxd/ie`@o@X@Y@P@W@W@X@ X@@DX@`X@lX@tX@X@X@X@i@@X@X@dY@Y@ Z@\Z@T@Z@Z@Z@$[@D[@\[@[@[@[@[@\@0\@L\@W@[@W@x\@\@\@%@@@@#% !(!<$$ ''@<$$pSB$@<@<$` $$(''A< @@>??!ڧ @@Aҡ!tAg8gg8g Ӏ oDM,gB BCCggHgp@jl@"Fjg@T Z@au\xydg @ aN, C@aQ`Jc@a󐘧AeM@ $e@ " XRaDhm *@ eR_aŘdomN XRaDhm*@pe >*u\xyodg gkl PrmKIH LrL` P4Q4L"`GD9JC$`@ Xo`Ccg VؘixgTu`GE9JC@n 4@v4b4yb34|TPHT J ҹh n#jAZ!naJB2R2@2FC`PgD0.[jjD XRaDhm*E Ĝ+&М&($`@ XRaD*Cg6B2M@p7"eAge @MPLI  ԀԀԀ {@@* XRaDhm* 4gp jl "l@nBeMxX؀,Xg`g`gCn\uL`k@iykzkxjDؠtjDl#"ĘAFD @bgNAH2I3bb3c3d XR aDhm*@pgIqaj"DaBdXjL, ZaR'qK MXKحmOnOoOjlgal lm"gf* XRaDhm * e XRG` XR aDhm*e XRaDhm*  g" XR aDhm*el JI#"gxgIJDhm*Ce dXHLjTjXMx wiJ\ j@X"jC\A@B djDDC2EjF٠XkBg٠|,K+(eHjIN٠X|B,K+(eJjKO٠X|B,K+(ekLrjpMPQST@[jl" jC`HɠPkL#k`lkKl"X|B,K+(ek`T`x`|٠pjl"jHd m@JXCJ"`HJ2ZJH2Iڍj@\`@`DCXg X RaD*   np gR` XR aDhm*elgj0jlgj  jDtl " mJl"g"* XRaDhm*e xS adHm*|@ ҠXB,K+(e Kh3mmd4`3lكɂmlhlلkHJLljmTxن٧inkompqsr@{pjl" jC`Hɠpjl"j`Lj@\`@`D @mwD٘ iJl\نـDi d3iJ %*Aml  * XRaDhm*e raB`L H2I @jC`L` `ca `ack !j"$j% #ӇBL C` Kca`&Can  j @j@j@j@jHk&j'j(*X)+:"lm,-lm./011"j2j46 kB&3ӣk57`BJCa`8CXg*Hn o" XRu`l lgljJg Bo X+RaDhm *@nC C pl L kJLClG"`HJ2ZJH2I``HJ2[JH2I`ڣm@ JCXg X R$` gR2` XRaDhm*Dhm* e`HD*  ӀnplgHJH Jr Xg*jpl"X *##n#pelDlm"g * XRaDhm * e XRaDhm_*ĘxB hHٷK㭘LjT٭|k`kc|a`bdDDC2EjF٠XkBg٠|,K+(eHjIN٠X|B,K+(eJjKO٠X|B,K+(eLjMPQSTقgA@UKXU jVC`A_L?ac`aفDDjpRj@[jl" jC`HɠPkL#k`lkKl"X|B,K+(ek`T`x`|٠pjl"jHlm g* XRaDhm *Be XRH`jK lg J"pjlcm*m@lq7e * XR_aDhm_*e XR_ aDhm_*"eAg1@Dhm*e XQZRjSj HCgAJc` AL_aC`c_a.k` j I J K Lâ`` ` ``c R pEgk q sAJ"c Ņg`ALaC`ca%k `,l ,lBd@JxlKiCXg X RaDhm * n p  X "R aDhm*el l TJT "C klG"`HJ2ZJH2 I`m @HJCXg  RaD*  @ np gR` XRaDhm*BjPJPئNdx-CXg Dxg)I+ CF` g xS8g" )Dhm*bel  nm)Dhm * n BBp  " XRaDhm*"l lm"g X %)RaDhm*e xS adHm* "eAg1@T:eoDhXjDg$"NGH2IwD5@2M2mIK eeb3fb3gxgb3h¢3b5b3c¤HOwg-w2Iy0666ٜ072I06ڜo0§¨2I§¨5¢65£U RaDhm * np og" XR aDhm*elgHlglm"g&* XR aDhm*e XRaDhm*""eAge1@B@``q`brksk hQ`A`QAac` a.l`k ` i ``C j Pj k l Q r Sb QHAc `QAaC`Bca%k`ʱg,lg,lX?"l omMXa`AN j^Ƀj ^aHA`Cac"`aہ`ajAcaC`calk`ʱg,lg,l@wJmCXg X RaDhm * n p g" XR aDhm* elg lglma@'* XR aDhm *AeA xSadHm*!"eAge5/@lm G* XR aDhm*eh Hl lm"g * XR aDhm^*e XR^aDhm^*"eAge5/@lm * XR aDhm*aeh l Al@OX2JB2R2g* XR aDhm*!eh l lm* XR aDhm*eh l@l*(eg eekm@C2AM@INnJOmKJ)LUKVLW؇@nmYLpHiaBJDjE@@dFAK`te!fs ƙ療ggaagtggHg c`CgG؀fd3IG`gC xXgS* aDhm* eaDhm*Ƙp XRaDhm"aaPhL eA JgHkdJxBjC!`@BśjD `j@%mM֠H"jMD܀@JLНHJPНHJTDXNśF2DN2\OeF2DN2@ܠHI"jDeam`@a`Dau ؚgV0$@adHm@*napeF@ApZeJgHkdJxBfjujk adHm *@npgo1" XRaDhm* Jc xgI g"a XRaDhm*a ` ca nm! PHJ1  XBB5GB2JW4:eDImXgB4KB2NƠTƂ4njDlB"NFH2Id jX4`3 Ilelegb4‚4ggb3ejixgb4kb34nMNva8" jXIke#gg3lgb34"d'iixgb4kb34n  B #`JCa ng Jnm`kPl"j l@IhBB2B2DjMCg FCgJg h`P"g`LmJ1$uhg ATCgAJAۢgll`T"g#` JC>ang fBm o`@V`BXj[\@Tej:egD$"G2404Y 2CjEFe0JI0ƀʙg˜gʆMOwg,Ԛ&6[CÅÆ !BCgA XRaDhm *npg g x{"S aDhm* C` JCjgH gH7 hA lA͋͂44luPEgJllg l`T"g `V!ZB2B2!\j!^WHjLgHC` JC nm jԘ[`lCgx`kjD" l7NDH2IKD0@2 B0GB2J0j LMLtg/P"l2k Ixb4gˆb34j "BCgARaDhm *npg g xSxg"#h  nm j[ #BCXgi*Dhm *np Ӱg xSxg* nm j[ $BCXgi*Dhm *n @p g Tg",Dh %BCXg ,Dhm * np g " XRaDhojL_+ްkjia@`@ۚ`r g xS`в o?*@` Kca@|JCJkCXg)ⁱ XRaDhm * @nǵдp gg*l"eAge#C@mT6@FHdm‛`A`Agg0leh@eRACj XRaDhm* np@2P2)J` gga@g gmI "F XRaDhm*"eAgGD@dHm_* @npJA@xg%ggg_""eAgesF@B-/`@AC>ane XR aDhm*`nxyponog*nog *lg ~d`@ECj XR aDhm*eplg"eAgCB@`@m@H`@t`@ @`@,a@q@`@\a@a@`@p@a@b@g@g@a@b@p@Db@b@c@'?b@: p@d@xp@@d@d@d@e@\p@e@e@Df@f@Dp@lf@f@dg@ d@$p@f@4g@@g@l@(h@l@tm@Th@h@h@h@ i@li@4i@p@i@i@i@0j@j@j@j@ %u Error: %d zones: Need more zones by shrinking zone size , Warn: Extension name (%s) is too long Info: format version with "%s" Info: SB CRC is set: offset (%d), crc (0x%x) Error: Device size is not sufficient for F2FS volume Error: Failed to prepare a super block!!! Error: Failed to trim whole device!!! Error: Calloc Failed for sit_zero_buf!!![%s:%4d] Filling sit area at offset 0x%08llx Error: While zeroing out the sit area on disk!!! Error: Failed to initialise the SIT AREA!!! Error: Calloc Failed for nat_zero_blk!!![%s:%4d] Filling nat area at offset 0x%08llx Error: While zeroing out the nat area on disk!!! Error: Failed to initialise the NAT AREA!!! Error: Calloc Failed for raw_node!!![%s:%4d] Writing root inode (hot node), %x %x %x at offset 0x%08llu Error: While writing the raw_node to disk!!! Error: Failed to write root inode!!! Error: Calloc Failed for filebuf!!! Error: While writing the quota_blk to disk!!![%s:%4d] Writing quota data, at offset %08x, %08x [%s:%4d] Writing quota inode (hot node), %x %x %x at offset 0x%08llu Error: Failed to write quota inode!!!c.lpf_ino[ASSERT] (%s:%4d) %s lost+found Error: Calloc Failed for dent_blk!!!...[%s:%4d] Writing default dentry lost+found, at offset 0x%08llx Error While writing the dentry_blk to disk!!! Error: Failed to add default dentries for lost+found!!![%s:%4d] Writing lost+found inode (hot node), %x %x %x at offset 0x%08llu Error: Failed to write lost+found inode!!! Error: Calloc Failed for discard_raw_node!!! Error: While traversing direct node!!![%s:%4d] Discard dnode, at offset 0x%08llx Error: While discarding direct node!!! Error: Failed to discard obsolete dnode!!! Error: Calloc Failed for nat_blk!!![%s:%4d] Writing nat root, at offset 0x%08llx Error: While writing the nat_blk set0 to disk! Error: Failed to update NAT for root!!![%s:%4d] Writing default dentry root, at offset 0x%08llx Error: While writing the dentry_blk to disk!!! Error: Failed to add default dentries for root!!! Error: Could not create the root directory!!! Error: Failed to create the root directory!!! Error: Calloc failed for f2fs_checkpoint!!! Error: Calloc failed for summary_node!!! Error: Calloc failed for summary buffer!!! Error: Calloc failed for nat bits buffer!!! Error: Calloc failed for cp_payload!!! Error: Not enough segments to create F2FS VolumeInfo: Overprovision ratio = %.3lf%% Info: Overprovision segments = %u (GC reserved = %u) Error: Wrong block size %d / %d!!! [%s:%4d] Writing main segments, cp at offset 0x%08llx Error: While writing the cp to disk!!! Error: While zeroing out the sit bitmap area on disk!!![%s:%4d] Writing Segment summary for HOT/WARM/COLD_DATA, at offset 0x%08llx Error: While writing the sum_blk to disk!!![%s:%4d] Writing Segment summary for HOT_NODE, at offset 0x%08llx [%s:%4d] Writing Segment summary for WARM_NODE, at offset 0x%08llx [%s:%4d] Writing Segment summary for COLD_NODE, at offset 0x%08llx [%s:%4d] Writing cp page2, at offset 0x%08llx [%s:%4d] Writing NAT bits pages, at offset 0x%08llx Error: write NAT bits to disk!!![%s:%4d] Writing cp page 1 of checkpoint pack 2, at offset 0x%08llx [%s:%4d] Writing cp page 2 of checkpoint pack 2, at offset 0x%08llx Error: Failed to write the check point pack!!! Error: Calloc Failed for super_blk_zero_buf!!![%s:%4d] Writing super block, at offset 0x%08x Error: While while writing super_blk on disk!!! index : %d Error: Failed to write the super block!!! Error: Could not format the device!!!dbvmdkvdiqcow2mpwmogjpavim4vm4pmkvmovwebmwavm4a3gpopusflacgifpngsvgwebpjardebisogzxzzstpdfpycttcttfexeapkcntexoodexvdexso Error: Malloc Failed for trim_stat_buf!!! Error: Failed to get the device stat!!!Info: [%s] Discarding device Info: fallocate(PUNCH_HOLE|KEEP_SIZE) is failedInfo: This device doesn't support BLKSECDISCARDInfo: Secure Discarded %lu MB Info: This device doesn't support BLKDISCARDInfo: Discarded %llu MB \@hf2fs_write_super_blockf2fs_write_check_point_packf2fs_add_default_dentry_rootf2fs_update_nat_rootf2fs_discard_obsolete_dnodef2fs_add_default_dentry_lpff2fs_write_lpf_inodef2fs_write_default_quotaf2fs_write_qf_inodef2fs_write_root_inodef2fs_init_nat_areaf2fs_init_sit_areaA<'#%x 'A< %Av?$~"J `^hc<79xD5z_Ig0\y(1@mjqNR|ZOepaTG}L]iw[tn{5 5 [!5( 7p`#Pt@0 7^ Np`xP@0: j\!p`|P<@U0d 1zO'spt`Pm@20 eYMp`P]@80H @B ]p `SP@0 6"p)`PL@0 ,+$qpP`P/@0Jg pla"wp%`P`@0 s[eO2 "C=po`PQ@0 ei7~p` P@0 1F?|z__RLD_MAP_fini__cxa_finalize__register_frame_info__deregister_frame_info__libc_start_mainmemcpy__difftime64__ltdf2__fixdfsiblobmsg_parsestrleniscntrl__floatsidfmemcmpungetcblobmsg_add_fieldntohsmemmovehtonsntohlhtonlblob_buf_initblobmsg_alloc_string_bufferinet_ntopblobmsg_add_string_bufferubus_notify_asyncubus_complete_requestinet_pton__stack_chk_guard__stack_chk_failcallocpipeisxdigitatoistrtol__gettimeofday_time64__divdi3if_indextonamestrcatstrcmpstrchr__errno_location__nanosleep_time64readvwritevopendirreaddirclosedirdirfdstrcpyreallocsprintfstrncpystrncatfopenfcloselongjmpstrtoulmemsetgetaddrinfogai_strerrorin6addr_anyif_nametoindexfreeaddrinfostrstrstrcasecmpsocketsetsockoptstrncmpstdinpclose__stat_time64popen__ashldi3strrchrsetjmpalphasortscandiropterrgetopt_longoptindgethostnameoptargputsputcharstrtokstderr__gedf2__ledf2__gtdf2sendtorecvfromioctlfcntlbindlistenwaitpidunlinkkill_exitsysconfsigemptysetsigactionumask__time64getsocknamecreatlseekgetpwnamgetgrnamgetgrgidcapgetchdirforksetsidgetpidgetuidfchowndupgetgid__fstat_time64fchmoddup2setgroupssetgidcapsetprctlsetuidinotify_init1readlinkinotify_add_watchreadvfprintfaccept__fixunsdfsirecvmsgshutdowngetsockoptalarmubus_freegetpeernamesendmsg__floatsisf__extendsfdf2rewindfflushfilenofsyncftruncatefscanfferroratolunsetenvmallocsleepfdopenwaitexeclwritefputcopenlogvsyslog__ctime64vsnprintfubus_send_replyatollpollubus_reconnectubus_strerrorubus_connectubus_add_objectubus_notifyqsorttolowergeteuidlibubox.so.20260213libubus.so.20251202libgcc_s.so.1libc.soGCC_3.0GLIBC_2.0P&y ii ]]]]]]]]]]]]]]^^^^ ^(^0^8^@^H^P^X^`^h^p^x^^^^^^^^^^^^^^^^^____ _(_0_8_@_H_P_X_`_h_p_x_________________``` `,`4`<`D`L`T`\`d`l`t`|`````````````````a aaa$a,a4ajw\@:eJe"^"B\"k@gm@AMPa@:eJe *T@:ee&o mj@noml@:eJe"@@:eJe *T@:e m`k@kl@AgLPa@:eJe*T@:eo0 DH:e mg@:e m@g@e`@jl "j@noml@:ee`jJ" $pL@:ege*alM*T@:e mL@:eej#@ 6(@@"`jJl"D".lL@:edbTpTe@:e@Xe@@xK/+T@:eomjjBpL@:ege*jB@Al *T@:eᘞL@:eej#Ҧ@` #kK+P0L' *k@ p|g0̛0h<N@`+0EMl@:e0̙0dN:ee M@le"@raL +0gMl@:ee`"%%A"H"0Ml@:ee"@ 0\@:eg0gEMl@:eek@# L@" l;"P@:egX@:e0"Djl""jLCg n*b`@BG@J P򴙐g@=e@=e *jL G@Jb`DjL+P򴙐g@=eP@=ej0 @2iedg0D$g @ @@*00zMl@8ej@Qgxd\l Ҁj @:eg"k@jl"Cj @2ide\g$gHg@:eLZeajqdj@ABC l`g+T`a\g0𬚰8M@9e Ҟe "\g0𬚚M@9ee*\g0𬚚M@9ee"\g0𬚺M@9e Me#\\ra][ra^e!jKxgLCgXraj #!\ggpH@:ee" r?a/qa knZXg@2.sJaLkIJ Z`K@*BgCAB@A\g@@:e@e\ggH@:eJeEJajXqg8jYkG1L\gP\%nm:e#`em@JJґP2eA? *\gpH@:ee?"G@J`r34`JJa@gR2\gnP\m@:eP2em@\ggH@:eJeEJajJjo @2ied|g0D \68)\g5\A)\g7\G)\g \L)\gaL2QA҂gH@:e"ge "gHI@:eED0gpHQNA m L@:ee5" Q$PD##0 gZMg@:eQgvdJarKaj i0 ZM #0gzMg@:e0 z M0,]Iej  @2ide g`H0D`j"BkL%g##+kl*l *"gT!@:e!ҰXg@:e e"l" lT@:e e0L]J<@TҀll" êvX`^O`vZ`v]`PD0Z M@:e e AD"@TҐ\KJ@:e 0𬘞egPDZM@:e ejl"@ӀT jl^"jl*jl*jJl"0LJRva0LJ0LJҳ0L J0LzJjl*"jl%"lH .o@:e le "5r `g0̘0@ZNmg@:eJ Zea l!Rѓjlb*вld*ϲlk`+k` +@k` +dz`+Ƴ`+*`òD"\g0,0LIBJ "AD"A"TҐ\KJ@:e 0𬘞egPDZM@:e e!.0LJW0LJR0LJM0LJH!F**" "0LJ4!!ҍ0LJR\g0,I`0LJog0̘0@Z Nm@:eJ Ze_`0L0,JI!`\g0LJi#@g0Ԁ#@dkTZ#da0l:Kj+@^,0 !zMl@:ed0LH J!\g0,I "gT!@:e eu0, I*0L]Jҥ0,0L IJ_0LJZ0L Jґ|g0l]Kӥ`kӡ0l: KL@:e   0!@zMXl@:e0!њMl@:e?*0,0LIJ0lK!*0,I0lZK0l:K D@  @j @2i deKa@:ege4"@b:eo@n2A 1E 0L;J jDj@@P3H@:eIje&D"@:ee*BH*bjl *I" "pD@:ee " k+'!`H"ra7|H'8(9*:+ h+bjl *I" "pD@:ee" j"'(ꢛ*꣛+"h"@:ee "A2 0LzJ j jj1@P3H@:eIe"eDJAgPjL[XgrxglҐPg:e@+Ұ\@:eg'&+(:e@72F&Ґ\GJg@:egg@:e 0LzJ j j'&3H1@:eIҗ@|JRr` "7"҂g@8ee*Q7"8*@`jl@"r`aTm7@:ee "Xno@:eҞe *$l7go@8ejeN"@8ee-"j@O+"P7@:egPe@:eC᚞e/0]O0@0̙Nm@:ee&QҎ %@ n@:eeH@:eeYHl.o7@:ee-l@Z*H@:ehe[0𬙐L M@:eHe@:ee[hL@:elg@:eo@7 0LzJ j j2@1@P3H@:eIe"eD JAg.raKj@O+"\":e@"gBYg@Lg"KCxgec/0]O0̙0@Nm@:eeE '@ng@:ee0L0 J7]O&H@:e"en[L@:eJ0reHO?`5"A&@"0@m@:eJZeara70Pmj, j`s a@("FҐ\Gl&@:eҞe` "K kl "j+KbgDjl*$"I "\LJ@:ee" ra0L{J.Ґ\lJ//FG@:e(Ҟe"!"!j@A( raDj "2k^2lLPj ZXgrxglr`@@@:e*Ҁ"dj *"$lMon@8e%**j"F&G@:eҞe*H'@:e* YDl@:e@e`C#@l " raj&Ҡ( ra0L{J.j+@/*+*"$lnog@8eej jJ",rar`r a@jҰX&(O*k@@lH"FҐ\Gl@:ee:"0On@8ek2@@񐚬 +|JB 0LkJ jj3H 1@:eIjjera@gBXMK" ("`ra'@:ee"h+ Ll,CD$h&j&=0LJ@'@:e(Ҟe"(I5djl@"j :*&"CD2*jL*.+"lM/:eo@g. j 2*1@@P3H@:eI(e+j((C?"!@@l?""r?ak@jl"cCnDl "j&FG@:ege* j 0LJ&%k`w j "r`2(kJ2l Mjon@8e#jj[+ "@j "CCnDl_*jKL(M\@:eggk Jg8e@Ґ\FGJ:e@2 .3 kHkg1@:eIҵ7gҰ@"@:ee_""log@8e2@@p r!a0L{J j 7j3H 1@:eIjje&0LJ&"eDSJAgB E*&@:e"Ҟe<" 0@!:eO@nA2 E 0LJ jj51@@P3H@:ee"A"5FJ"j!r?`#r a@XҠ(@ *FҐ\Gl@:ege"$"jҐ\&Kjl*Fn*I "\gLJ@:e"&FlJGg@:e`*kB2^2lLjl`*r``@@@:e` "$jM#ЧBS""@:e ҞeJ"j0@:eO@nA2 C E D1 0L J j!j5@@P3H@:ee"A"5FJ *g`j ҁG@JG@J @:eҞe="`0j ;eO@na0LbJc2 d f e j#jj 1@@P3H@:eIejr@`rxg+@j "7o$l@8ejeI#"Kbg`l "j@UjҰX *ykBllbgbcc#|kkmB1&"kBBmgB)@:e3Ҟe"00jnOZMl@8ejecjKl#kmC]g@0@1@:eC]ge@0@1@:eD]ge`0@1@:eHE˞e3c$ $ lc"eDSJAg!"!j@My$ jlҟ* l"GҢgHn@:e 2F"Ґ\GJg@:e  3 0l;K kH"k1@:eIr` `j@@:eo@N$jFGg@:ege*&*`j"!r `ra\_m@:ee"jno$l@8ejej"eDJAgNG@J"jIjIj#NIҐ\FG@:eҞe"FraKg jL(nH@:eҞe"\FGJ@:e 1g 3 0l;KH kko@:eҞe" M^2LiF"(\FGjg@:ege*GVF "@:e"jFKkL<#k kl*FGFgҐ\J@:e}g`𤫀k1%#0l{K҇@3L kH kn@:e"J M^2LӠk0lKIh3mE!lqr`@@:ee"I*IFGl@:ee"Ino$l@8e%e"%j@jұ8gD @:e$җ"0j$nO@8e@eX(jj"eDJAglg`j;eo@70L`zJ j jj "eDJAg pd P@@ @j) @2ideg-0LJwd0D7Dm]pHNiL@:ee"iX0L BaX)J.*0]OPD0M@:eIeI |Oji @2ide&g&g0D@ P" g00Hg:Ml@:eeg@8evdj  @2ide jZ*@hB$a|g PT`@+\g4X@:eekm$a`@` "\gh0 0`\gm0PL6ML@:ee*wdh4K2I〚,H Ba\g0m$ML@?eB9e@ej) @2ied r a;,@0@@:eA@kefڐ@ngAB\L@:eA0De@@0@@:eAajeFہ k`̀`aA`AE*iL@:eK؞e*0,:IM"` l`A0@@:e lAAeB0PN@:ee*AB0Pl@:ere aAk`C*0,z IsG *AB\nL@:ekr`0,I_jg @2idbҚeg8#AgrJaEFB`N``JCn@?eBGZxgsxglBjdd raEFBLM`Nan`JCL"lej @2ie$d`Wraj sr8`tR`hr2`mraj wrjD3Ml3p2kH2P0C0j@jA mn@:eDٞe\g @@:eXe\gL@:ede@Jkhm($s%` ga٠m@:egDـjle"AOj\gL @:ejebmBo= \g @@:e *` C'`jl%*Pgbs`ss!`is!`g g٠m@:ekeDAB`k JqL2Kjjhh" H6Y N m@:egDBkgmle *@xra`bJlBH\g0P J J*DCٯ @:eҞe\g L/m@:e Ҟe\g0P g l@:ee*\g0𬚚M * C` D@C` `CXg*\g \ng@:eHe Ҵ\g @@:eRe@`HbjKlB R da`HR eb`HR fc`HH G_?%@hBK[`k+wknZXggrXg0P @:ej 0Le @ * @xrXg* @ iAgpD  M@:e`"PD @:eҞe*0\gM*H@:eB iY m@:eg e"C=` IC_ a\g \ g@:e e\g m@?ee Ii J3* j@\g m@?ee @]*8jnұ ` iCJK%.uaMĀ$JCԃg`# \g pD @:ee* JMCg1b3ADg`Jk @:ee _# > @JI  k ba JI ҟg H@:eA0D @:eDٞej Rabjl?*r abjJl#"\g0MTrabjJl*E"A"\g0MB\g0D@`f٠ jE\g0D@|fـ<%hljB %Eghml;""eD9JAgej @2ie\g30Dh3@ikd쀚 `ej @2ide\ggHL L@:e"Ir~s`S#raNkb2dd.knKB2jje @2idҚe;O-# OOOOOOOOgOO+0u>OO-7O6u%%Og&;OAK(JOOOOOOO'O=#OOOO;O OO## } _OO OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO>O=(;F)%(6OO$;;;B0u[)O(OO6u6>&=gF#ODc8w9O4c?>&OOOOO-OOMOHO&&'C!OO?OOOOOOOy u O%OO&OO#9O&1(7O k o67I*OOOWBOe%#%#OC!OOO%'gOOOOO6OO?Sta0𬙻 MhDK[`SkHDJZ aP@=eejtoN0P Ґ`rb``r`g @:e P J@:eeB*0 аP @:ee"* L0 @J"*0<M20L Ҿ" HnbmI L@:eg0P@:e 0D@:e@0De@paؠ 0LI J g0P@:e H nm@:eg0D@:e@0De@paؠ *p0P g @:eP=e@gОe(\0LI J H (nm@:egg 0P@:e @=e e"g0P@Nl@:eReaajAjH0Das@ati *0D@:ege"g@m@:e0gmI L@?ee0D@:ege"g@mwM@:e0gmI L@?eejg0P:e@ g0D @:e Ҟe"j 0L& g@:e@e"nI J҂gH!m@:e @*rlaA]* !m@?ee(pL @:e Ҟea"0LҐP @:e Ҟe_* g@ (L @:e0LI J ҁmg@8ee* * _" mA8e @ m@8eҞe  @a @:e  Ӟe@۠ ga @:e Ӟe@ۓ0 nLP$@9e J҂gH@:e Ҟe" ir~s` S#r#a#s` z"g J@҂gH@:e ce `K UpD@:ee^"(_.r`:e@g ce `K UpD@:ee_"H( @:e I KNg Yam@8eg p\ e@:e0\ eM@:e\ e@:eD eJ@:eJ *0 n Lh JҺPjlr#a nam@8e  `e( `pD @:eRe`D@ m@?ee m@:ee mA8e @ m@8e e mA8e @ m@8ee ҿP)l@=ee "g0P@:e 0L$nI Jg Hm:e@ gL /m@:eb"PP g@:ege"p\@:egm @?ee"eD JAgP@M@:ee *p\ @:egmjG0D@ " $nm@:eg /m@:e B"PP g@:ege"p\@:egmP @M@:ee*p\ @:egmP @M@:ee *p\ @:eg mjG@ jP @M@:ee*p\ @:egmmPl@=e0De $0D@:e@D؞eA0LJ@D:P:l@=e0De $0D@:e@H؞e%0L;J@H"eDJAg/m ҂g\@:ee *pD0 M@:ee*0D 0D@:e H؞e"eDJAg0 jNH  ҂g\n@:e L0 e @"Jg \ n@:e ‚X@:e Ke "\ n@:eH@a_@e"\ nJ@:e0D|@e d"eDJAg0;M"eDJAg0D0D@:eH؞e"eDJAg0D@:e0D @e A""jAH @p"eDJAg"H00nmI L@:elhmkeaڄڥb0D0D@:eT؞e"eDJAgj0J8e @g "g@8eg"TJ@:ee *0;M"eDJAgP @8e Ҟe\g0LI J * !m@?e0𬙞e[M"eDJAg "g@8e "H n!m@:e0d`eUkb ` aJe"eDJAg0DPD@:eD؞e*0[M"eDJAg0D0D@:e@L؞e"eDJAg0DnP\m@:e@P؞e"eDJAg0D0D@:eP؞e"eDJAg r a0{ M"eDJAg0D0D@:eL؞e"eDJAgH0na mI L@:eg0D@:eB0De@dCckaؐHs ah`؀"eDJAgs a|`"eDJAgsa``"eDJAgH0nmI L@:eg0D@:eCjB0De@d`ڐ@r ajB"eDJAg@r a jB"eDJAg@rajB"eDJAgg 0P:e@ 0D 0D @:eD0Le "(nI JgHm@:eg @:e j=e@@0Pe @Nl@:eRe ajB@liؠ  0P @N l@:eRea jL /m@:e @:e @jB e"g0pD{M@:ee"pD0 M@:ee"D :em@ p\ e@:egm @:ee"eD JAg0Pg:e@ 0LnI Jg Hm:e@ PDg@:e e@*p\0M@:e m "eDJAg jBCA0D@L ҿ"jJ @:e /m@:eҞe "gPJ@:ee"@0 M@:e ne2*CgJ j0P gl@:ee#" (nm@:egJe*jEjD\ng@:eeF" CH 8j0P g l@:e" (nm@:egJe*@jEj nm@:eg0D @:e@jA eAB "JrajA gr^aj BH 0Pg:e@ g@0e@:e`@T e "g@:e @ 0D@:e H@e|JK".l`>+ "g@:e @ e@:e`@X e"g@:e@ e@:e`@\e"g@@:e`e`@"eDJAg@saJg0P:e@ PD @:eeg"0LAmI J ҂gD @:e e`"H HnA m@:egj =eAO@PL /m@:e`"g@:ePJ@:ee *p\ @:egAm ;G@ Jg0P l@:ee"J!R ap\0M@:egAm kKdjNذL@:ekLPe@:eDeBL@:emEeM"sr` @:egeA"H@:eZe9ap\0M@:ega mpD0:M@:eҞe "p\ @:egam@ PT Nml@:eonP@ml@:e @:e@ؐesr`a0D@`q"eDJAgG@Jg0P l@:ee"JR ap\0M@:egm4 ARiaH nl{m@:eBCXgKi\@L@:ejN @PG@!Jg\eMn@:e@OLOLLPX:e@MM@:ee"sr#` @:egeA "H@:eZeap\0M@:egmjKҢpD0:M@:eҞe "p\ @:egm@ P\Nml*p\ @:egm @:eg@:e0Pe @ Nl@:eeA"N(*DEؐsr ` "g @:egeA "H@:e0Zeap\0M@:eg mW0P@ Nl@:ee*p\ @:egmBG@Jg0P l@:ee""jN@!L*\@nM@:e0Pg:e@ le*p\ @:egmsrXg *0D @:eBCؙp\ @:egm$PH*m@:ee"a+`jON"P@R `p\0M@:egm0D@dq"eDJAgsr^apD0M@:e*Pl@=ee"eDJAg0D @:e\؞e"eDJAg$0D0D@:e`P؞e"eDJAgPH?l @:e0Pe  g@:e0@eMg@:eeW"0D H@g H@:erea@ * @l@:e je C`b@c`]g pH@:ee"HbB`ca`n`AgA@m@:e e`\DgJ  raғ@0𬙐g M@:ee"0D@`Mp@@:ee*"eD[JAg@0𬙐gM@:ee^"0D@L`M(P l@=ee"eDJAg򼙐g@=e0pDe;Mg@:ee*P6l@=ee"eDJAgpD0𬙐g;M@:ee*P7l@=ee"eDJAg0D0D@:eT؞e"eDJAg0@0D@:eX@ket"eDJAg0D0D@:e\؞e"eDJAgP(l@=ee~"0LI J H (nAm@:egg0P@:e 0D@:e@jH0DIse@axi *"eDJAgsadi`sakh|i`sakPMl@=ee" ҂g@=e e^"gL/m@:e Ҟe "gPJ@:ee>"g 0P l@:eregc`0P l@:ere>a * jJh"eDJAgt a𐛆P"eD% JAgL"eD% JAg0P @N l@:eRe aj kGaB"eD{ JAgp\ @:eg m "eDJAg`i"eDJAg򼙐g@=e@/raH0LI J Lg /m@:egH nm@:ePD @:e@0De@񄚁d^ @*"eDJAgjZp\,nmL@:eJ}KNWҐg@=ee/ @/r$alA@ ҂gg /m@:ee*@ * jZ Е,"Sr)akZm! 0L]J j 0L]J ArapD0𬙐gM@:eeZ*jZ\ hZ *J ҂g @:ee"Z *0@ @:ege>* kZl"KT@n* *yКP@KNJ@:ee" P"JN`Hg@:eJA`Z?+@kmZ@#raA*@yg 0Pgl@:eRea j0P g l@:eReaj0;M"eDJAgXJg@:ege*GAkklkZl"M^$p@=ee"eDJAg򼙐g@=ee} 0Pg@:e Lg/m@:ege)*jKJg 0Pgl@:ee#"JAG* jJ o PT@:ege}*"eDJAgPJ@:ee"g 0Pg l@:ee="JAG*jJҀo P\ r a0[ M"eDJAg`r a0𬙛 M"eDJAg0D@g J j=e@A@BW @/rTa H L/mg@:e Ҟed"pgjjgK.t `"pD0𬙐gM@:e)" '"PDg@:ege"H0 nmI L@:e bp\em ng@:e  0 ]HH0 nmI L@:e L҂gp\em n@:e0L ]JeA} @} "pgn@8*H06mI L@:e 0P g @:eg0D @:e@CgJe(Jb+ xb Lx"eDJAg,raNK @Cg0 M"eDJAgPJ@:ee"JS`jJ%ba0DJ@ x"eDJAg0D@MT@:ee*"eD[JAg0D@M0D@ M0D MPPl@8ee}"g0pDM@:ee *3l@8ee"eDJAgpD0<M@:ee*3l@8eIl@8ee"eDJAgpD0:M@:ee *Ll@8ee"eDJAgpD0< M@:ee*Nl@8ee"eDJAg0j L $P M@:ee]"@ leSadk l"eDJAg pD0𬙐g"M@:ee*P1l@=ee"eDJAgpD0𬙐g M@:ee *PHl@=ee"eDJAgPJ@:ee"0DJ@ l"eDJAg0@@BT@:ee"@@d +kx"eDJAg0@0BP@:ee"@ TR} `"eD[JAgPJ@:ee"0dJt` a@T"eDJAg t a@X"eDJAg@taRaj@\"eDJAg t a`@"eDJAg t a`D"eDJAg@t a`Hj`L"eDJAg@P"eDJAg0D @ k` (k|"eDJAg0Pg@:eg J Ңg@8ee"J2R a `\ " g@8ee"Jkz+ @`"eDJAg HJar aj"eD; JAgjJj H0nI L m@:eJ`0d`te`aZ }""eDJAgj[0DM0D M0DM ҂g0P@:e Ҟe\g00D '"H0n!mI L@:e 8e@ 8e@@A e@ 򔚃 t"eDJAg 8e@@e P"eDJAg ҂g0P@:e Ҟe *0\M"eDJAg0 @BT @:ee"@ B @:ee"@| b` `"eDJAg P0𬙐g~ M@:ee*Pl@=ee"eDJAgP0𬙐gM@:ee*P8l@=ee"eDJAg ҂g0P @:e Ҟe "H @:eZe a0\M"eDJAg0D@`W(H0namI L@:eggp\ e@:ejD@`|e`0L ҂g @:e @e "H@:eZe` HnamI L@:egDEp\e@:ee *"eDJAgpD g@:ee"0LnI Jg Ham@:egj@ ҂g0P@:ege* g m@?e0𬙞e| M"eDJAg0P@Nl@:ee"0P @l@:ee"0D@`c؀"eDJAgL @:e@؞e*jJKLMNOP0L8nI Jg Hm@:eggp\em8n@:e o Ңg!jKe@*0P @:e 1"0H @:e" D" 0TL@:eK ghDK` gf +bggK[aL \`M,ra JJ j 0P @:e eA۠" J CgJ ra0P @Nl@:ee"0D0@Mllk`؀ FGK ҂gpD@:ee *jhmHP@:e Pe@:e ce`FgGf r`L.m ҂g\@:ee"0P @Nl@:eRe ahjmHfGnblf"p󤙐g@=e0𬙞eM"eDJAgI"p󤙐g@=e0𬙞eM"eDJAgP@ @:eg0D@:eI' r_ap󤙐g@=e0𬙞eM"eDJAgpD0 M@:ee*jg0P @Nl@:ee_* r] `M.m ҂g\@:ee+*j Jn* H2Ji0XM ҂gpD@:ee%*Jh@mH"eDJAg0P @Nl@:eReahjmH r`jpD0 M@:ee *hjmH"eDJAg @"H @:eB e@dr`eR`MrK`NR`Dr`HrC`jSrC`Wrajsr=`tR`hr5`mrj ` wrjD3Ml3p2kH2P3KH2 j@ HDJ Z a, Jb`p\0M@:egm"eD]JAgkjjK@ @:e xex[`H}`xj@"eDJAg0L8nI J ҂gH m @:eg0D@eXLؐrXgZXg@2L2@jKEFB0P *@"eDJAg @:e\ e:m@:e Ҟe" !kk@eXglIr}a AeXglDrua B:rXg o* C*raj`m@\ :mJ ҂g\@:e!" ҰLnog@:e J *p𨙐g@=e0𬙞eM"eDJAg @=eH e@:e m@:egeB"`jm@ A C` IC>a\ @:ee_ ` iC@0 M@:e ne"@0𬙃g M@:e ne* nm@:ee a E0TmL@:e e@@0 M@:e n *0TgL@:eF؞e nm@:e J BBLnOM@:e @Je * gm@?eE kgK؃\ .m@:eeJ"g 0P l@:eRe=a`G jm@X" k*#g'aHԜ .ol@:e0@eԚPDM@:ep𨙐g@=ee"eD JAgLH @:eZeNa JI @dr`eR`Mr?`NR`Dr`Hr7`kSr7`Wraksr1`tR`hr)`mrk ` wrkd4q43h3p4oh3 k` n`+ &@ @:e xexZ#`xj!lkkj jgL \a s` #@pD0 M@:ee*JJj[nMpD0 M@:ee*jJC"p𨙐g@=e0𬙞eM"eDJAgPD @:egC*p𨙐g@=e0𬙞e<M"eDJAgT@:e"`jm@pH@:eD؞eh0L nI J ҂gHm @:egjBA@0De`D*0P -bgB* mB0T@:e 0@ e M@:e neC* nm@:e`a @؞e` L" @:eH e@:eZ`j@0󬙁@=e0󸙀@=e0p\e\M@:egm"eDJAg@0 M@:e Ne+ aaAظ0j @@=ee@|*r$`R`r `rXgZg6pL@:ee"eDJAgrXgZg66nn ҂g0P@:e Ҟe|"gH@:e Ҟe| "0LnI Jg H m:e@gjA n m@:e BP@ @:eg0D@:e *l@ JI`+`jA @:e@0De@lcؠ "eDJAgpP@:e e "0g@8e0D @:e jJH"8eg@g @:e 򼙐g@=e0PegJl@:eR-` g@:egjJH0nI L"m@:e `aJec d0d`񜛅ڠ\"eDJAghpP@:eeg$PJ@:ee"H0 nI L"m@:eJ`0dڞe`񔛂T"eDJAg0LnI Jg HB m:e@ gjE j@pP@:eE *p𬙐g@=ee"eD[JAg0P @:e =e@H e@:eB Bm@:eBDAeB C2` C~a\ @:ejCjBe%"gPJ@:ee"DJ`0D@|fk|"eDJAg `CkDk0LnI JgHbm@:egJg0\eM4n@:ejECDpP@:eE "g0P @:e ҞeF*0󬙅@=egm@?eeVP @:e Ke -* g @:e @0D @:eAe(*ABjF0D`@W*j\"eDJAgj H2I〚,P @:e"g @:e P@:ee"AjB "g0P@ Nl@:ee*D @:eC؞e0l.\BA .@:eegF*ܦ ҂g0P@:e Ҟe<"0L(nI Jg Hm@:egP@ @:eg0D@:e =e@GG@JҰL @ngM@:eAJe*Dǘ :e m@ p\ e@:eg m"eD]JAg0D@xiؠ"eDJAg0LnI Jg Hm:e@ g҂g0P @:e Ҟe*p\ @:egm "eDJAgP@@:eg0D@:eD eҐUr#a@0 \M@:e ne* g@:e  @e L@:e eBӀ# j @ O* @=eH e@:egUr `jr`@* #J+m @:egC eCH` C}a\ @:e rei` RX`Urb`jr]`0D@tfؠ"eDJAgpH @:ee * :rajJҜj  ҰLgo@:eg@m `C(*DĘ :em@ p\ e@:eg m"eD]JAg r `rajjAؠjjj\g0D (@ ktKx"eDJAg0Pg@:e g@B@8ee *0|M"eDJAg "Mg@8ee<*TJX"eDJAgH0n"mI L@:eg0DJs@e ahaj 0P <sata3saxa sapala  @:e 0H@:e"J0T @:e  e* @"eDJAg0k@x0L  Ҽ" nI Jg Hbm@:e 0P @:e 0Pe l@:eRe `p\0|M@:e bm#@ 񈚁h 0LPnI Jg Hbm@:egg 0P:e@ ҂g @:e Ґre0ajO "g\*m@:ee#"jMذD̘ :em@ 0p\eM@:egm "eDJAgjM "0P gl@:eQ"L #m@:ege-*CjN0P @ Nl@:ee**D *\ *m@:e."j 0D@ls 0D @:eL e*T@1M@:ee"O"0P @Nl@:e"j  j 0LnI J҂gH m@:eg0D@ hd jKCjA 2"g0P @:e ."g\:e@ @:e &"g @:ej L -m@:e Re`0𬙼M"eDJAgj j jj0P gl@:eRea0P @Nl@:eRea r a0P @Nl@:ee" \"g0P@l@:eRe`p\0M@:eg"m"eDJAgAcl*P@:e Pe@:e ce`g 0P:e@ 0L(nI JgH"m@:eggp\em(n@:ejB0D`GC|KyJa+G@J @:e Ҟe "0P l@:ee "jbmB  `GCJi0P @ N l@:e(*L /m@:e Ҟe *0D @:eb` u lgeAl P-7,0M"eDJAgjpD0 {M@:ee*JblBpD0 M@:ee*Jp\ @:egBm4llt` lb +0𬙛M"eDJAg$k #+ "0:M"eDJAg"PD @:e@؞e; *jKJh j 0P * *0M"eDJAg @:e Оe  j `PJg@:ee* PD 40D@X](H0nI Lm@:e`e^ b cJ` JI gj ҰHҀb, " j`H @:e @:e `* @:e " *0LI J g ҂m@8e m@8eer @:e!"0LI J g ҂m@8e m@8e0𬙞eM"eDJAgyj қ@:eHe* " Ҕg 0P@:egPD :e@  Ҟe\g0LI J * m@?e0𬙞eM"eDJAg g@:eg"H nm@:e0d`eY `"eDJAgjKLMNOP J*j Ұ0 mI L@?e0𬙞e<M"eDJAgj 0PJ @:eAX" HJr aPD @:e "K@8e"L@8e" r@a P@:e Ҹ"H0 nmI L@:eg0D@vg @0DM:e@DN@:eCO@:eB eAEF"eDJAg raj 08eg@ ҂g8e@ 0LnI Jg H m:e@ gj@P @:e*D :em@ 0p\e<M@:egm"eDCJAgPD @:e@؞e" C"j ҰLnog@:e Je"jED0D@xd " m@:egA eE C` IC}a\ @:ee"eDJAgj  ` iC08eg@ ҂g8e@ ҂g8e@ 0LnI JgHm:e@ g0D J@xdP@:ee *0\M"eDJAg " "PD @:e@؞e"\ :e@ @:eH e@:eH e@:eYN 1m@:eJA`H e@:ea AAeJH@:e egc:`Ca\ @:eH e@:eaJIH e@:e egc`C a\ @:ejeD"eDJAg C` C`0 g 0PI H@:e Hng " m:e@ gjDjCPD @:e@؞e*p\0\M@:eg"m"eDJAg0D@wd ,"gH@:ek{+J "mY @:ekA` eBB#x;e ` +AS"eDJAgj ,sN`w a j_Dgg M [`gm``K`jJj0Pg:e@ ҐgP @8e Ҟe *0|M"eDJAg\g0LI J "g @:e @8e Ҟe*p\0|M@:e bm"eDJAg r"g @:e J@8e#* b m@8e0p\e|M@:e b m @8ee"eD JAg@"g @:e @8e* bm@8e0p\eM@:e bm "g@8e* bm@8e0p\eM@:e bmH nm@:e0d`eUkb ` aJcde"eDJAg *0𬙼M"eDJAg0P @:e Ҟe"0L$nI Jg Hm:e@gBp\em n@:ejK@ e ҄ `HCJ Z#a-+@ @:e@ ҂g @:e e+0D@}+kh"eDJAg K  0P l@:ee"CjamA0P l@:e Ҟe "\@n L@:ejPD @:e Ҟe'*\g˜D .p\0M@:e gm"eDcJAgA m@:ee  nm@:e ` ab+Btga+Ao~PJ$PJ@:ee"JRa*JJ0DJ@d"eDJAgPJ@:ee"JRa0d`@"eDJAg0M"eDJAg *jJJR Һ`(!R `H0nI Lm@:e0dBt`eaH aڇB\ nL@:ee"eDJAgj"eDAJAg "eDcJAg@xd@KL@Qj @2idej&\gpP@:eke\g@`j@ raj @ rXgZXg \g0X @:ee*|g`@|d Jgj \g0L@ ""r+a\g!@Hg@:egeB\gg0L@:ee@ ""r$a\g!@Hg@:egeB\gg0L@:ee\g Hg@:eeN" j@jH ҿ\r$a\g!\gL@:ee"tq#a jA\g!@Hg@:egeB\gg0L@:eeg`j n,bg`Hnqa jbqajrqa jeqajJ ra ##kn) @ r`\gH@:ee_"B` s`Ik`*\g\=m@:ee "!B` s`lca` s{`=sy`(\g0L,J2i Ҁ $\gpD@:eeg* Cs"\g00L,J A[*o)@ rqaSrn`@ rj`\g0𬚜M|g0D@p\@:eee\L@:e0Le|L@:e0LeL@:e0LeL@:ee Cra\g 0Dg:e+ Ҟegg@m@:e gm@?ee0 @< OgКjjD;J@:ee*0n@<LF0mvM\L@:ee@ kl*`Zr a0@@@:e[Ȟe r``K+ @p`H DDg*Jadu`ua0n| LE܅Br` a0@@@:eCȞe r` h +0p\M@:eePg H@:e𤘞en[L @:e0D@:eH؞e]U ҰX M*D*`jl#" * nCm@:e  @ kab0D@:e @eu؀D *0D@:eD؞eU$*@kKL(+&$$$ lL!$0nmLc B * 򰘀 @:ee* G Ҡb+a+daGlLz$j+P"`#0nm L60𬙐@M@:e V"0X  Ңg @:ee2"0 @=Hg@:ege"pD0]M@:ee*@lg@:eg"PD@:e\" l@:eepT @:ee\*P0n] L0n@=LP|#0L.(@b ,,,$glLb"0\0̙0𬙀0HNM@:ee Bz"@.m ҂g\@:e Ҟen"PH .m@:e Nec+ @ H@:e He@:e IJZea0 n} LZ p\@:e@e M\@:e@e\@:e m@:e@PD@:e@؞e*0nmL"eDfJAgSl_"0nmL"eDfJAglL_#Al_*Pl@=eP l@=eeD *D~deuj @2ied@@No\gL@:e e\J\U"JUj J jam)" ``LJ`L\gP@:eZ~dK"e DJAg(?* JJa?"jdg@0@@:e 󤘑g@@=e je ljK jl lom5e ee$@@D@4@jV @2ied|gX@+j"0Do@̚"$ҰD@:e l`jeP@X*% RaHBR`\gpP@:er8ge)g Jl@jj@;eeo"K]@2M4B2g^0 @20M@1p\gpP1耫@:egegkp\@:e"ge4"R@!pX @:eSe* !*"Cg$\g\8`0a#AH3m`z#`0+#Jja+`n` "\gp@"@Bc8`@\g0@@:e@ke@I+5ȚKJ\g@8eo@lO@:ee(\gg@=ee-lknmjg@:eОexdeeeeeeej @2ie\g0D`j "H*n#l#U j jeju @2ide\g0$@j( "\gl00M@?evdO.*@r+a\g0Pm@:ee!*@|g.oԚH@l@:ejeM@|gԚ00HM:e@ljeej @2iedgX0 @MjҐ@$g@:e Ҟe$*T@:e0\e@:eg00(g=Ml@9eje `n"p@8e0l@=ej 0X @:ee *pT @:e0@\gP\ @ ) m@̚\gp\@:e @el0\gj3P\ @( k@#h+ XR a\gl00cM@?ee j% @\gp ( @\gp ( @\gp ( @\gp ( @\gp ( @lȚ\gp@8ee @l+d#񘚐B\gpH Ҡ , @ B\gpL Ҡ, 񜘠, ,\gnpom0l@8e k@e@l2"|g0L0J ҂g@M@:eje*gT@:e0\e@:e0 0g=Ml@8ee g@p𰘀@=ep@*gpT@:e0 0MlLk @KL## kliK |g"Ù m@8e˙ m@8e gm@8ee GA)J  J  \gH !g\gH@:eB  @:ee*JL#q` $ @:ee"ij@H H,$ @:ee*\g Lno@:ereapg@!*\g0Pgl@:eRe`\g 0 ZM\g 0 cM0l@8eK.r`J Zi`K @X(j i @(\g8n0PLmiL@:ege?"jJ@jKDE @xl؀@q-@ؠa ck Ӏkm|g@0,KiI *PL n mg@:eK؞e"BLc`JCa`Kc~`耘 j"GjJ` \gPg@:e Ҟe**\g 00 zMl@8ee\g 0miL@?eh\g T@:ee" @\g8(ig`jl" @9ee* j @kKL#\g 0 M4$G*F*@raAZ `\gn\L@:ee_" 5g]\gn\@:eKk`kakefg J mg\g pdej4 @2ide\g0$( ud耘Dra\g\@:eeDr`@a 󐚁 gJ1D"\gm0IL@?e`0C Te"a Л PEgBj @2ide\g10Lg!QΙ1*&\gm0)L@?eeN\g0D@|qq|\gi𼚇@EL1@=ee26$\g@=eeg-$j, "@!-"-#-"hs\g(n0PLm)L@:ege *I&(%\g Hn@:eҞe* h`@raA@D)ECH1\g(n0PLm)L@:ege\g \ng@:ejeg@:ee"P%ja*jLR(nG`n\"\gp@"` 󌛌LjL3*|ggL@:eeԘ@|g?lT00HM@:eegB L@:ee*LҺjLCJCHkl.*@@ln J@:ee!"`󌛌L*\gL@@:e`egg\g00Hԛ M?l@:e mj @2iedgX @n\@:e eh*5k)0D`@Le"@񈛂aa$g1J+1Z Qadj \@:e {+0@e:e@1"ge\g0D ts?a)f"5nX@:eJeY*T@:e@}re` ra J h" Z5`pPg@:e `e@񌛊`B1  i j ҽj ҹ)!" s5ʹan@0@@:e"ge @@(\@:e {+e 6*4"Tr aL@:eje2nm@@:eZeXg `n-"p@8e raL@:ejeLn)m @"j@ nm@:eOZXgerjj ~dej @2i deD@:eJe7*<"jkDeB*H T@:e0\e@:eg00H Ml@:eejeBDm" OH =l@8e~d<jB./ .Ę aŘaƘjaǘJ`Gؐ\ إ:e@f0eegXgg@:eRea./ Л@"G="`@jl*A l "nmLe@:eePXD@:eJe"P@:eaBҞe\+D@:e\Ee@:eeU jҾ|gP;#E@:eDno@8e@e| `DhKch`dڰ\@:e`e@@dJ@@"ePT2JAg`@@:eEo8e@np@el@:e\De@:eEe D؀ $@=ek@ehDnm@:egJe"jKLDgm@:egP@:ee*;+j10D@Xg@:e` ">g#ҐHg@:eҞe*@P!j "jl"\!.m@:e*!@"L!@:e "ҰКpT8@:es"X=n@:eZ"=K_@2M4B2B2j=&+I" & @@l@8e@򐚰H@:e-&\r0af@ B AkZXg  hCV2lmgX@:e% 3jҵo%hj%jh j#H2,ҀjL (,@i@EJ*#?!2 JCjjLC!@:ee *j "l@=eCJ}`33C]g`3@0@41@:e&@NTjUeVW(PH0@h3@ij*[J*Tnm@:eg[Je"j@@@INo-M@:ee*\@:ejKe[(J"J2ja#(ja(ҹjHjkJjIk@KHg$Cnm@:eHIeBCXgIj@$eHBnm@:eG@J\$L reWaj]T^j_j`abҠ5L5\@:egP@:ee*T@:e`e7#KK[`+jFkl**.*L r&anPH$@:eJ"*@L@L@:eg0`0H?lԛ M@:eeZjnj*,@@i@e@kl@*"0no@:ee"&@pP@:e$0F"$GpHFa mL@:eFGe""PP$o@:ee" JC$ Z aBR`pP@:erea$@Cjj!@:ere aCL}\`3M_C3@2+4n*`l``nj!@:ee"@@oN򰚰L@:e1klC$kmCAZxg@@Ry`-ZXgm l &Ү$ ҰT@:eg je&*(? >Ґ@PҐP@:ege*p@m@:e\e@:eTnoT@:ee*@R`\@:ejKe[ 0@H Mp\@:elkkl}jgҡjEjjoZAD"p@m@:e\e@:ejKe["ePTs JAgL"ePTJAgj}j{j*J*@*B*&$"]g@0@1@:e&eX|gtJ9e"joj\Xg g@:eg'l@:e0@ge1@:e&@LjN9MnOTPoM@:ee?"B_"p@m@:e\e@:e0Dk@e@hj"ePTsJAg0|d @@  8  jK @2ide gLX, @%PP-l@:e,H2j Te Ґ\ @:e"gH,e@:ee=e@ggeg PT @:eRe ` Bj}`@-J"P-m@?e0$@@@"@@j  @2iedg0$@@@*jwdjҰLlno@:eg"k@jl"P@:eg\e.m@:e *T@:e"@`n?e@N@p`@8e@`H A"p\@:eg" XL@:e*ejJ @2iedkj,?k\gA60L@d<k=jB<H"n@:egJe*T@:e@re`%`n`"p@AL \gpH a@]O:m@:ee*g?m@:ee<Hn@:eJe *T@:e@re` raB jlҷ*RapDA2@:eex*2'3A( \jҀa@mhl*@0@@:e@Rj@Pmd@lC`jKlҐX:e@g@@X@:ee"gm@@pD@:eҞe_*@`@FaBB+fj k\N2l$Pn:eC@`o@e`*(^!'"a+bs ac[xgsg` [aKCO[`ivhu"j d#+*t `J$.MQ〄$&raLg@:e*0gM0l@?eejCK"@"engC@:ee``@F"@r aT &(jGoFy#hn"XRno@:eҞe"An#ҢBoB\@:egeV"@nm@:eejK#@p\NmC@:ee"$&C@:ee"@@6"gCg@:ee"n1g:e@`jed<j=j@A0>``0Ѐ"C@"eVj`n*Mҹj\Cg@m@pD@:eJ"H+@T (L*Lj+C/@.o+l@:ee)*LK|JV"HPԙKNl@:ee "L".NOPTM J+n@:eHPԙ. Nl@:ee "@r#a+)FC##K@c#[` \g0Dr(#cf"jK@@L"0!"l@=e ."e' ( +C ҈ ,$!"D@:ep!"1@?epl@=e1e *d@goml@:ee_"0gFMe $hjl"C@:ee_* %ML'Qs)f"jK@ì %n:e@Kje\OJ*M"n*"`jai`f@hj`LDt0@@:e`NDe *Km@@pD@:eJe*LT@:e0\e@:e0gM1)`jaL@:e-Le-"0DKm@@pD@:eJe*LT@:e0\e@:e0gfMl0H@:eePH"hj`Hh҄hf8*Bu\no@:eҞe"J KC_ajAjBjC kh knkokIqRjKWkJB`JC``D@C\ng@:eBLe(`JCa\ng@:eC\2 LP-Ce`Kca`JCa\n-@:eRje@Ä`D@CPt@0@@:eJh{jHjKs&zl@:e@m@jh&Ґ\@:e`e"Hԛl.og@:e@e`D*0̙m0@NM@:e0l@M`욀Ԛ o@gHO MlF *F *C",,e * R"e""0@@:e RCC7:;l9j8pP6A6ԅ@@:eB2`^2e0*BJZ`A*jKe@=eD=e@ed RSe`JCaC`hC a\n@:eA\@MJe `CaSG@ JC`c a3^ `\@ L@:ej[Qm@eg@pD@:eJe*T@:e0\e@:e00gMl@?e_ *jKF1d0ol@:eeLn<@:eg@8ee*T@:eg@e".oe@lԚH@:e@e0T0\@:e0gMl@8ee"ePTJAg,e0@@:e R˟@sd@j @2ied" @`PKR"`ACB2@AAjBC`Kca`CXg*\gn\@:eJe8\gl00 M@?e @\nDA"jQT ?*jmQT|g\dnoQH*1. 3QLh3mLn lMۀm pa&QH QL3h3i QPkak`QKdFnQHj @2ide\gAl0D@\ *\g D)|dbbFB jl"@jl* (" jL`#\g PTn[J@:ee& jlG"CB jKl Bl7"Ccj3a @jm Bn@:ee%"\gPD @:ee" jL +\gPTJ@:ee " HjMAbJIj}jRa\gÙ00Ml@?eeB\gPT}nZJ@:ege"\gL@:ee`D@C``CXg*\gn\g@:ee@e\g PTd  bjl" nBg[ Jo@:e `AJIe` ej @2ide O@?e HPgvd`*amd?eDg.E``sav`j1d+JCa@Ca+ygb`ejA @2iedg$gLqL@8e#*o4nA@8e"Bjl "AAeL@8e *jL #AAeM%L@8evdMj`L@2maej @2ideDgg%k#$\gn@m@:exZbg`xkG$J"`gDd Ggja @2ideg@DPTgJLqL:e@&gҞe%g 0L@:ee gi[҂gp\m@:ee @@D*i\g0D@@lA"`L@"|gP@:e@e|gg00HeOMl@:eeS)\gr0D@@lt" Lq"` h0g@m`BpHi L@:e"@`@ ao2n@:e* rajCao}n@:e3Ҁ"AoJC aj=;3GAXah3:en@G3gnYg@g r\aEECWa3O3Mon@8eon8e@3;on@8e3=G #;#0lF҇KEE r`aoRn@:eg"AaJ#nuB\o@:e+Ҟe'"#k+C`` `C`Oj=;҆C`#IC\#g@:e+B@$AoJI#Ңg n@@:e "nmg@:e^2kld#on@@:eg "PAO@?eADҡMo n@@:eg"PAO@?eA#@T0L%*D*aovn@:eg "PAO@?eAD@$Abgl*ao=n@:e("A5(J((JB%%5gPL@:e "(*A("@5C(PT5ZJ%g@:e&9e$JPP(FDM+C * ra@PT'`(aoMn@:e *@ҠT*aҞe"%A%bGKc`LaC`fGc ag8en@m\eGnK@:e8e.(D/* B""PO@?eCebgdjC-%0X!":e@AAee%An"n@:ee "FbgCgCgbl"MҵD"E\.mg@:ebgBe0@eL#0̙gNm@:ePZHjo8e@5nLe@:e8eo@6nP4%{H@8ePT:J0@:eKQGjMjN@kn\SOPTR[J+mM@:e`P0PCJPk&A HlJ,gL8eB@ MPe@:epg@?eDbgD0̙ggNm@:eya]no@:ege@"@nm@:e2 re`g" ra**kHl "*n@8ee**M***kHlgm*a7no@:e*Ҟe"8` *B`Ca\g@:e*kAkIe`* r`Z`rA`r `ra\g0D )*@"@kl@"k@Al*0 ' H`\J\"JC00&A0j,PTL J@:ee~(p@@:eҞe~ "I "Bj$L@:ePjMk@=e C@eAl|g "aPno@8ee " *j1j)jh"ePTDJAg*%BM8oܚPH@:e҂gPTJ@:egjD er`C*jlC0@@:eemEPO@?e2R*aj>g!"2PTJ@:e* C"E۠%BneL@?e rajPZHo8e@5n*Le@:e8eo@6nP4%{H@8ePT:J@:eg"">**2Ě!"PTJ@:egkPT[Jn+m@:e0D@PT`(jP/Hn@8eC`PJP)k"0LJP0a,& HkmgL@8ePe@:epg@?e)e> *PjMk@=e_%0X!":e@AAe;jHbjl"/[ J*mg:e@gPTZJ@:eg"/*g@:e|0LJj4%_jK]j4%J2`C r` r a`j"l"Hԛ.oll@:e@& D@"(0D00@ MlԚ@?ee"ePTJAgl@:e"0D @lKlcS#CMC'&000aLT0LJ,PT J#@:e @ҀL-*/ Hg@:e+*gH@:e" 0 h`LPJPC"BjM҉mLM"W "0LҠ($@:ep@@:e"B !H@BIH:@:eҞe "E*$@:eҞeI "Bj$L@:eҞeP@:epg@?eg hCAPTZJ@:e& 0` LTJTB1MC/j& paB&Aj,#@:ePO@?ePTZJ5no@:e pxgeV+ XJXc9mPTJ@:ee"ePT_JAgAJZ"`oiKiygu\@:ee"a +B\@:e*EG@ J`ӁADj0 hLjm{ paNbgcHbgbIbgaBȚ-!M `Ca\-@:eAebg\gPTJ##*=m@:e"PT=nZJ@:ege"`Ca\@:e*3m@:ee"FgM+jK3no@:eeG v"PTJn@:e*:m@:e"F3!"KCgla (C `ko:n@:e*;m@:e"gFgn4!ocFg"gmBa *c `o;n@:e*[m@:ee!"gFg!sfg"gSa+c`!Ki[no@:ee% @`ښq`Ca\@:eZ7hDBp\@:e!kK" D 7 P H*@8eW"*Rm@:e"PTRnZJ@:ege"ٚ`Ca\@:e`-C`-C`C!k`C`Ca6no@:ege"PAHg@8eA#ePThz J@:eAXgneҝ*a8no@:egPT`J:e`@oa2n@:eҞe} "0&@CLxKxa`H,BPT J@:ee"N@8eAne *0!"@=eeV"@ klR"AG8e@AneE*0@m@`@?e@.oeԚlBHM@:e@00Ԛ`蚧Ml@8e@ebgjm@Cg!h"i"ePT_JAgAJAM*"ePT_JAgp@@:ege"a6no@:ege"PAOg?e@ҰgPA#z Hh8e@eAXgjea6"NbgCJ0a0!"@=eP0`& HLCJLL8eA0j,B@Me"ePTJAg0LJ0a2no@:eҞe~"PgOA@?eAe)W"@ klS" .ol@ԚBHM@:eH@:ege" `G@!J:H@0I08g!MpL@:een*MA:PT08ZJ@:e g0\`M@:e0g0g Ml@8eg"H@:e_" g@L@:eS*Gjeggj+`M*@bgjl0"!"Ț隐\@:epe"gg@8eR` 0@GMԚ  0@MԚ0l@?eG"Dh"ePTJAg'"H)@:e"H)@:e* )@L@:e*e)P!"o@:e")dC'e&!"BP\ M@:e*0 GH"ePTJAg0 H"ePTJAgNbgDJ`0!"@=e"ePTJAgP@:epg@?e 00`&LHJHkA,B M@:eao8e@3ngPTJ@:ePOP?eZH@jo5n@8ePThz J#:e@APAe@:eo6n@8eo3n@8ep\@:ek4!"17 % 2 / 6DP* H@8e"ePTJAg)}*"@kl}*a2no@:e Ҟe"Ag1PT J:e@0Aga6no@:e Ҟei"#"0 1@:eA#Ne=+#j, 10@:eAN M*Dl@:e0D@eA8#(@l"j0LJ "NbgDJ`0!"@=ej1h$@r`A 108@:e1AjeaH"1*0Da@@l"hj1j"NN j10LhJ A"CbgNJBa\h@:e1Cbgdj0&`LPJPC00Aj,BPT M J@:e *"@ kl * *0D @@l*d}"jd0L J ҳjrj"ePT JAgEbgGJ` M *p@@:e "H@:ee* "@ kl "GbgDJ a \"0D @88L@:ee*@*Hg@:e`""BȚ!HgpL@:ee"8.olԚBH1M@:eg00\@:e 0g`Ml@8ee0 "O{jP("@ kL#kl*DJ`H@:e"n*0LGJ!"Ț隐\@:e0e gg@8eR`nn"0LGJ0Hg@:eҞe"jI*P@:epg@?ee\gX "EbgjmE @|JT"F"P0њ@ mi L@?ejaQRSo")|*nmg@8ejl"00lGM@?ee"ePTJAg% decScee@jz @2ide\gPTJ@l@:egJe *\gT@:e@r`vd|gpX PTXa@ZaCa Jg@:e @kJklCEj @2ie|g d0$@ DJ "00Ml@?ej`@ @ABCDjTV*j\jj]|gDQDJQD@D@no@ j\gH@:eg@8ee*gT@:e@* j PTJl@:e Je*@ra\g @=e dj|gpXpT Za@Za Ca`gcabsa\g PTgJ@:e Ҟe@kkJl AO Q􄜮,s`sa#pa'@JsI saQlK\gL@:ekkegljn;e [`$ # @:eeZXgrXg ҷuaAu aA `[a cauagK ew s*a=$ JO E Z+`RoZ3 oL//o*jM$ "Q3e gӸg@:eesa™omnl@Za CaasaAos_a_+@KLJnmo;eZ`Lakl_*_%?& ?" @:eevq aCD `[aca!qaDK9g,kqj @2ie>dP@k@:eHegnl@:eHegnl@:eHegnl@:e0D @e`@jl?*b="Ll@:eJe!* @ @bg l|gP *`omn@8eTe@:e a` m3\c@:eJe"@b@:eJe"p`ad@8eaJe"\a@:ej 0L @Pj "gm)L@?ePHhno@@:ee"@`kL[xgsxgAs`s`C\asaknZXgrXg0LGJ C@v`aB *PD0𬙐gM@:eAe@ j 0LB B`saEFaDAPaXg@:e Ҡ"PPgo@:ee" h@H 0LDB`dpaI E*jE .o@ԚH+Gl@:eArea @#PD0Lg M@:ee @l?#`@jl *PX@:eJe? "P@:eJe *T@:e@JZea @h@@LJ* (\@:e\e@:eT@:e ` m@8ee0l@9es aknZXgrXg0LG JsaknZXgrXgjA0LGJsaj0LGJ0LGJ0LGJ0LGJ g@ȢPDM@:eAB Jne "PD0𬙐g|M@:eAe J J j  PDM@:e I DeJ"PD0 |M@:e Ie H hIAra jr`T @:ee"\ .m@:ee"aB N l`Pl@:eeh"(\@:e0𬙐TeM@:e Ҟe"*\@:eeTg@:eje5anbg1K[L!`omP `@8e0 @8ee* pTPL`nm@:e.kL#C6omJ*T@:e@re`(\@:eDem@:eDem@:e\e@:eeAkB[ ar `*D" @PT0>J :egL@g  H"V 0i gL@:e 0@eJ`PDg M@:e 0g@L` @:e 0gL@:eFMe * 00ggML@:ee\gPH *0̙ N@8e0̙ gN@8eg6*0̙  N@8e0̙ 'Ng@8e0̙ 'Ng@8e0̙ GNg@8e0̙ gNg@8e0̙ ggN@8eg0̙ gN8e@0̙ Ng@8e0̙ Ng@8eҞe\g0D\g0L J" @8eҞe0L@`PD+0IZ M@:eAr `I"@` 0:eL@gAra 0:eL@gAraj`@@l"0LgJ 0' L@:eeD`m@:eaBe #nMD`m@:ee\@:eAre a V@p\@:ee*. /mL ҂gPH@:ee]"B\"ArY`jҀT X@:eTe@:e`o m"ePTJAgmmm~H"H.o@l`̚H@:eg @:ee7mM@:e @`̚@8eJe"m;mG `蘦j "ePTFJAg0pdej @2ied`ICa\g \g@:e eA"C1`ICa\g\g@:eeA "E!`#a\g \g@:ege\g0\cxd` IC`iC` ICjX @2ied" ҄j\gnPTo Jl@:eei\gP\@:ege"j-Km*jM+(\gD N(iy(nm*wdBjKl Bjl*\gDn@:ee"\gPD @:ee"jMb"j,r an@:ee*JL""j,(*E҂g n@:ee"\gPDg@:ee"l `a#b+F*jM"Gg,*E*\gPDg@:ee"l`jab+F*jMcE*\gl00HM@?eeB*S`g`abbF*Dgj @2i deHg'g>aIj:a '\gL\g!L@:ee/**"("!O) egjmEPkg`|g0L$%x =$%x <$%x ;$%x :$%x 9$%x 8$%x 7$%x 6$%x 5$%x 4$%x 3$%x 2$%x 1$%x 0$%x /$%x .$%x -$%x ,$%x +$%x )$%x ($%x '$%x &$%x %$%x $$%x #$%x "$%x !$%x  $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x $%x  $%x  $%x  $%x  $%x  $%x $%x $%x $' 'otherunsupported DNSKEY algorithmunsupported DS digeststale answerforgedDNSSEC indeterminateDNSSEC bogusDNSSEC signature expiredDNSSEC sig not yet validDNSKEY missingRRSIG missingno zone key bit setNSEC(3) missingcached errornot readyblockedcensoredfilteredprohibitedstale NXDOMAINnot authoritativeno reachable authoritynetwork errorinvalid datasignature expired before validtoo earlyunsupported NSEC3 iterations valueuanble to conform to policysynthesizedupstream returned SERVFAILunknownconfig/etc/hostsAAAAdns_resultcould not get memorycannot create pipe: %sNo IPv4 address found for %sin-addrip6int%*/proc/self/fdfailed to allocate %d bytesmalloc: %s:%u %zu bytes at %xreallocfailed to reallocate %d bytes%s: %s:%u %zu bytes from %x to %xexpand_buf%s[%s]%s[type=%d]<%s>SERVFAILREFUSEDFORMERRnot implementedNXDOMAINNODATA-IPv4NODATA-IPv6NODATAipset addnftset addisfromcached-staletocachednon-query opcodeTCP UDP authreply%u (EDE: %s)#%u%s%u %s %s%s%s %s%s%s%u %s/%u %s %s%s%s %s%s%s %s%s%s %s%s6bind%s%u%s%llu%s%02x%02xsdsssdsszzzdtruncated%.2x%sfree: %s:%u block at %xfailed to load names from %s: %sbad address at %s line %dbad name at %s line %dread %s - %d names%ud%uh%um%usinfinitebad addressCannot resolve server namebad port#cannot use IPv4 server address with IPv6 source addressbad interface nameinterface can only be specified oncecannot use IPv6 server address with IPv4 source addressbad IPv4 prefix length%d.in-addr.arpabad IPv6 prefix length%.1x.ip6.arpanet:tag:set:option:bad dhcp-optionvendor:inappropriate vendor:encap:inappropriate encap:vi-encap:bad IP addressbad IPv4 addressbad domain in dhcp-optiondhcp-option too longNo vendor-encap options allowed in dhcp-option-pxeillegal dhcp-matchdnsmasq.dnsnetmasktime-offsetrouterdns-serverlog-serverlpr-serverhostnameboot-file-sizedomain-nameswap-serverroot-pathextension-pathip-forward-enablenon-local-source-routingpolicy-filtermax-datagram-reassemblydefault-ttlmtuall-subnets-localbroadcastrouter-discoveryrouter-solicitationstatic-routetrailer-encapsulationarp-timeoutethernet-encaptcp-ttltcp-keepalivenis-domainnis-serverntp-servervendor-encapnetbios-nsnetbios-ddnetbios-nodetypenetbios-scopex-windows-fsx-windows-dmrequested-addresslease-timeoption-overloadmessage-typeserver-identifierparameter-requestmessagemax-message-sizeT1T2vendor-classclient-idnis+-domainnis+-servertftp-serverbootfile-namemobile-ip-homesmtp-serverpop3-servernntp-serverirc-serveruser-classrapid-commitFQDNagent-infolast-transactionassociated-ipclient-archclient-interface-idclient-machine-idposix-timezonetzdb-timezoneipv6-onlycaptive-portalsubnet-selectdomain-searchsip-serverclassless-static-routevendor-id-encaptftp-server-addressserver-ip-addressMFSOAMBMGMRNULLWKSPTRHINFOMINFOMXTXTRPAFSDBX25ISDNRTNSAPNSAP_PTRSIGPXGPOSLOCNXTEIDNIMLOCSRVATMANAPTRKXCERTA6DNAMESINKOPTAPLDSSSHFPIPSECKEYRRSIGNSECDNSKEYDHCIDNSEC3NSEC3PARAMTLSASMIMEAHIPNINFORKEYTALINKCDSCDNSKEYOPENPGPKEYCSYNCZONEMDSVCBHTTPSDSYNCHHITBRIDSPFUINFOGIDUNSPECNIDL32L64LPEUI48EUI64NXNAMETKEYTSIGIXFRAXFRMAILBMAILAANYURICAAAVCDOAAMTRELAYRESINFOWALLETCLAIPNDLVfailed to bind server socket to %s: %sstdincannot execute %s: %scannot read %s: %serror executing %s: %s%s returns non-zero error codebad dynamic hostillegal repeated flagillegal repeated keywordcannot access directory %s: %s/cannot access %s: %suk.org.thekelleys.dnsmasqdnsmasqbad log facilitybad MX preferencebad MX namebad MX targetrecompile with HAVE_LUASCRIPT defined to enable Lua scriptsinvalid auth-zoneexclude:bad prefix lengthbad prefixprefix length too smalldeviceid:orgid:assetid:base64textBad address in --addressrecompile with HAVE_IPSET defined to enable ipset directivesrecompile with HAVE_NFTSET defined to enable nftset directivesrecompile with HAVE_CONNTRACK defined to enable connmark-allowlist directivesextraprotoonly_failedbad RR typebad port rangebad bridge-interfacebad shared-networkonly one tag allowedbad dhcp-rangestaticproxyinconsistent DHCP rangedeprecatedbad hex constantduplicate dhcp-host IP address %signoreDHCP host has multiple namesbad DHCP host namebad tag-ifenterprise:invalid port numberbad dhcp-proxy addressBad dhcp-relaymissing address in aliasinvalid alias rangemissing address in dynamic hostbad CNAMEduplicate CNAMEbad PTR recordbad NAPTR recordbad RR recordbad CAA recordbad TXT recordbad SRV recordbad SRV targetinvalid priorityinvalid weightBad host-recordBad name in host-recordunsupported option (check that dnsmasq was compiled with DHCP/TFTP/DNSSEC/DBus support)authprivcrondaemonkernlprmailmarknewssecuritysysloguseruucplocal0local1local2local3local4local5local6local7x86PCPC98IA64_EFIAlphaArc_x86Intel_Lean_ClientIA32_EFIx86-64_EFIXscale_EFIBC_EFIARM32_EFIARM64_EFImissing "bad optionextraneous parametermissing parameterillegal option"tnebr\ in output from %s at line %d of %sread %s=/etc/resolv.confnobody/var/run/dnsmasq.pid951yZDNLERKzowefnbvhdkqr:m:p:c:l:s:i:t:u:g:a:x:S:C:A:T:H:Q:I:B:F:G:O:M:X:V:U:j:P:J:W:Y:2:4:6:7:8:0:3:junk found in command lineKnown DHCP options:%3d %s Usage: dnsmasq [options] Valid options are:-%c, --%s%s%s%-55.55sCopyright (c) 2000-2026 Simon Kelley2.93Dnsmasq version %s %s Compile time options: %s This software comes with ABSOLUTELY NO WARRANTY.Dnsmasq is free software, and you are welcome to redistribute itunder the terms of the GNU General Public License, version 2 or 3.try --helpbad command line options: %s/etc/dnsmasq.confCNAME loop involving %shostmaster.PXEClientcannot get host-name: %sonly one resolv.conf file allowed in no-poll mode.must have exactly one resolv.conf to read domain from.failed to read %s: %s searchno search directive found in %ssrv-host name %s too long after domain appendedbad srv-host name %s after domain appendedthere must be a default domain when --dhcp-fqdn is setsyntax check OKdnsmasq: %s. duplicateversionno-hostsno-pollhelpno-daemonlog-queriesgroupresolv-fileservers-filemx-hostmx-targetcache-sizedhcp-leasefiledhcp-leasedhcp-hostdhcp-bootdomain-suffixlisten-addresslocal-servicebogus-privbogus-nxdomainignore-addressselfmxfilterwin2kfilter-Afilter-AAAAfilter-rrpid-filestrict-orderrev-serverconf-fileconf-scriptno-resolvexpand-hostslocalmxlocal-ttlno-negcacheno-round-robinno-0x20-encodedo-0x20-encodecache-rraddn-hostshostsdirquery-portexcept-interfaceno-dhcp-interfaceno-dhcpv4-interfaceno-dhcpv6-interfacedomain-neededdhcp-lease-maxbind-interfacesread-ethersaliasdhcp-vendorclassdhcp-userclassdhcp-ignoreedns-packet-maxkeep-in-foregrounddhcp-authoritativesrv-hostlocalise-queriestxt-recordcaa-recorddns-rrenable-dbusenable-ubusbootp-dynamicdhcp-macno-pingdhcp-scriptconf-dirlog-facilityleasefile-roscript-on-renewaldns-forward-maxclear-on-reloaddhcp-ignore-namesenable-tftptftp-securetftp-no-failtftp-unique-roottftp-roottftp-maxtftp-mtutftp-lowercasetftp-single-portptr-recordnaptr-recorddhcp-option-forcedhcp-option-pxetftp-no-blocksizelog-dhcplog-asyncdhcp-circuitiddhcp-remoteiddhcp-subscriddhcp-pxe-vendorinterface-namedhcp-hostsfiledhcp-optsfiledhcp-hostsdirdhcp-optsdirdhcp-no-overridetftp-port-rangestop-dns-rebindrebind-domain-okall-serversdhcp-name-matchdhcp-broadcastneg-ttlmax-ttlmin-cache-ttlmax-cache-ttldhcp-alternate-portdhcp-scriptusermin-portmax-portdhcp-fqdncnamepxe-promptpxe-servicetestdhcp-proxydhcp-generate-namesrebind-localhost-okadd-macstrip-macadd-subnetstrip-subnetadd-cpe-idproxy-dnssecdhcp-sequential-ipconntrackdhcp-client-updatedhcp-luascriptenable-radhcp-duidbind-dynamicauth-serverauth-ttlauth-soaauth-sec-serversauth-peeripsetnftsetconnmark-allowlist-enableconnmark-allowlistsynth-domaindnssectrust-anchordnssec-debugdnssec-check-unsigneddnssec-no-timecheckdnssec-timestampdnssec-limitsdhcp-split-relayra-paramquiet-dhcpquiet-dhcp6quiet-radns-loop-detectscript-arpdhcp-ttldhcp-reply-delaydhcp-rapid-commitdumpfiledumpmaskdhcp-ignore-cliddynamic-hostlog-debugumbrellaquiet-tftpport-limitfast-dns-retryuse-stale-cacheno-identmax-tcp-connectionsleasequerylog-mallocSpecify local address(es) to listen on.//Return ipaddr for all hosts in specified domains.Fake reverse lookups for RFC1918 private address ranges.Treat ipaddr as NXDOMAIN (defeats Verisign wildcard).Specify the size of the cache in entries (defaults to %s).$Specify configuration file (defaults to %s).Do NOT fork into the background: run in debug mode.Do NOT forward queries with no domain part.Return self-pointing MX records for local hosts.Expand simple names in /etc/hosts with domain-suffix.Don't forward spurious DNS requests from Windows hosts.Don't include IPv4 addresses in DNS answers.Don't include IPv6 addresses in DNS answers.Don't include resource records of the given type in DNS answers.,...Enable DHCP in the range given with lease duration.Change to this group after startup (defaults to %s).dipSet address or hostname for a specified machine.Read DHCP host specs from file.Read DHCP option specs from file.Read DHCP host specs from a directory.Read DHCP options from a directory.tag-expressionEvaluate conditional tag expression.Do NOT load %s file.Specify a hosts file to be read in addition to %s.Read hosts files from a directory.Specify interface(s) to listen on.Specify interface(s) NOT to listen on.set:,Map DHCP user class to tag.set:,Map RFC3046 circuit-id to tag.set:,Map RFC3046 remote-id to tag.Map RFC3993 subscriber-id to tag.[,...]Specify vendor class to match for PXE requests.tag:...Don't do DHCP for hosts with tag set.[=tag:...]Force broadcast replies for hosts with tag set.Do NOT fork into the background, do NOT run in debug mode.Assume we are the only DHCP server on the local network.Specify where to store DHCP leases (defaults to %s)./var/lib/misc/dnsmasq.leasesReturn MX records for local hosts.,,Specify an MX record.Specify BOOTP options to DHCP server.Do NOT poll %s file, reload only on SIGHUP.Do NOT cache failed search results.[=]Use expired cache data for faster reply.Use nameservers strictly in the order given in %s.Specify options to be sent to DHCP clients.DHCP option sent even if the client does not request it.DHCP option sent only to PXE clients.Specify port to listen for DNS requests on (defaults to 53).Maximum supported UDP packet size for EDNS.0 (defaults to %s).Log DNS queries.Force the originating port for upstream DNS queries.#portsSet maximum number of random originating ports for a query.Do NOT read resolv.conf.Specify path to resolv.conf (defaults to %s).Specify path to file with server= optionsSpecify address(es) of upstream servers with optional domains./,Specify address of upstream servers for reverse address queries//Never forward queries to specified domains.[,]Specify the domain to be assigned in DHCP leases.Specify default target in an MX record.Specify time-to-live in seconds for replies from /etc/hosts.Specify time-to-live in seconds for negative caching.Specify time-to-live in seconds for maximum TTL to send to clients.Specify time-to-live ceiling for cache.Specify time-to-live floor for cache.Retry DNS queries after this many milliseconds.Change to this user after startup. (defaults to %s).Map DHCP vendor class to tag.Display dnsmasq version and copyright information.,,Translate IPv4 addresses from upstream servers.,,...Specify a SRV record.Display this message. Use --help dhcp or --help dhcp6 for known DHCP options.Specify path of PID file (defaults to %s).Specify maximum number of DHCP leases (defaults to %s).&Answer DNS queries based on the interface a query was sent to.,[,,Specify PTR DNS record.,Give DNS name to IPv4 address of interface.Bind only to interfaces in use.Read DHCP static host information from %s./etc/ethers[=]Enable the DBus interface for setting upstream servers, etc.Enable the UBus interface.Do not provide DHCP on this interface, only provide DNS.Do not provide DHCPv6 on this interface.Do not provide DHCPv4 on this interface.[=tag:]...Enable dynamic address allocation for bootp.set:,Map MAC address (with wildcards) to option set.,..Treat DHCP requests on aliases as arriving from interface.|,Specify extra networks sharing a broadcast domain for DHCP[[/prefix>]]Enable RFC 4388 leasequery functions for DHCPv4Disable ICMP echo address checking in the DHCP server.Shell script to run on DHCP lease creation and destruction.pathLua script to run on DHCP lease creation and destruction.Run lease-change scripts as this user.Call dhcp-script with changes to local ARP table.Read configuration from all the files in this directory.Execute file and read configuration from stdin.|Log to this syslog facility or file. (defaults to DAEMON)Do not use leasefile.Maximum number of concurrent DNS queries. (defaults to %s)!Clear DNS cache when reloading %s.Ignore hostnames provided by DHCP clients.Do NOT reuse filename and server fields for extra DHCP options.[=[,]]Enable integrated read-only TFTP server.[,]Export files by TFTP only from the specified subtree.[=ip|mac]Add client IP or hardware address to tftp-root.Allow access only to files owned by the user running dnsmasq.Do not terminate the service if TFTP directories are inaccessible.Maximum number of concurrent TFTP transfers (defaults to %s).Maximum MTU to use for TFTP transfers.Disable the TFTP blocksize extension.Convert TFTP filenames to lowercase,Ephemeral port range for use by TFTP transfers.Use only one port for TFTP server.Extra logging for DHCP.[=]Enable async. logging; optionally set queue length.Stop DNS rebinding. Filter private IP ranges when resolving.Allow rebinding of 127.0.0.0/8, for RBL servers.Inhibit DNS-rebind protection on this domain.Always perform DNS queries to all servers.set:,Set tag if client includes matching option in request.set:,[*]Set tag if client provides given name.[=]Use alternative ports for DHCP.,Specify NAPTR DNS record.Specify lowest port available for DNS query transmission.Specify highest port available for DNS query transmission.Use only fully qualified domain names for DHCP clients.[=tag:]Generate hostnames based on MAC address for nameless clients.[=]...Use these DHCP relays as full proxies.,[,]Relay DHCP requests to a remote server,,,[,]Specify alias name for LOCAL DNS name.,[]Prompt to send to PXE clients.Boot service for PXE menu.Check configuration syntax.[=base64|text]Add requestor's MAC address to forwarded DNS queries.Strip MAC information from queries.[,]Add specified IP subnet to forwarded DNS queries.Strip ECS information from queries.Add client identification to forwarded DNS queries.Proxy DNSSEC validation results from upstream nameservers.Attempt to allocate sequential IP addresses to DHCP clients.Ignore client identifier option sent by DHCP clients.Copy connection-track mark from queries to upstream connections.Allow DHCP clients to do their own DDNS updates.Send router-advertisements for interfaces doing DHCPv6,Specify DUID_EN-type DHCPv6 server DUID,
[,]Specify host (A/AAAA and PTR) records,[][,],Specify host record in interface subnet,,,Specify certification authority authorization record,,[]Specify arbitrary DNS resource recordBind to interfaces in use - check for new interfaces,Export local names to global DNS,[...]Domain to export to global DNSSet TTL for authoritative replies[,...]Set authoritative zone information[,...]Secondary authoritative nameservers for forward domains[,...]Peers which are allowed to do zone transfer/[/...]/...Specify ipsets to which matching domains should be added/[/...]/...Specify nftables sets to which matching domains should be added[=]Enable filtering of DNS queries with connection-track marks.[/][,[/...]]Set allowed DNS patterns for a connection-track mark.,,[]Specify a domain and address range for synthesised namesActivate DNSSEC validation,[,]...Specify trust anchor key digest.Disable upstream checking for DNSSEC debugging.Ensure answers without DNSSEC are in unsigned zones.Don't check DNSSEC signature timestamps until first cache-reloadTimestamp file to verify system clock for DNSSEC,..Set resource limits for DNSSEC validation,[mtu:||off,][,][,]Set MTU, priority, resend-interval and router-lifetimeDo not log routine DHCP.Do not log routine DHCPv6.Do not log RA.Log debugging information.Accept queries only from directly-connected networks.Detect and remove DNS forwarding loops.Ignore DNS responses containing ipaddr.Set TTL in DNS responses with DHCP-derived addresses.Delay DHCP replies for at least number of seconds.Enables DHCPv4 Rapid Commit option.Path to debug packet dump file.Mask which packets to dump.Call dhcp-script when lease expiry changes.[=]Send Cisco Umbrella identifiers including remote IP.Do not log routine TFTP.Suppress round-robin ordering of DNS records.Suppress DNS bit 0x20 encoding.Enable DNS bit 0x20 encoding.Do not add CHAOS TXT records.Cache this DNS resource record type.Maximum number of concurrent tcp connections.Log memory allocation for debugging.LOUD WARNING: listening on %s may accept requests via interfaces other than %sLOUD WARNING: use --bind-dynamic rather than --bind-interfaces to avoid DNS amplification attacks via these interface(s)nameservercannot fork into background: %sfailed to create helper: %ssetting capabilities failed: %sfailed to change user-id to %s: %sfailed to change group-id to %s: %sfailed to open pidfile %s: %scannot open log %s: %sfailed to load Lua script: %sTFTP directory %s inaccessible: %scannot create timestamp file %s: %scannot access path %s: %sfailed to create inotify: %stoo many symlinks following %sdirectory %s for resolv-file is missing, cannot pollfailed to create inotify for %s: %scleared cachebad line at %s line %dignoring %s line %d, duplicate name or IP addressread %s - %d addressesMaximum number of concurrent DNS queries reached (max: %d)Maximum number of concurrent DNS queries to %s reached (max: %d)Case mismatch in DNS reply - check bit 0x20 encoding.stopped listening on %s(#%d): %s port %dfailed to create listening socket for %s: %slistening on %s port %dunqualified%.8xignoring nameserver %s - local interfaceignoring nameserver %s - cannot make/bind socket: %smore servers are defined but not loggedusing nameserver %s#%d for %s %s%s %sNOT using nameserver %s#%d - query loop detectedusing nameserver %s#%d(via %s)using nameserver %s#%dusing only locally-known addresses for %susing standard nameservers for %susing %d more local addressesusing %d more nameserversfailed to access %s: %sreading %sno servers found in %s, will retrytime %lucache size %d, %d/%d cache insertions re-used unexpired cache entries.queries forwarded %u, queries answered locally %uqueries answered from stale cache %upool memory in use %zu, max %zu, allocated %zuchild processes for TCP requests: in use %zu, highest since last SIGUSR1 %zu, max allowed %zu.server %s#%d: queries sent %u, retried %u, failed %u, nxdomain replies %u, avg. latency %umsHost Address Flags Expires Source------------------------------ ---------------------------------------- ---------- ------------------------ ------------TCP helper process %u died unexpectedlyscript process killed by signal %dscript process exited with status %dfailed to execute %s: %sexiting on receipt of SIGTERMNET_ADMINNET_RAWNET_BIND_SERVICE%s stateless on %s%.0s%.0s%s%s, static leases only on %.0s%s%s%.0s%s, proxy on subnet %.0s%s%.0s%.0s%s, IP range %s -- %s%s%.0senabledroot is secure modesingle port mode/dev/urandomfailed to seed the random number generator: %sIPv6 GNU-getopt no-DBus UBus no-i18n no-IDN DHCP no-DHCPv6 no-Lua TFTP no-conntrack no-ipset no-nftset no-auth no-DNSSEC no-ID loop-detect inotify dumpfile/dev/nullDNSSEC not available: set HAVE_DNSSEC in src/config.hconntrack support not available: set HAVE_CONNTRACK in src/config.hauthoritative DNS not available: set HAVE_AUTH in src/config.hmax_port cannot be smaller than min_portport_limit must not be larger than available port range--auth-server required when an auth zone is defined.cannot create netlink socket: %scannot set --bind-interfaces and --bind-dynamicfailed to find list of interfaces: %sunknown interface %sfailed to set SO_BINDTODEVICE on DHCP socket: %scannot create %s: %scannot open pipe %s: %sbad header in %sDBus not available: set HAVE_DBUS in src/config.hUBus error: %sfailed to bind server socket for %s: %sunknown user or group: %sprocess is missing required capability %scannot chdir to filesystem root: %s%d started, version %s DNS disabledstarted, version %s cachesize %dcache size greater than 10000 may cause performance issues, and is unlikely to be useful.started, version %s cache disabledDNS service limited to local subnetsDNS service limited to localhostcompile time options: %schown of PID file %s failed: please add capability CAP_CHOWNchown of PID file %s failed: %sUBus support enabled: connected to system busUBus support enabled: bus connection pendingwarning: failed to change owner of %s: %swarning: using interface %s insteadwarning: no addresses found for interface %swarning: interface %s does not currently existwarning: ignoring resolv-file flag because no-resolv is setwarning: no upstream servers configuredasynchronous logging enabled, queue limit is %d messages, lease time DHCP relay from %s via %sDHCP split-relay from %s to %s via %sDHCP relay from %s to %s via %sDHCP relay from %s to %sDHCP, sockets bound exclusively to interface %sTFTP %s%s %s %swarning: %s inaccessiblewarning: TFTP directory %s inaccessiblerestricting maximum simultaneous TFTP transfers to %dCannot set UBus listeners: no connectionerror binding DHCP socket to device %sinotify: %s removedinotify: %s new or modifiedinotify: flushed %u names read from %sconnected to system UBusCannot poll UBus listeners: no connectionDisconnecting from UBusDHCP range %s -- %s is not consistent with netmask %sDHCP relay address %s appears on more than one interfaceignoring query from non-local network %s (logged only once)ignoring query from non-local network %sTCP connection failed to %s#%dcannot create DHCP socket: %sfailed to set options on DHCP socket: %sfailed to set SO_REUSE{ADDR|PORT} on DHCP socket: %sfailed to bind DHCP server socket: %s%lu %.2x-%.2x %s %.2x:%.2x * agent-info %s vendorclass %s failed to write %s: %s (retry in %u s)unknown interface %s in bridge-interfaceDHCP packet received on %s which has no addressCannot send to server via interface %s: %sCannot broadcast DHCP relay via interface %s: %sbroadcast via %sDHCP relay at %s -> %sARP-cache injection failed: %sError sending DHCP packet to %s: %sIgnoring domain %s for DHCP host name %slease-change script name is too long inita+cannot open or create lease file %s: %svendorclass %764s %64s %255s %764signoring invalid line in lease database: %s %s %s %s ...ignoring invalid line in lease database, bad address: %stoo many stored leases%255s %255sfailed to parse lease database cleanlyfailed to read lease file %s: %scannot run lease-init script %s: %slease-init script returned exit code %scannot send DHCP/BOOTP option %d: no space left in packet%s.0%u %s(%s) %s%s%s%s%s%s%s(%s) %s%s%s%s%s%sDHCPACKdhcp.ackDHCPRELEASEdhcp.release, %u sent size:%3d option:%3d %s %sPXE menu too largecannot send RFC3925 option: too many options for enterprise number %d%d%s%s%s%u requested options: %s%u reply delay: %dnetlink returns error: %s%u bootfile name: %s%u server name: %s%u next server: %s%u broadcast responsewith subnet selectorviaknown-othernetknownignoredaddress in useno address availablewrong networkno address configuredno leases leftproxy-ignoredDHCPLEASEUNASSIGNEDDHCPLEASEUNKNOWNDHCPLEASEACTIVEunknown leaseno unique-idwrong server-IDlease not foundwrong addressaddress not availableaddress reservedstatic lease availableNOANSWERDHCPNAKcpewan-idno address range available for DHCP request %s %s%u available DHCP subnet: %s/%s%u available DHCP range: %s -- %s%u vendor class: %s%u user class: %sbootpBOOTP%u client provides name: %sPXE BIS not supported%s.%dPXEDHCPLEASEQUERYfrom DHCPDECLINEdisabling DHCP static address %s for %snot using configured address %s because it is leased to %snot using configured address %s because it is in use by the server or relaynot using configured address %s because it was previously declinedDHCPDISCOVERDHCPOFFERDHCPREQUESTabandoning lease to %s of %sDHCPINFORMleasequery from %s not permittedBUG: called iface_enumerate() in child processoldtftparp-addarp-delrelay-snoop1%luDNSMASQ_CLIENT_IDDNSMASQ_INTERFACEDNSMASQ_LEASE_EXPIRESDNSMASQ_DOMAINDNSMASQ_DATA_MISSINGDNSMASQ_VENDOR_CLASSDNSMASQ_SUPPLIED_HOSTNAMEDNSMASQ_CPEWAN_OUIDNSMASQ_CPEWAN_SERIALDNSMASQ_CPEWAN_CLASSDNSMASQ_CIRCUIT_IDDNSMASQ_SUBSCRIBER_IDDNSMASQ_REMOTE_IDDNSMASQ_REQUESTED_OPTIONSDNSMASQ_MUD_URLDNSMASQ_TAGSDNSMASQ_RELAY_ADDRESSDNSMASQ_USER_CLASS%iDNSMASQ_TIME_REMAININGDNSMASQ_OLD_HOSTNAMEDNSMASQ_LOG_DHCPblksizetsizewindowsizeerror %d %s received from %signoring packet from %s (TID mismatch)timeout sending %s to %sfailed sending %s to %ssent %s to %sexpand_workspace-dhcp-debug-tftpdnsmasq%s: <%d>%.15s dnsmasq%s[%d]: overflow: %d log entries lost/dev/loglog failed: %s0UBus subscription callback: %s subscriber(s)blob_buf_init(&b, BLOBMSG_TYPE_TABLE)UBus command failed: %d (%s)blobmsg_add_u32(&b, get_metric_name(i), daemon->metrics[i])ubus_send_reply(ctx, req, b.head)FAILED to start up%u tags: %sduplicate IP address %s (%s) in dhcp-config directive%s has more than one address in hostsfile, using %s for DHCPbad dynamic directory %s: %snot a directoryABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/failed to write packet dump%u dumping packet %u mask 0x%04xdumping packet %u mask 0x%04xCannot reconnect to UBus: %s%s.dnsblobmsg_add_string(&b, "mac", mac)blobmsg_add_string(&b, "ip", ip)blobmsg_add_string(&b, "name", name)blobmsg_add_string(&b, "interface", interface)ubus_notify(ubus, &ubus_object, type, b.head, -1)opcode%s is a CNAME, not giving it to the DHCP lease of %snot giving name %s to the DHCP lease of %s because the name exists in %s with address %sIgnoring duplicate dhcp-option %dfailed to send packet: %sunable to get free port for TFTPunsupported write request from %sempty filename in request from %soctetnetasciiunsupported request from %s%.2x-%.2x-%.2x-%.2x-%.2x-%.2x//..file %s not found for %sTFXHV%-30.30s %-40.40s %s%s%s%s%s%s%s%s%s%s %-24.24s %-40.40sInternal error in cache.discarding DNS reply: subnet option mismatchnameserver %s refused to do a recursive querypossible DNS-rebind attack detected: %smetricsdns_cache_inserteddns_cache_live_freeddns_queries_forwardeddns_auth_answereddns_local_answereddns_stale_answereddns_unanswereddnssec_max_crypto_usednssec_max_sig_faildnssec_max_workdhcp_ackdhcp_declinedhcp_discoverdhcp_informdhcp_nakdhcp_offerdhcp_releasedhcp_requestnoanswerleases_allocated_4leases_pruned_4leases_allocated_6leases_pruned_6tcp_connectionsdhcp_leasequerydhcp_lease_unassigneddhcp_lease_actvedhcp_lease_unknownparse_dhcp_optdhcp_opt_freedhcp_context_freedhcp_config_freedhcp_netid_list_freedhcp_netid_freedhcp_netid_createif_names_addcanonicalise_optopt_string_alloc123456  78 90abcdefABCDEF:,.get_line_allocprint_maccanonicalisequerystrread_hostsfilerehashstore_nameget_config_crec$*&!#2allocate_rfdget_new_frecforward_queryread_optsexpand_filelistone_optdhcp_read_ethersasync_eventread_eventdhcp_common_initmy_readlinkinotify_dnsmasq_initinotify_checkmaincheck_serversallocate_sfdclean_interfacesrelease_listeneriface_allowedfree_frecfree_rfdslease_add_extradatado_script_runlease_set_vendorclasslease_set_agent_idlease_set_hostnamekill_namelease_allocatedo_icmp_pingrecv_dhcp_packettcp_talktcp_requestdo_tcp_connectionfree_transferbuff_alloccreate_helpernetlink_recvpxe_optsdhcp_replyODNSdump_cache_entrylease_set_hwaddrreally_insertcheck_tftp_filepermtftp_requestadd_update_servercleanup_serversmark_serversbuild_server_arrayubus_initfind_macfilter_macadd_pseudoheaderrrfilterpoll_listenset_dynamic_inotifydyndir_addhostsblockdata_retrieveadd_blocks_^$,8@LX d 0p  0<P d!t"#$%&()*+ ,- . /00@1P2d3"p4 5$67 8 9 :;<= @ABC,D<EHFTG`JlMxPQ R [\]^adel r0v @w@Px\yt}       0(,0 4!<"@#H$P%T&\'`(h)p*t+x,|-./012345789:;<=>?@A B(C0D8c@dDefLgPhXi\j`kdlhmpx,v4h@nHwPd\q|uhgpr|MmtcpllGF OMssliaObB,R<eDfPq\rh}txoSL(ACvRELTNz |,H8VDQPId2x~DXzZVUjJP$k8KLWXylYxd61b3456789h0$4HT`Xp]5gXpe    , 8 H XhixTU* c,<D)LS\8l Y!"#$%T&'(+,t$E0s@ZL-\.p/|0123479:;<=> ?pm8nL@\IdJtKNPWCDFG HQ([4\@^T_h`tafjklowxy{ |Eu]EEEEEEFF,F@F0:PF\FlF|FFFFFFFFFGG$G4GLG`Gp< (P4H<PXDL0PX`8h t(|@ $08DaP,APThbBPcQXCP\dXdD eE (f`qPrP}PFPHXgQGPP\P\4TP\XUP\&PhHP\VP\(iPLXIPL|jP P PP<iP`pJPPkKTlQ\L mP (MP@PnxN yQoOP<HP<tP<pQPQqPXQQlwQRrP\MQ\4SPT`LPPsP4HtQ|TQQ)Q(8QlSQxQuQUP@v`VPWPw xQ\\XQyYPP0@PXlz Z1QbQ@2PL\~PLPL3P4P0HPxePP05`6Q\1PQ[5@7P\tvP\8Q900QHPP , PX h P   X4 Q` ]Q   5& Q $ g<T  x  Q   + *PH x P  cP  Q0 < P\ l  Q  YQ  !(P@P'PCPP"P0L#Pt$P%,PtD8EQ\tsCZQ-!."Df;/#0$2%43Ql4PjPdP@`6P7':Q(9PLd;Q<Q=P>P$<?PhpPmQ,8nPx@PI-8JPTlK/NPP.WQ\<Qp|DPF*(G+DH,`k>pOQQ2RP\Q^QT_9`Q\aQh=lQ,oBdzEJK{F|PQ8OhPXE $!' po01]po5!59X1qշ^ElUbY%! ugf1~!A.1 fex}M`9ijlicQ}c.qq|wvAni=!z*YW>ċ1^̋o4u1u!}xpdc|hehm|tp1yY@ȋ5w5>y?;p)ooio.EٷkU.Ձ(`ghQhIoopplelKiq5jy}h gh~ei}kkmŀmy e-dqYxɪ)kMոL< @V&'AIQ^%K Y.DP"Gg@@V> 00@@"/= 4@ +$v)KE@ 2Y@"88@>}umEfMS^l@WkZafm9P~sJC<y700@)P@_ \F=8__RLD_MAPmd5_endblobmsg_alloc_string_bufferblob_buf_freeblob_buf_initblobmsg_parseblobmsg_add_fieldblobmsg_check_attrmd5_hash_finimd5_beginblobmsg_open_nestedblob_nest_endblobmsg_add_string_buffer__clock_gettime64vfprintffcntlrecvmsgfputsstrchrstrlenvsyslog__errno_locationstderrstrcmppollfclosememsetfopenstrdupmemcmpreallocunlinksendmsgopenlogreadsetsockoptbindkillstrrchr__stack_chk_failsocketmallocmemcpyfgets__stack_chk_guardsnprintfmemmovewaitpidubus_add_objectubus_reconnectubus_freeubus_notifyubus_strerrorubus_connectubus_send_reply__divdi3__fixunsdfsi__udivdi3__floatunsidf__moddi3__register_frame_info__muldf3__deregister_frame_infoin6addr_anyioctlrecvinet_ptongetopt_longgetpidsleepopen_memstreamstrtoulmempcpyputenvsendisxdigitalarmntohlsignalstrncpyhtonlsendtofdopenforksscanfexecvindexntohsgethostnameatexitsetlogmaskfputchtonsdn_expanddn_compinet_ntopatoi_exitdaemon__libc_start_mainstrpbrkraisegetsocknameoptindoptarglibubox.so.20260213libubus.so.20251202libgcc_s.so.1libc.soGCC_3.0GCC_4.2.0GLIBC_2.09P&y O``' Wii a@@~0@~4@~8@~1P@~Q\@`@d@h@l@p@t@x@ |@ @ @ @ @@@@@@@@@@@@@@@@@ @!@"@#@$@%@&@(@)@*@+@,@-@.@/@0 @2@3@4@5@6 @7$@8(@9,@:0@;4@=8@><@?@@@D@AH@BL@CP@DT@EX@F\@G`@Hd@Ih@Jl@Kp@Lt@Mx@O|@P@R@S@T@U@V@W@X@Y@Z@[@\@]@^@_@`@a@b@c@d@e@f@g@h@i@j@k@l@m@n@o@p@q' ' d@Հe@/ejjjJ jj  j D B"J6Z `D3 m`iUGQQQQmQQ3Q7QQQQQQQQQQQQOQQQ#QQ QCQ;j!!. J*!  e!4/n@lAJ/L @H2I @@+*n.@ @/jE1 l. lkn MCg ҫlg*+l!a@f+kfځh /mg@ABCD/E2"+Z aga+lj !`n".e g*j !j@IjngoN/Rga IҢg L/" @ qC` Ca` CaX`g.!F0gg "gW*{@0e"g&*j !j@I JҢg L/" g l@ .yR_a_ !/0gg "gW*L)0e"g;*j!j@I/gbg1Cg u ML/?" @i/ C@` IC_a .g JI! 0gg"gW*` IC zde0@̗@d:mi/ " gJ@"A"2*n. "g `+n"%Cai+Qgxdg1*"u`'u1aB@g/ *"/@AN#( on  j*nj7L R gag1g 1"g0goni+dp/e "g gZg08gQgudiejz o yx z r | ui{j {`q~`rs`x@a@a@d@d@g@JiĠLĠ`@eeeeeeL \u`2 I@Qe+?Sg{3`Ccxg a.bCcxg c)dCcxg e$hCcxg ijCcxg klCcxg mnCcxg opCcxg q rCcxg stCcxguڠe@d$C@}gGGGJN2L2Ke3'(m:ea)oBj\@#`4ę+lcG`n".eeM_]a?meggMN=egevd0@@ؗ@З@d@-Ih@2mdg44MK@2$/M lM@2m44MO@2$/M C`@ +A@2/MrFadE@2m44MG@2$/M g g`+l'Bj I dAcaA@2M4B2 B0 @20M1  C ` -`n".e8nm/dE@2mf`3`3MG@2m, r `raHX aIh@24m4MK@2$/M(Ed@24m4MG@2$/Mg)(ja s*A@s"/g淂g/gg/g * v*A@a*+l A`anM.#AjH d@caA@2ꂠ7571 cS`-"n l.o# l/g(g) `+l `C".o/ l g`㣴+l Cb@2M`3B2m1JE"  Й/gg/gg/g +c`*ҍ r&a_at`@Ed@2m"B4@2MO1 1"j@Cb@2M`3B2m1JArnra_a ` \6aDgA]a@jg Eg*`ODO2J@Y an`6MmKCaL2#n. KD/m `c³jҰHX aUt@24m4MW@2$/M)Yx@24m4M[@2$/M)(_ a R*A@R"/gVVg/gg/g * U*A@@*+ jK`AnA#.AHk D@CaA@2ꂠ7571 G2` #nl .oI# l/ ()g0+l  к/g..g/gg/g +c`*Ү ra_at`@E@2 "B4@2MO1 1*kC@2M4B21JAnj@j  yde0@@ @@,@H@ @d@\@??dlBik{+CaNlvd耘0H0I1Hdg`CXg*`DEC`.n$/Eded@l&gUj*;egngP/o g`V`.#o@ܠ܀D.%{gڡڠ@B.${XgSځڀAF/"ocg``AU`@noT`@lmۡR`@lmڡڠ !NlNlN lN lNlNlNlNlNlNlNlNlNlN ljDAC a@0 0@2MPg1Cb@2M B2`3m1 DAiC `R aZ@`Z``r``~dkYra'e*NlN l!P+`P9aJZ5`D3 m`ie]]]]]]] 1]]]]]]]q_]]]]]y^p`_P$`Rp`SP `8p``@p` gB l/Spa rea ABL\a`ZW`p`gp`_pa Al ZHa@*rL`@*rD`eD`3MF@2@2m0M`D/N r-`gAj K DCCa@4MC@2M6B21B`G gI"A@kl* gNRlCb@2M`3B2m1JEtKaZIau+`C Ԅ0= J1A@2/Mra 32m1 g jN jKLsa *l`JZ`Ra`k``jKjl JM{ ra@`jl*nA .e Za r$`AD4@24M gB1 1pXg "P`pXg"parXg_*npmB[_`ejFkl_ ".n D jl?*gAlRe Al jl?*gA ls3aB3@4K1[-`n lRe bC@2M`3B2m1 JI B a `Aä@2m 6b`461`#ral r anAl Al ra A@ra raDr aEraOraA M`caC`gAKc`n& Z al* Ale ra ABLa`Jˏl* AlH AlD $Za$nT/A" Al6jҞ ra'e* eNl lBnRMf@gV`Dg@jAۊlg`ڐ.nl.nRg@ ajYZ[\]jX n.Raj jҀm n(/MR a /mRa`m/ nM/mRaqjj !h k@o n.Ra+e nm/" kӀAjK"n:m(/&Raj.j/0X.1Qn@)m2j(/Rqaij nm(/ Reaj n)m(/ RZaj 3n)m(/ R Oa/ gm(/nRAa /mR:a/mR 3anM/mR+aBj3jj*Ҁj@nj/R`!,/llj#.eTa/eT`jK/ed0@@@@@@@@@@c@ @e@ @e@ @e@ @e@d@c`Lِgj.ngf"oA/l90e>6..ngV".o/ l10e8 8 m7  DAM q D@CaaC`3날@2M5B21@ICa sata#..ng".o@/ l0eCb@2M`3B2m1JA j#.e~de0@\@<@t@T@L@l@d@,@8@D@H@P@X@d@p@t@x@ dgnQ/'g  mcxaL/j@.o M/ lF0eq'`D q-a@*A*B*C">;..ngm".og/ l60e7 5 e//PkJkl Feature options: -S Don't allow configuration via SLAAC (RAs) only -D Discard advertisements without any address or prefix proposed -N Mode for requesting addresses [try|force|none] -P <[pfx/]len> Request IPv6-Prefix (0 = auto) -F Force IPv6-Prefix -V Set vendor-class option (base-16 encoded) -u Set user-class option string -x : Add option opt (with value val) in sent packets (cumulative) Examples of IPv6 address, string and base-16 encoded options: -x dns:2001:2001::1,2001:2001::2 - option 23 -x 15:office - option 15 (userclass) -x 0x1f4:ABBA - option 500 -x 202:'"file"' - option 202 -c Override client-ID (base-16 encoded 16-bit type + value) -i Use a custom interface identifier for RA handling -r Options to be requested (comma-separated) -R Do not request any options except those specified with -r -s